EMLSAG00000001530, EMLSAG00000001530-684296 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000001530
Unique NameEMLSAG00000001530-684296
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
T F181 female
  1. PreAdult2
All animals with short and abnormal egg strings, few animals with no egg strings
-Missing-
30.10.2014 - 09:00
09.12.2014 (All day)
Homology
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:MTTP "Microsomal triglyceride transfer protein large subunit" species:9913 "Bos taurus" [GO:0005319 "lipid transporter activity" evidence=IEA] [GO:0005788 "endoplasmic reticulum lumen" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0006497 "protein lipidation" evidence=IEA] [GO:0006641 "triglyceride metabolic process" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0042953 "lipoprotein transport" evidence=IEA] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005794 GO:GO:0042632 GO:GO:0006497 GO:GO:0042953 GO:GO:0005788 GO:GO:0008289 GO:GO:0006641 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 EMBL:X78567 PIR:A46764 UniGene:Bt.64166 ProteinModelPortal:P55156 BindingDB:P55156 ChEMBL:CHEMBL2934 PaxDb:P55156 PRIDE:P55156 eggNOG:NOG272516 HOVERGEN:HBG006416 InParanoid:P55156 ArrayExpress:P55156 Uniprot:P55156)

HSP 1 Score: 107.457 bits (267), Expect = 1.388e-22
Identity = 175/733 (23.87%), Postives = 323/733 (44.07%), Query Frame = 0
Query:   43 NVSSETINFKVERASVWKKGEDEVVLY--TLTPTNERFLVHVSDSAKIVAIYFEGDKPH--KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDY--EIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPT---QLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKES---FINSL-SLICNN----IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDF--------LKMELSTGGLSGFIADKPD---PNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGS---METKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +V+ E +N +    S++K  +   ++    L       L+H+    KI   Y   ++P   +NL +G+ASLF  + +     + D+SGDC V Y+  +++++ ++K  D C  E       H   G T  ++       +D  ++ V   E    R   +     +I SRQ + L   +    + P  +   V  +I AV  KY     VG+       SK K  P+      +++  L+ ++L+  E  ++F++  K +R   ++  +  LK + NK +LPQ++D   S  T D+  A+L     +ST + +L ERF++A +          H   ++   L    + S F S  ++ES    I +L   +C N    +K   E     L    K  ++E  + Y+  L+N       +L E +  +       +     +    ++  D  +P + +E+K  +  I+    +  + +VR ++   +++NNP+   +  IL ++     E+  Y+++ +Q       P SK   ++L E++A    N+D  S +G S     Y E+  + ++ + L++  S + IL+ S L     NI  +        +++ +   GL   IA  PD    N DS A LS    L  V LRP   F+  S+L S   S S   M   + LL     + D        SGL     ++G L++DI+G++  SL+ + + + +
Sbjct:   79 DVNLENVNQQRGEKSIFKGKKSSQIIRKENLEAMQRPVLLHLIH-GKIKEFYSYQNEPAAIENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA-HQDKVTKIKALDSCKIERAGFTTPHQVLGVTSKATSVTTYKIEDSFVVAVLSEEIRALRLNFLQSIAGKIVSRQKLELKTTEASVRLKPGKQ---VAAIIKAVDSKYTAIPIVGQVF----QSKCKGCPSLSEHWQSIRKHLQPDNLSKAEAVRSFLAFIKHLRTAKKEEILQILKAE-NKEVLPQLVDAVTSAQTPDSLDAILDFLDFKSTESVILQERFLYACAFAS-------HPDEELLRALISKFKGS-FGSNDIRESVMIIIGALVRKLCQNQGCKLKGVIEAKKLILGGLEKAEKKEDIVMYLLALKN------ARLPEGIPLLLKYTETGEGPISHLAATTLQRYD--VPFITDEVKKTMNRIYHQNRKIHEKTVRTTAAAIILKNNPSYMEVKNILLSIGELPKEMNKYMLSIVQDILRFETPASKMVRQVLKEMVA---HNYDRFSKSGSSSAYTGYVERTSHSASTYSLDILYSGSGILRRSNL-----NIFQYIEKTPLHGIQVVIEAQGLEALIAATPDEGEENLDSYAGLSAL--LFDVQLRPVTFFNGYSDLMSKMLSASSDPMSVVKGLL----LLIDHSQELQLQSGLKANMDVQGGLAIDITGAMEFSLWYRESKTRV 771          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:MTTP "Microsomal triglyceride transfer protein large subunit" species:9913 "Bos taurus" [GO:0005319 "lipid transporter activity" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0006497 "protein lipidation" evidence=IEA] [GO:0006641 "triglyceride metabolic process" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0042953 "lipoprotein transport" evidence=IEA] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005783 GO:GO:0005794 GO:GO:0042632 GO:GO:0006497 GO:GO:0042953 GO:GO:0006641 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 TreeFam:TF328754 GeneTree:ENSGT00390000011412 OMA:RPVTFFN OrthoDB:EOG747PH9 EMBL:DAAA02016819 EMBL:DAAA02016820 EMBL:DAAA02016821 EMBL:DAAA02016822 PRIDE:F1MDA1 Ensembl:ENSBTAT00000015850 ArrayExpress:F1MDA1 Uniprot:F1MDA1)

HSP 1 Score: 107.457 bits (267), Expect = 1.473e-22
Identity = 175/733 (23.87%), Postives = 323/733 (44.07%), Query Frame = 0
Query:   43 NVSSETINFKVERASVWKKGEDEVVLY--TLTPTNERFLVHVSDSAKIVAIYFEGDKPH--KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDY--EIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPT---QLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKES---FINSL-SLICNN----IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDF--------LKMELSTGGLSGFIADKPD---PNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGS---METKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +V+ E +N +    S++K  +   ++    L       L+H+    KI   Y   ++P   +NL +G+ASLF  + +     + D+SGDC V Y+  +++++ ++K  D C  E       H   G T  ++       +D  ++ V   E    R   +     +I SRQ + L   +    + P  +   V  +I AV  KY     VG+       SK K  P+      +++  L+ ++L+  E  ++F++  K +R   ++  +  LK + NK +LPQ++D   S  T D+  A+L     +ST + +L ERF++A +          H   ++   L    + S F S  ++ES    I +L   +C N    +K   E     L    K  ++E  + Y+  L+N       +L E +  +       +     +    ++  D  +P + +E+K  +  I+    +  + +VR ++   +++NNP+   +  IL ++     E+  Y+++ +Q       P SK   ++L E++A    N+D  S +G S     Y E+  + ++ + L++  S + IL+ S L     NI  +        +++ +   GL   IA  PD    N DS A LS    L  V LRP   F+  S+L S   S S   M   + LL     + D        SGL     ++G L++DI+G++  SL+ + + + +
Sbjct:   86 DVNLENVNQQRGEKSIFKGKKSSQIIRKENLEAMQRPVLLHLIH-GKIKEFYSYQNEPAAIENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA-HQDKVTKIKALDSCKIERAGFTTPHQVLGVTSKATSVTTYKIEDSFVVAVLSEEIRALRLNFLQSIAGKIVSRQKLELKTTEASVRLKPGKQ---VAAIIKAVDSKYTAIPIVGQVF----QSKCKGCPSLSEHWQSIRKHLQPDNLSKAEAVRSFLAFIKHLRTAKKEEILQILKAE-NKEVLPQLVDAVTSAQTPDSLDAILDFLDFKSTESVILQERFLYACAFAS-------HPDEELLRALISKFKGS-FGSNDIRESVMIIIGALVRKLCQNQGCKLKGVIEAKKLILGGLEKAEKKEDIVMYLLALKN------ARLPEGIPLLLKYTETGEGPISHLAATTLQRYD--VPFITDEVKKTMNRIYHQNRKIHEKTVRTTAAAIILKNNPSYMEVKNILLSIGELPKEMNKYMLSIVQDILRFETPASKMVRQVLKEMVA---HNYDRFSKSGSSSAYTGYVERTSHSASTYSLDILYSGSGILRRSNL-----NIFQYIEKTPLHGIQVVIEAQGLEALIAATPDEGEENLDSYAGLSAL--LFDVQLRPVTFFNGYSDLMSKMLSASSDPMSVVKGLL----LLIDHSQELQLQSGLKANMDVQGGLAIDITGAMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:MTTP "Microsomal triglyceride transfer protein large subunit" species:9823 "Sus scrofa" [GO:0005319 "lipid transporter activity" evidence=IEA] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 TreeFam:TF328754 GeneTree:ENSGT00390000011412 OMA:RPVTFFN OrthoDB:EOG747PH9 EMBL:CU914340 Ensembl:ENSSSCT00000010052 Uniprot:F1S0Z3)

HSP 1 Score: 103.99 bits (258), Expect = 1.658e-21
Identity = 157/683 (22.99%), Postives = 301/683 (44.07%), Query Frame = 0
Query:   93 FEGDKPH-KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSE----DTMKHKLHDESGSTEWSSETLID------LKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKY-LTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIF--INPGEDNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDF--------LKMELSTGGLSGFIADKPD---PNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            ++ + P  +NL +G+ASLF  + +     + D+SGDC V Y+  +++++ ++K  D C  E     T    L   S +T  ++  + D      L ++   L++  ++ +  +        I S+Q + L       +  P  K    V  +I AV  KY     VG+   +              +++  L+ ++L+  E  ++F++  + +R   ++  +  LK + NK+ILPQ++D   S  T D+  A+L     +S +N +L ERF++A            H   ++   L    + S F S  ++ES +  +  +   +  NE        +     L    +  ++E  + Y+  L+N       +L E +  +      ++     +    ++  D+  P + +E+K  +  I+       + +VR ++   ++ NNP+   +  IL ++     E+  Y+++ +Q       P SK   R+L E++A    N+D  S +G S     Y E+G + ++ + L++  S + IL+ S L     NI  +        +++ +   GL   IA  PD    N DS A LS    L  V LRP   F+  S+L S   S S +    +      I  S  + +  SGL    +++G L++DISGS+  SL+ + + + +
Sbjct:  138 YQNEPPAIQNLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA-HQDKVTKIKALDSCTIERSGFTTRNQVLGVTSKATSVTTYKIEDSFVVAVLAEEIHALRLNFLQTIAGK--------IVSKQKLELK----TTEAGPRLKSGKQVAAIIKAVDSKYTAIPIVGQVFQSECKGCSSLS-QHWQSVRKHLQPDNLSKTEAVRSFLTFIQHLRTAKKEEILQILKAE-NKDILPQLVDAVTSAQTPDSLDAILDFLDFKSDSNIILQERFLYACGFAS-------HPDEELLRALISKFKGS-FGSNDIRESVMIIIGALVRKLCQNEGCKLKAVVDAKKLILGGLERAEKKEDTMMYLLALKN------ARLPEGIPLLLKYAEAAEGPISHLAVTTLQRYDA--PFITDEVKKTMNRIYHQTRKVHEKTVRTTAAAVILNNNPSYMEVKNILLSIGELPKEMNKYMLSIVQDILRFEMPASKMVRRVLKEMVA---HNYDRFSKSGSSSAYTGYIERGPHSASTYSLDILYSGSGILRRSNL-----NIFQYVGKTPLHAIQVVIEAQGLEALIAATPDEGEENLDSYAGLSPL--LFDVQLRPVTFFNGYSDLMSKMLSASSDPISVVKGLILLIDHSQELQL-QSGLKANMEVQGGLAIDISGSMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:MTTP "Microsomal triglyceride transfer protein large subunit" species:9823 "Sus scrofa" [GO:0005319 "lipid transporter activity" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005783 GO:GO:0008289 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 eggNOG:NOG272516 HOVERGEN:HBG006416 CTD:4547 HOGENOM:HOG000113688 KO:K14463 EMBL:AY217034 RefSeq:NP_999350.1 UniGene:Ssc.17221 ProteinModelPortal:Q865F1 PaxDb:Q865F1 GeneID:397381 KEGG:ssc:397381 Uniprot:Q865F1)

HSP 1 Score: 103.99 bits (258), Expect = 1.839e-21
Identity = 157/683 (22.99%), Postives = 301/683 (44.07%), Query Frame = 0
Query:   93 FEGDKPH-KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSE----DTMKHKLHDESGSTEWSSETLID------LKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKY-LTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIF--INPGEDNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDF--------LKMELSTGGLSGFIADKPD---PNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            ++ + P  +NL +G+ASLF  + +     + D+SGDC V Y+  +++++ ++K  D C  E     T    L   S +T  ++  + D      L ++   L++  ++ +  +        I S+Q + L       +  P  K    V  +I AV  KY     VG+   +              +++  L+ ++L+  E  ++F++  + +R   ++  +  LK + NK+ILPQ++D   S  T D+  A+L     +S +N +L ERF++A            H   ++   L    + S F S  ++ES +  +  +   +  NE        +     L    +  ++E  + Y+  L+N       +L E +  +      ++     +    ++  D+  P + +E+K  +  I+       + +VR ++   ++ NNP+   +  IL ++     E+  Y+++ +Q       P SK   R+L E++A    N+D  S +G S     Y E+G + ++ + L++  S + IL+ S L     NI  +        +++ +   GL   IA  PD    N DS A LS    L  V LRP   F+  S+L S   S S +    +      I  S  + +  SGL    +++G L++DISGS+  SL+ + + + +
Sbjct:  138 YQNEPPAIQNLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA-HQDKVTKIKALDSCTIERSGFTTRNQVLGVTSKATSVTTYKIEDSFVVAVLAEEIHALRLNFLQTIAGK--------IVSKQKLELK----TTEAGPRLKSGKQVAAIIKAVDSKYTAIPIVGQVFQSECKGCSSLS-QHWQSVRKHLQPDNLSKTEAVRSFLTFIQHLRTAKKEEILQILKAE-NKDILPQLVDAVTSAQTPDSLDAILDFLDFKSDSNIILQERFLYACGFAS-------HPDEELLRALISKFKGS-FGSNDIRESVMIIIGALVRKLCQNEGCKLKAVVDAKKLILGGLERAEKKEDTMMYLLALKN------ARLPEGIPLLLKYAEAAEGPISHLAVTTLQRYDA--PFITDEVKKTMNRIYHQTRKVHEKTVRTTAAAVILNNNPSYMEVKNILLSIGELPKEMNKYMLSIVQDILRFEMPASKMVRRVLKEMVA---HNYDRFSKSGSSSAYTGYIERGPHSASTYSLDILYSGSGILRRSNL-----NIFQYVGKTPLHAIQVVIEAQGLEALIAATPDEGEENLDSYAGLSPL--LFDVQLRPVTFFNGYSDLMSKMLSASSDPISVVKGLILLIDHSQELQL-QSGLKANMEVQGGLAIDISGSMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:Mttp "microsomal triglyceride transfer protein" species:10116 "Rattus norvegicus" [GO:0005319 "lipid transporter activity" evidence=ISO;IDA] [GO:0005783 "endoplasmic reticulum" evidence=ISO] [GO:0005791 "rough endoplasmic reticulum" evidence=IDA] [GO:0005794 "Golgi apparatus" evidence=ISO;IDA] [GO:0006497 "protein lipidation" evidence=IEA;ISO] [GO:0006629 "lipid metabolic process" evidence=ISO] [GO:0006641 "triglyceride metabolic process" evidence=IEA;ISO] [GO:0006869 "lipid transport" evidence=ISO;IDA] [GO:0016323 "basolateral plasma membrane" evidence=IDA] [GO:0031526 "brush border membrane" evidence=IDA] [GO:0031528 "microvillus membrane" evidence=IDA] [GO:0031988 "membrane-bounded vesicle" evidence=IDA] [GO:0034185 "apolipoprotein binding" evidence=IPI] [GO:0042157 "lipoprotein metabolic process" evidence=ISO;IDA] [GO:0042632 "cholesterol homeostasis" evidence=ISO;IEP] [GO:0042953 "lipoprotein transport" evidence=IEA;ISO] [GO:0043235 "receptor complex" evidence=ISO] [GO:0046982 "protein heterodimerization activity" evidence=IPI] [GO:0051592 "response to calcium ion" evidence=IEP] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 RGD:1308388 GO:GO:0005794 GO:GO:0031988 GO:GO:0051592 GO:GO:0005791 GO:GO:0016323 GO:GO:0042632 GO:GO:0042157 GO:GO:0006497 GO:GO:0042953 GO:GO:0006641 GO:GO:0031528 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 GO:GO:0031526 EMBL:CH473952 CTD:4547 KO:K14463 TreeFam:TF328754 GeneTree:ENSGT00390000011412 OMA:RPVTFFN OrthoDB:EOG747PH9 EMBL:AABR06020987 EMBL:AABR06020988 EMBL:AABR06020989 RefSeq:NP_001101197.1 UniGene:Rn.81556 Ensembl:ENSRNOT00000014631 GeneID:310900 KEGG:rno:310900 NextBio:662796 PRO:PR:D4A1W8 Uniprot:D4A1W8)

HSP 1 Score: 99.7525 bits (247), Expect = 3.950e-20
Identity = 163/689 (23.66%), Postives = 300/689 (43.54%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSE----DTMKHKLHDESGSTEWSSETLID------LKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPT---QLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQ---HSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRN----------IDYAQQEKLGENVLS-MANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL-KMEL-------STGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +NL +G+ASLF  + T     + D+SGDC V Y+ + +++++++K  D C  E     T    L   S +T  ++  + D      + ++     +  ++ +  +        I S+Q + L   +    +VP  +   V  VI A+  KYK    VG+ +     S  K  P+      +++  L+  +L+  E  ++F++  + +R    +  +  LK +  K +LPQ++D   S  T  + +A+L     +S ++ +L ERF++A     H   P          EL Q +       F+S  ++ES +  +  +   +  NE        E     L    K  ++E    Y+  L+N          + YA+    GE  +S +A  VL+   AS                 + +E+K  L  I+    +  + +VR ++   +++NNP+   +  IL ++     E+  Y++  +Q       P SK   R+L E+I     N+D  S +G S     Y E+  + ++ + L++  S + IL+ S L     NI  ++ K EL          GL G IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +    +      I  S  +    SGL     ++G L++DISGS+  SL+ + + + +
Sbjct:  146 ENLKRGLASLFQMQLTSGTTNEVDISGDCKVTYQAQ-QDKVVKIKALDTCKIERSGFTTANQVLGVTSKATSVTTYKIEDSFVTAVVAEETRAFALNFLQTVAGK--------IVSKQKLELKTTEAGPRMVPGKQ---VAGVIKAIDSKYKAIPIVGQVL----QSVCKGCPSLAEHWQSIRKHLEPENLSNAEAVQSFLAFIQHLRTSRREEILQILKAE-KKEVLPQLVDAVTSAQTPASLEAILDFLDFKSDSSIILQERFLYACGFASH---P--------DEELLQALLSKFKGSFASNDIRESVMIIIGALVRKLCQNEGCKLKAVVEAKKLILGGLEKPEKKEDTTMYLLALKNALLPEGIPLLLKYAEA---GEGPVSHLATTVLQRYDASF----------------ITDEVKKTLNRIYHQNRKVHEKTVRTTAAAVILKNNPSYMDVKNILLSIGELPKEMNKYMLTIVQDILHFEMPASKMIRRVLKEMIV---HNYDRFSKSGSSSAYTGYVERSPHAASTYSLDILYSGSGILRRSNL-----NIFQYIGKAELHGSQVVIEAQGLEGLIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPVSVVKGLILLIDHSQDIQ-LQSGLKANMDIQGGLAIDISGSMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:Mttp "microsomal triglyceride transfer protein" species:10090 "Mus musculus" [GO:0005319 "lipid transporter activity" evidence=ISO;IDA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005783 "endoplasmic reticulum" evidence=IDA] [GO:0005791 "rough endoplasmic reticulum" evidence=ISO] [GO:0005794 "Golgi apparatus" evidence=ISO;IDA] [GO:0006497 "protein lipidation" evidence=IDA] [GO:0006629 "lipid metabolic process" evidence=IDA] [GO:0006641 "triglyceride metabolic process" evidence=IDA] [GO:0006810 "transport" evidence=IEA] [GO:0006869 "lipid transport" evidence=ISO;IDA] [GO:0008202 "steroid metabolic process" evidence=IEA] [GO:0008203 "cholesterol metabolic process" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] [GO:0016323 "basolateral plasma membrane" evidence=ISO] [GO:0031526 "brush border membrane" evidence=ISO] [GO:0031528 "microvillus membrane" evidence=ISO] [GO:0031988 "membrane-bounded vesicle" evidence=ISO] [GO:0034185 "apolipoprotein binding" evidence=ISO] [GO:0042157 "lipoprotein metabolic process" evidence=ISO;IMP] [GO:0042632 "cholesterol homeostasis" evidence=IMP] [GO:0042953 "lipoprotein transport" evidence=IDA;IMP] [GO:0043235 "receptor complex" evidence=ISO] [GO:0046982 "protein heterodimerization activity" evidence=ISO] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 MGI:MGI:106926 GO:GO:0005783 GO:GO:0005794 GO:GO:0031988 GO:GO:0051592 GO:GO:0005791 GO:GO:0008203 GO:GO:0043235 GO:GO:0016323 GO:GO:0042632 GO:GO:0006497 GO:GO:0042953 GO:GO:0008289 GO:GO:0006641 GO:GO:0031528 EMBL:CH466532 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 GO:GO:0031526 eggNOG:NOG272516 HOVERGEN:HBG006416 CTD:4547 HOGENOM:HOG000113688 KO:K14463 TreeFam:TF328754 EMBL:L47970 EMBL:EU553486 EMBL:AK146553 EMBL:BC012686 RefSeq:NP_001156929.1 RefSeq:NP_032668.2 RefSeq:XP_006501165.1 RefSeq:XP_006501166.1 UniGene:Mm.2941 ProteinModelPortal:O08601 SMR:O08601 IntAct:O08601 MINT:MINT-1864006 STRING:10090.ENSMUSP00000029805 PhosphoSite:O08601 PaxDb:O08601 PRIDE:O08601 Ensembl:ENSMUST00000029805 Ensembl:ENSMUST00000098580 GeneID:17777 KEGG:mmu:17777 UCSC:uc008rmw.2 UCSC:uc008rmx.2 GeneTree:ENSGT00390000011412 InParanoid:Q91X33 OMA:RPVTFFN OrthoDB:EOG747PH9 ChiTaRS:MTTP NextBio:292509 PRO:PR:O08601 ArrayExpress:O08601 Bgee:O08601 CleanEx:MM_MTTP Genevestigator:O08601 Uniprot:O08601)

HSP 1 Score: 94.3597 bits (233), Expect = 1.859e-18
Identity = 158/669 (23.62%), Postives = 296/669 (44.25%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVEN-----LVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVA-----LKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSKRILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL-KMEL-------STGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +NL +G+ASLF  + +     + D+SGDC V Y+ + +++++++K  D C  E +     +   G +  ++ ++   K + S +   L E      L  +  + G  +I S+Q + L   +    ++P  +   V  VI AV  KYK    VG+ +      +R  K    +A     ++  L+  +L+  E  ++F++  + +R    +  +  LK +  K +LPQ++D   S  T D+ +A+L     +S ++ +L ERF++A      F T   H   ++   L    + S F+S  ++ES +  +  +   +  NE        E     L    K  ++E    Y+  L+N        L E +  +       +     + T  ++  D  +  + +E+K  L  I+    +  + +VR ++  A+I  NP+   +  IL ++     E+  Y++  +Q       P SK I   L      N+D  S +G S     Y E+    ++ + L++  S + IL+ S L     NI  ++ K EL          GL G IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +    +      I  S  +    SGL    +++G L++DISGS+  SL+ + + + +
Sbjct:  146 ENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQAQ-QDKVVKIKALDTCKIERSGFTTANQVLGVSSKAT-SVTTYKIEDSFVTAVLAEETRAFALNFQQTIAG--KIVSKQKLELKTTEAGPRMIPGKQ---VAGVIKAVDSKYKAIPIVGQVL------ERVCKGCPSLAEHWKSIRKNLEPENLSKAEAVQSFLAFIQHLRTSRREEILQILKAE-KKEVLPQLVDAVTSAQTPDSLEAILDFLDFKSDSSIILQERFLYACG----FAT---HPDEELLRALLSKFKGS-FASNDIRESVMIIIGALVRKLCQNEGCKLKAVVEAKKLILGGLEKPEKKEDTTMYLLALKN------ALLPEGIPLLLKYAEAGEGPVSHLATTVLQRYD--VSFITDEVKKTLNRIYHQNRKVHEKTVRTTA-AAVILKNPSYMDVKNILLSIGELPKEMNKYMLTVVQDILHFEMPASKMIRRVLKEMAVHNYDRFSKSGSSSAYTGYVERSPRAASTYSLDILYSGSGILRRSNL-----NIFQYIGKAELHGSQVVIEAQGLEGLIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPVSVVKGLILLIDHSQDIQ-LQSGLKANMEIQGGLAIDISGSMEFSLWYRESKTRV 777          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:Mtp "Microsomal triacylglycerol transfer protein" species:7227 "Drosophila melanogaster" [GO:0006641 "triglyceride metabolic process" evidence=ISS] [GO:0017129 "triglyceride binding" evidence=ISS] [GO:0006869 "lipid transport" evidence=IEA] [GO:0008525 "phosphatidylcholine transporter activity" evidence=IDA] [GO:0005811 "lipid particle" evidence=IDA] [GO:0035149 "lumen formation, open tracheal system" evidence=IMP] [GO:0008039 "synaptic target recognition" evidence=IMP] [GO:0042157 "lipoprotein metabolic process" evidence=IMP] [GO:0048813 "dendrite morphogenesis" evidence=IMP] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005811 GO:GO:0042157 GO:GO:0048813 GO:GO:0008039 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 GO:GO:0035149 eggNOG:NOG272516 OrthoDB:EOG747PH9 GO:GO:0008525 EMBL:AY050228 ProteinModelPortal:Q961S9 SMR:Q961S9 STRING:7227.FBpp0080968 PaxDb:Q961S9 PRIDE:Q961S9 FlyBase:FBgn0266369 InParanoid:Q961S9 Bgee:Q961S9 Uniprot:Q961S9)

HSP 1 Score: 92.4337 bits (228), Expect = 7.325e-18
Identity = 156/700 (22.29%), Postives = 288/700 (41.14%), Query Frame = 0
Query:   87 KIVAIYFEGDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDES--GSTEWSSETLI-DLKKDKSILKVELVENL---VKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDIATPPDS-KRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNK----LLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSE-SLKESFINSLSLICNN---------IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNI-DYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSI-LPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS---ELTSYVVNKL----QSNPKSKRIL-GELIASGHWN-WDVLSTNGQSL---SYFEKGKYFSTNFGLELSTNKILK--------ESYLHVSLPNISDFLKMELSTGGLSGFIADKPD-------PNDDSNAH-----LSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFG 729
            K++A +   D+   NL +GIASL   +    +  + DVSG C V Y  K+  ++ + K +C   D ++   H E   G T+ + ET+  +L  + ++L  E  EN    +   P +G +    +  ++L       + V + +  ++ + I ++ + Y+   +  D+     + K +    QL A  ++L+   +     A A++    + R   ++     L +  +  +LPQ++D+ G++ T D   A       ES   +    LLE+++ +L+   H     + H       LF  ++         L+ES I +L+ +            +K    YL   L S      +E  L Y+R L+N+ D A  E L E+  +           +  +   A++ + +  L   N   +    +IF       D+S R  + + ++   P  + LG  LD L ++    E+ +YV+ KL    +  P+ + +   EL+   H N ++VL   G +        +   F+      LST ++ +        E  LH      S F K+ + T GL   + D          P DD  +        +++S+    LRP   FS  +EL    W GS               D+    + +SG     ++ GA S+D++G V  SL+++ A + I    G
Sbjct:  117 KVIA-HTSKDQSLLNLERGIASLLQLRLDASQQEELDVSGLCRVSYNVKSSTKVEKTKRDCSLWD-LRVNYHPEEALGVTQQAQETVFYELSSEGTLLHAESQENHRLNLAAKPDVGSF---VKSSLILQHVSQGSEEVKQLQLGSLDKAIQSLLEWYRVFELESDVDGMISAIKEQTLEDQLKASLTELQSADVGKSSLALAYVKLIPLARITRQEQFEDLLTE--HSEVLPQLVDLLGAVQTFDAHNATFGFLYKESETTREQLDLLEKYLQSLAVATHPDRKIVEH-------LFGLLEQESIKKHLKLRESVIQTLATLTRQSGLDVEDPLLKEVRSYLLQGLTS------KEPTL-YIRALQNLQDPATIEALLEHAQT---------GEAPNLSVAALQALKAFPLGSFNSSHRLQFESIFYQRKRRFDSSARTLALDIILSLRPTQEQLGNFLDYLASNDRQFEIKTYVLQKLRMLAEKCPRFRALFKSELVKRRHVNNYNVLGQKGLTTVLTRQLSQAPAFNETL---LSTQEVYQGILKRGSVEFLLHAGRSQASSF-KLGIYTAGLGSLVGDGDSGDGNDGIPADDEFSEDEAVTAGMEISVQGAQLRPLVFFSGQTELMGHVWGGSASDSTPAYQATTLSQDNEHYIILTSGATLHWRVLGARSVDLNGKVGFSLWNRNAQTEIQQNTG 782          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:MTTP "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0005319 "lipid transporter activity" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0006497 "protein lipidation" evidence=IEA] [GO:0006641 "triglyceride metabolic process" evidence=IEA] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0042953 "lipoprotein transport" evidence=IEA] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005783 GO:GO:0005794 GO:GO:0042632 GO:GO:0006497 GO:GO:0042953 GO:GO:0006641 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 CTD:4547 KO:K14463 TreeFam:TF328754 GeneTree:ENSGT00390000011412 OMA:RPVTFFN OrthoDB:EOG747PH9 EMBL:AAEX03016784 RefSeq:XP_544995.3 Ensembl:ENSCAFT00000016783 GeneID:487873 KEGG:cfa:487873 NextBio:20861360 Uniprot:E2QXN6)

HSP 1 Score: 90.1225 bits (222), Expect = 3.210e-17
Identity = 146/667 (21.89%), Postives = 295/667 (44.23%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDY--EIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPT---QLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL--------KMELSTGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +NL +G+ASLF  + +     + D+SGDC V Y+  +++++ ++K  D C  E       +   G T   +       +D  ++ V   E    R   +      I S+Q + L   +    ++P  +   V  +I AV  +Y+    +G++      S+ K  P+      +++  L+ ++L+  E A+ F++  + +R    +  +  LK + NK +LPQ++D   S  T D+  A+L     +S ++ +L ERF++A            H   ++   L    + S F S  ++E+ +  +  +   +  NE        E     L    +  ++E  + Y+  L+N    +   L   +L  A    +++     + T  ++  D     + +E+K  L  ++    +  + +VR ++   ++ NNP+   +  IL ++     E+  Y++  +Q       P SK   R+L +++A    N+D  S +G S     Y  +  + ++ + L++  S + IL+ S L     NI  ++        ++ +   GL G IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +   S++     + D        SGL     ++G L++DISG++  SL+ + + + +
Sbjct:  146 ENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA-HQDKVTKIKALDSCKIERPGFTTSNQVLGVTSKGTAVTTYKIEDSFVIAVFAEEIHAFRMNFLPTIAGNIVSKQKLELKTTEAGPRLMPGKQ---VAAIIKAVNSEYRALPIMGQNF----QSECKGCPSLAEHWQSIRKHLQPDNLSKAEAARNFLAFIQHLRTAKREEILQILKAE-NKEVLPQLVDAVTSAQTSDSLDAILDFLDFKSDSSIVLQERFLYACGFAS-------HPDEELLRALISKFKGS-FGSNDIRETVMIIIGALVRKLCQNEGCKLKAVIEAKKLILGGLERTEKKEDTMMYLLALKNALLPEGIPL---LLKYA----EAEGPVSHLATTTLQRYDVHF--ITDEVKKTLNRVYHQNRKVHEKTVRTTAATIILNNNPSYMEVKNILLSIGELPKEMNKYMLAVVQDILRFETPASKMVRRVLKDMLA---HNYDRFSKSGSSSAYTGYITRAPHLASTYSLDILYSGSGILRRSNL-----NIFQYIGKSHLHSSQVVIEAQGLEGLIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDP-VSVVKGLILLTDHSQELQLQSGLKANMDVQGGLAIDISGAMEFSLWYRESKTRV 777          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:MTTP "Microsomal triglyceride transfer protein large subunit" species:9606 "Homo sapiens" [GO:0005319 "lipid transporter activity" evidence=IEA] InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 UniGene:Hs.195799 GeneID:4547 KEGG:hsa:4547 CTD:4547 HGNC:HGNC:7467 KO:K14463 OMA:RPVTFFN OrthoDB:EOG747PH9 EMBL:AC083902 RefSeq:XP_005263082.1 ProteinModelPortal:E9PBP6 Ensembl:ENST00000511045 UCSC:uc011cej.2 NextBio:35501439 ArrayExpress:E9PBP6 Bgee:E9PBP6 Uniprot:E9PBP6)

HSP 1 Score: 89.3521 bits (220), Expect = 7.172e-17
Identity = 153/667 (22.94%), Postives = 298/667 (44.68%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DEC-LSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKV--ELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVALKSKLKY---NSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLI---CNN----IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL--------KMELSTGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +N+ +G+ASLF  + +     + D+SG+C V Y+  ++++++++K  D C ++             S++ +S T   ++ D  ++ V  E   N           +I S+Q + L   +    ++   +      +I AV  KY     VG+       S  K  P+     +S  KY   ++L+  E  + F++  + +R   ++  +  LK + NK +LPQ++D   S  T D+ +A+L     +S ++ +L ERF++A            H + ++   L    + S  SS+  +   I + +L+   C N    +K+  E     L    K  ++E    Y+  L+N        L E + S+       +     + T A++  D  LP + +E+K  L  I+    +  + +VR ++   ++ NNP+   +  IL ++     E+  Y++  +Q       P SK   R+L E++A    N+D  S +G S     Y E+    ++ + L++  S + IL+ S L     NI  ++        ++ +   GL   IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +    +      I  S  + +  SGL    +++G L++DISG++  SL+ + + + +
Sbjct:  173 ENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQA-HQDKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIE-DSFVIAVLAEETHNFGLNFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQ---AAAIIKAVDSKYTAIPIVGQVF----QSHCKGCPSLSELWRSTRKYLQPDNLSKAEAVRNFLAFIQHLRTAKKEEILQILKME-NKEVLPQLVDAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFAS-------HPNEELLRALISKFKGSIGSSDIRETVMIITGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKN------ALLPEGIPSLLKYAEAGEGPISHLATTALQRYD--LPFITDEVKKTLNRIYHQNRKVHEKTVRTAAAAIILNNNPSYMDVKNILLSIGELPQEMNKYMLAIVQDILRFEMPASKIVRRVLKEMVAH---NYDRFSRSGSSSAYTGYIERSPRSASTYSLDILYSGSGILRRSNL-----NIFQYIGKAGLHGSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPISVVKGLILLIDHSQELQL-QSGLKANIEVQGGLAIDISGAMEFSLWYRESKTRV 805          
BLAST of EMLSAG00000001530 vs. GO
Match: - (symbol:MTTP "Microsomal triglyceride transfer protein large subunit" species:9606 "Homo sapiens" [GO:0005319 "lipid transporter activity" evidence=TAS] [GO:0005788 "endoplasmic reticulum lumen" evidence=TAS] [GO:0005791 "rough endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0006497 "protein lipidation" evidence=IEA] [GO:0006629 "lipid metabolic process" evidence=TAS] [GO:0006641 "triglyceride metabolic process" evidence=IEA] [GO:0008289 "lipid binding" evidence=IEA] [GO:0016323 "basolateral plasma membrane" evidence=IEA] [GO:0031526 "brush border membrane" evidence=IEA] [GO:0031528 "microvillus membrane" evidence=IEA] [GO:0031988 "membrane-bounded vesicle" evidence=IEA] [GO:0034185 "apolipoprotein binding" evidence=IEA] [GO:0042157 "lipoprotein metabolic process" evidence=TAS] [GO:0042632 "cholesterol homeostasis" evidence=IEA] [GO:0042953 "lipoprotein transport" evidence=IEA] [GO:0043235 "receptor complex" evidence=IDA] [GO:0044281 "small molecule metabolic process" evidence=TAS] [GO:0046982 "protein heterodimerization activity" evidence=IEA] [GO:0051592 "response to calcium ion" evidence=IEA] Reactome:REACT_111217 InterPro:IPR001747 InterPro:IPR011030 InterPro:IPR015816 InterPro:IPR015819 Pfam:PF01347 PROSITE:PS51211 SMART:SM00638 GO:GO:0005794 GO:GO:0031988 GO:GO:0044281 GO:GO:0051592 GO:GO:0005791 GO:GO:0006629 GO:GO:0043235 GO:GO:0016323 GO:GO:0042632 GO:GO:0042157 GO:GO:0006497 GO:GO:0042953 GO:GO:0005788 GO:GO:0008289 GO:GO:0006641 GO:GO:0031528 Orphanet:426 GO:GO:0005319 Gene3D:1.25.10.20 Gene3D:2.30.230.10 SUPFAM:SSF48431 SUPFAM:SSF56968 GO:GO:0031526 DrugBank:DB01094 eggNOG:NOG272516 HOVERGEN:HBG006416 EMBL:X75500 EMBL:X59657 EMBL:X83013 EMBL:X83014 EMBL:X83015 EMBL:X83016 EMBL:X83017 EMBL:X83018 EMBL:X83019 EMBL:X83020 EMBL:X83021 EMBL:X83022 EMBL:X83023 EMBL:X83024 EMBL:X83025 EMBL:X83026 EMBL:X83027 EMBL:X83028 EMBL:X83029 EMBL:X83030 EMBL:AK290793 EMBL:BC125110 EMBL:BC125111 PIR:I38047 RefSeq:NP_000244.2 UniGene:Hs.195799 ProteinModelPortal:P55157 BioGrid:110641 MINT:MINT-1537333 STRING:9606.ENSP00000265517 BindingDB:P55157 ChEMBL:CHEMBL2569 PhosphoSite:P55157 DMDM:1709167 PaxDb:P55157 PRIDE:P55157 Ensembl:ENST00000265517 Ensembl:ENST00000457717 GeneID:4547 KEGG:hsa:4547 UCSC:uc003hvc.4 CTD:4547 GeneCards:GC04P100485 HGNC:HGNC:7467 HPA:HPA054862 MIM:157147 MIM:200100 neXtProt:NX_P55157 Orphanet:14 PharmGKB:PA164742099 HOGENOM:HOG000113688 InParanoid:P55157 KO:K14463 PhylomeDB:P55157 TreeFam:TF328754 GeneWiki:Microsomal_triglyceride_transfer_protein GenomeRNAi:4547 NextBio:17529 PRO:PR:P55157 ArrayExpress:P55157 Bgee:P55157 CleanEx:HS_MTTP Genevestigator:P55157 Uniprot:P55157)

HSP 1 Score: 88.1965 bits (217), Expect = 1.460e-16
Identity = 153/667 (22.94%), Postives = 298/667 (44.68%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DEC-LSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKV--ELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVALKSKLKY---NSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLI---CNN----IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL--------KMELSTGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +N+ +G+ASLF  + +     + D+SG+C V Y+  ++++++++K  D C ++             S++ +S T   ++ D  ++ V  E   N           +I S+Q + L   +    ++   +      +I AV  KY     VG+       S  K  P+     +S  KY   ++L+  E  + F++  + +R   ++  +  LK + NK +LPQ++D   S  T D+ +A+L     +S ++ +L ERF++A            H + ++   L    + S  SS+  +   I + +L+   C N    +K+  E     L    K  ++E    Y+  L+N        L E + S+       +     + T A++  D  LP + +E+K  L  I+    +  + +VR ++   ++ NNP+   +  IL ++     E+  Y++  +Q       P SK   R+L E++A    N+D  S +G S     Y E+    ++ + L++  S + IL+ S L     NI  ++        ++ +   GL   IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +    +      I  S  + +  SGL    +++G L++DISG++  SL+ + + + +
Sbjct:  146 ENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQA-HQDKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIE-DSFVIAVLAEETHNFGLNFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQ---AAAIIKAVDSKYTAIPIVGQVF----QSHCKGCPSLSELWRSTRKYLQPDNLSKAEAVRNFLAFIQHLRTAKKEEILQILKME-NKEVLPQLVDAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFAS-------HPNEELLRALISKFKGSIGSSDIRETVMIITGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKN------ALLPEGIPSLLKYAEAGEGPISHLATTALQRYD--LPFITDEVKKTLNRIYHQNRKVHEKTVRTAAAAIILNNNPSYMDVKNILLSIGELPQEMNKYMLAIVQDILRFEMPASKIVRRVLKEMVA---HNYDRFSRSGSSSAYTGYIERSPRSASTYSLDILYSGSGILRRSNL-----NIFQYIGKAGLHGSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPISVVKGLILLIDHSQELQL-QSGLKANIEVQGGLAIDISGAMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. C. finmarchicus
Match: gi|592857657|gb|GAXK01099905.1| (TSA: Calanus finmarchicus comp253228_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 95.5153 bits (236), Expect = 2.580e-19
Identity = 126/521 (24.18%), Postives = 239/521 (45.87%), Query Frame = 0
Query:  225 LTVKEVIDAVAKKYKTSFVGEDIATPPDSKRK---FKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHXXXXXXXXXXXXINSLSLICNNIKSNEEYLNWFL----DSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNL-IADSELTSYVVNKLQSNPKSKRILGEL---IASGHWNWDVLSTNGQSLSYF--------EKGKYFSTNFGLELSTNKILKESYLHVS--LPNISDFLKMELSTGGLSGFIADKPDPNDDSNAHXXXXXXXXXXXXRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            L+++EV+D      K + +G DI    D K +       Q++ +K  ++     + EG+KAF+S   +++ I +  A + +     K +   ++D     + +   + +  V   ++ N  LLER++ +L     F  P    +  + SEL + I+       ++KE+ I SL  +   ++ +E+ +        DS   C    C     R++  +    ++   + ++  A      DK ++ M   A+     +     +++   L++IF+N  E    R+++F ++     +A    ++L N+   D +L+S+V  KL  N     +LG+    +     N+D LS    + S F        E  K     F L +  N + + S++  +    N ++ L+++   GGLS ++    DP DD + + SVQLS+L +PLRPF LFSS  +L  +Y SG+ +   S ++ +  + D       S+GL    +   A+S D SG   VS++SQT  + +
Sbjct:  854 LSLREVLDLTEGNEK-NVIGNDIKKETDIKDQEEIINAAQILLVK--IQKTKAVSVEGSKAFLSLVALLKSITKANAEAVISKFKTKKVFKHLVDAAAGSNNVHLHQNLFKVL-SKNKNKALLERYLISLG----FINP----NPDLVSELAKDIETIPEKDVNVKETAIYSLCRLVGKLEDSEKLVKSVFRLVRDSAPDCKSVGC---QKRMVNCVAALGKDSYTKQLVQQAKT--SQDKLAREMAIMALGKPGLVPENQAQKVDEELLSIFMNEDERTVDRLAAFNSI---KLDADASKKVLKNIGRKDKDLSSFVSQKLAQN-----VLGQTDQDMKMTILNYDFLSLQNSAQSVFVSKDIADIETAKV-GFAFSLIMKGNALKRTSFVLKTEEKENGNEILRLDSVVGGLSSYVG-AADPQDDPDPNASVQLSILGLPLRPFTLFSSFGDLFDMYMSGAADKLTSFISGSVLLLDKQETFPLSNGLELSIKATAAISFDFSGKGEVSIWSQTGKTHV 2335          
BLAST of EMLSAG00000001530 vs. C. finmarchicus
Match: gi|592822310|gb|GAXK01132258.1| (TSA: Calanus finmarchicus comp26304_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 33.8834 bits (76), Expect = 3.184e+0
Identity = 15/56 (26.79%), Postives = 31/56 (55.36%), Query Frame = 0
Query:  486 LMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNLI--ADSELTSYVVNKLQ 539
             + +F+N  E + VRI++F+ L+   P+     +I+  +I   D+E+ +YV    +
Sbjct: 2942 FLPVFLNRNEGHEVRIAAFDMLMRATPSTTTFNKIMTFMIYETDNEVFNYVYTAFE 3109          
BLAST of EMLSAG00000001530 vs. C. finmarchicus
Match: gi|592869582|gb|GAXK01087980.1| (TSA: Calanus finmarchicus comp3807147_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 30.4166 bits (67), Expect = 9.385e+0
Identity = 31/95 (32.63%), Postives = 42/95 (44.21%), Query Frame = 0
Query:  187 ENLVKRDPLMGDYEIESRQDIMLS-----EYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFV----GEDIATPPDSKRKFKP-TQLVALKSKLKY 271
            E+ + R P+  D E    Q   LS     EY+FID     D  L  K +  A+ + YK   V    G DI  P   KR  K    ++ + +KLKY
Sbjct:   50 ESFIPRVPIGVDTEHYKNQFDKLSASEKKEYNFIDRTPELDGDLVEKTIYSALKRFYKKKEVVVLQGADILIPAAKKRGLKQEMDMIIINNKLKY 334          
BLAST of EMLSAG00000001530 vs. L. salmonis peptides
Match: EMLSAP00000001530 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1263:7207:10466:1 gene:EMLSAG00000001530 transcript:EMLSAT00000001530 description:"maker-LSalAtl2s1263-augustus-gene-0.4")

HSP 1 Score: 1554.27 bits (4023), Expect = 0.000e+0
Identity = 766/766 (100.00%), Postives = 766/766 (100.00%), Query Frame = 0
Query:    1 MYYYKTPTLSTVVVVVVGIFLGHTVSGETVVQKYEYSXAWFANVSSETINFKVERASVWKKGEDEVVLYTLTPTNERFLVHVSDSAKIVAIYFEGDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNLIADSELTSYVVNKLQSNPKSKRILGELIASGHWNWDVLSTNGQSLSYFEKGKYFSTNFGLELSTNKILKESYLHVSLPNISDFLKMELSTGGLSGFIADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSLVGIWKEETLISNIHEGSGKVVLDMEGDIRI 766
            MYYYKTPTLSTVVVVVVGIFLGHTVSGETVVQKYEYSXAWFANVSSETINFKVERASVWKKGEDEVVLYTLTPTNERFLVHVSDSAKIVAIYFEGDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNLIADSELTSYVVNKLQSNPKSKRILGELIASGHWNWDVLSTNGQSLSYFEKGKYFSTNFGLELSTNKILKESYLHVSLPNISDFLKMELSTGGLSGFIADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSLVGIWKEETLISNIHEGSGKVVLDMEGDIRI
Sbjct:    1 MYYYKTPTLSTVVVVVVGIFLGHTVSGETVVQKYEYSXAWFANVSSETINFKVERASVWKKGEDEVVLYTLTPTNERFLVHVSDSAKIVAIYFEGDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNLIADSELTSYVVNKLQSNPKSKRILGELIASGHWNWDVLSTNGQSLSYFEKGKYFSTNFGLELSTNKILKESYLHVSLPNISDFLKMELSTGGLSGFIADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSLVGIWKEETLISNIHEGSGKVVLDMEGDIRI 766          
BLAST of EMLSAG00000001530 vs. SwissProt
Match: gi|1709166|sp|P55156.1|MTP_BOVIN (RecName: Full=Microsomal triglyceride transfer protein large subunit; Flags: Precursor)

HSP 1 Score: 107.457 bits (267), Expect = 1.086e-22
Identity = 175/733 (23.87%), Postives = 323/733 (44.07%), Query Frame = 0
Query:   43 NVSSETINFKVERASVWKKGEDEVVLY--TLTPTNERFLVHVSDSAKIVAIYFEGDKPH--KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDY--EIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPT---QLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKES---FINSL-SLICNN----IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDF--------LKMELSTGGLSGFIADKPD---PNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGS---METKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +V+ E +N +    S++K  +   ++    L       L+H+    KI   Y   ++P   +NL +G+ASLF  + +     + D+SGDC V Y+  +++++ ++K  D C  E       H   G T  ++       +D  ++ V   E    R   +     +I SRQ + L   +    + P  +   V  +I AV  KY     VG+       SK K  P+      +++  L+ ++L+  E  ++F++  K +R   ++  +  LK + NK +LPQ++D   S  T D+  A+L     +ST + +L ERF++A +          H   ++   L    + S F S  ++ES    I +L   +C N    +K   E     L    K  ++E  + Y+  L+N       +L E +  +       +     +    ++  D  +P + +E+K  +  I+    +  + +VR ++   +++NNP+   +  IL ++     E+  Y+++ +Q       P SK   ++L E++A    N+D  S +G S     Y E+  + ++ + L++  S + IL+ S L     NI  +        +++ +   GL   IA  PD    N DS A LS    L  V LRP   F+  S+L S   S S   M   + LL     + D        SGL     ++G L++DI+G++  SL+ + + + +
Sbjct:   79 DVNLENVNQQRGEKSIFKGKKSSQIIRKENLEAMQRPVLLHLIH-GKIKEFYSYQNEPAAIENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA-HQDKVTKIKALDSCKIERAGFTTPHQVLGVTSKATSVTTYKIEDSFVVAVLSEEIRALRLNFLQSIAGKIVSRQKLELKTTEASVRLKPGKQ---VAAIIKAVDSKYTAIPIVGQVF----QSKCKGCPSLSEHWQSIRKHLQPDNLSKAEAVRSFLAFIKHLRTAKKEEILQILKAE-NKEVLPQLVDAVTSAQTPDSLDAILDFLDFKSTESVILQERFLYACAFAS-------HPDEELLRALISKFKGS-FGSNDIRESVMIIIGALVRKLCQNQGCKLKGVIEAKKLILGGLEKAEKKEDIVMYLLALKN------ARLPEGIPLLLKYTETGEGPISHLAATTLQRYD--VPFITDEVKKTMNRIYHQNRKIHEKTVRTTAAAIILKNNPSYMEVKNILLSIGELPKEMNKYMLSIVQDILRFETPASKMVRQVLKEMVA---HNYDRFSKSGSSSAYTGYVERTSHSASTYSLDILYSGSGILRRSNL-----NIFQYIEKTPLHGIQVVIEAQGLEALIAATPDEGEENLDSYAGLSAL--LFDVQLRPVTFFNGYSDLMSKMLSASSDPMSVVKGLL----LLIDHSQELQLQSGLKANMDVQGGLAIDITGAMEFSLWYRESKTRV 771          
BLAST of EMLSAG00000001530 vs. SwissProt
Match: gi|46396062|sp|Q865F1.1|MTP_PIG (RecName: Full=Microsomal triglyceride transfer protein large subunit; Flags: Precursor)

HSP 1 Score: 103.99 bits (258), Expect = 1.440e-21
Identity = 157/683 (22.99%), Postives = 301/683 (44.07%), Query Frame = 0
Query:   93 FEGDKPH-KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSE----DTMKHKLHDESGSTEWSSETLID------LKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKY-LTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIF--INPGEDNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDF--------LKMELSTGGLSGFIADKPD---PNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            ++ + P  +NL +G+ASLF  + +     + D+SGDC V Y+  +++++ ++K  D C  E     T    L   S +T  ++  + D      L ++   L++  ++ +  +        I S+Q + L       +  P  K    V  +I AV  KY     VG+   +              +++  L+ ++L+  E  ++F++  + +R   ++  +  LK + NK+ILPQ++D   S  T D+  A+L     +S +N +L ERF++A            H   ++   L    + S F S  ++ES +  +  +   +  NE        +     L    +  ++E  + Y+  L+N       +L E +  +      ++     +    ++  D+  P + +E+K  +  I+       + +VR ++   ++ NNP+   +  IL ++     E+  Y+++ +Q       P SK   R+L E++A    N+D  S +G S     Y E+G + ++ + L++  S + IL+ S L     NI  +        +++ +   GL   IA  PD    N DS A LS    L  V LRP   F+  S+L S   S S +    +      I  S  + +  SGL    +++G L++DISGS+  SL+ + + + +
Sbjct:  138 YQNEPPAIQNLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQA-HQDKVTKIKALDSCTIERSGFTTRNQVLGVTSKATSVTTYKIEDSFVVAVLAEEIHALRLNFLQTIAGK--------IVSKQKLELK----TTEAGPRLKSGKQVAAIIKAVDSKYTAIPIVGQVFQSECKGCSSLS-QHWQSVRKHLQPDNLSKTEAVRSFLTFIQHLRTAKKEEILQILKAE-NKDILPQLVDAVTSAQTPDSLDAILDFLDFKSDSNIILQERFLYACGFAS-------HPDEELLRALISKFKGS-FGSNDIRESVMIIIGALVRKLCQNEGCKLKAVVDAKKLILGGLERAEKKEDTMMYLLALKN------ARLPEGIPLLLKYAEAAEGPISHLAVTTLQRYDA--PFITDEVKKTMNRIYHQTRKVHEKTVRTTAAAVILNNNPSYMEVKNILLSIGELPKEMNKYMLSIVQDILRFEMPASKMVRRVLKEMVA---HNYDRFSKSGSSSAYTGYIERGPHSASTYSLDILYSGSGILRRSNL-----NIFQYVGKTPLHAIQVVIEAQGLEALIAATPDEGEENLDSYAGLSPL--LFDVQLRPVTFFNGYSDLMSKMLSASSDPISVVKGLILLIDHSQELQL-QSGLKANMEVQGGLAIDISGSMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. SwissProt
Match: gi|284018098|sp|O08601.2|MTP_MOUSE (RecName: Full=Microsomal triglyceride transfer protein large subunit; Flags: Precursor)

HSP 1 Score: 94.3597 bits (233), Expect = 1.458e-18
Identity = 158/669 (23.62%), Postives = 296/669 (44.25%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVEN-----LVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVA-----LKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSKRILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL-KMEL-------STGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +NL +G+ASLF  + +     + D+SGDC V Y+ + +++++++K  D C  E +     +   G +  ++ ++   K + S +   L E      L  +  + G  +I S+Q + L   +    ++P  +   V  VI AV  KYK    VG+ +      +R  K    +A     ++  L+  +L+  E  ++F++  + +R    +  +  LK +  K +LPQ++D   S  T D+ +A+L     +S ++ +L ERF++A      F T   H   ++   L    + S F+S  ++ES +  +  +   +  NE        E     L    K  ++E    Y+  L+N        L E +  +       +     + T  ++  D  +  + +E+K  L  I+    +  + +VR ++  A+I  NP+   +  IL ++     E+  Y++  +Q       P SK I   L      N+D  S +G S     Y E+    ++ + L++  S + IL+ S L     NI  ++ K EL          GL G IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +    +      I  S  +    SGL    +++G L++DISGS+  SL+ + + + +
Sbjct:  146 ENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQAQ-QDKVVKIKALDTCKIERSGFTTANQVLGVSSKAT-SVTTYKIEDSFVTAVLAEETRAFALNFQQTIAG--KIVSKQKLELKTTEAGPRMIPGKQ---VAGVIKAVDSKYKAIPIVGQVL------ERVCKGCPSLAEHWKSIRKNLEPENLSKAEAVQSFLAFIQHLRTSRREEILQILKAE-KKEVLPQLVDAVTSAQTPDSLEAILDFLDFKSDSSIILQERFLYACG----FAT---HPDEELLRALLSKFKGS-FASNDIRESVMIIIGALVRKLCQNEGCKLKAVVEAKKLILGGLEKPEKKEDTTMYLLALKN------ALLPEGIPLLLKYAEAGEGPVSHLATTVLQRYD--VSFITDEVKKTLNRIYHQNRKVHEKTVRTTA-AAVILKNPSYMDVKNILLSIGELPKEMNKYMLTVVQDILHFEMPASKMIRRVLKEMAVHNYDRFSKSGSSSAYTGYVERSPRAASTYSLDILYSGSGILRRSNL-----NIFQYIGKAELHGSQVVIEAQGLEGLIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPVSVVKGLILLIDHSQDIQ-LQSGLKANMEIQGGLAIDISGSMEFSLWYRESKTRV 777          
BLAST of EMLSAG00000001530 vs. SwissProt
Match: gi|1709168|sp|P55158.1|MTP_MESAU (RecName: Full=Microsomal triglyceride transfer protein large subunit; Flags: Precursor)

HSP 1 Score: 88.5817 bits (218), Expect = 7.649e-17
Identity = 143/669 (21.38%), Postives = 293/669 (43.80%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRD-------PLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE--------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVN--------KLQSNPKSKRILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL--------KMELSTGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +NL +G+ASLF  + +     + D+SGDC V Y+ + ++++++ K  D C  E +    ++   G +  ++       +D  +  V   E    RD        + G  +I S+Q + L   +    +VP  +   V  VI A+  KY     VG+ + +              +++  L+  +L+  +   +F++  + +R    +  +  LK +  K +LPQ++D   S  T D+ +A+L     +S ++ +L ERF++A            H   ++   L    + S F+S  ++E+ +  +  +   +  NE        E     L    K  ++E    Y+  L+N        L E +  +       +     + T  ++  D  +  + +E+K  L  I+    +  + +VR ++   ++++NP+   +  IL ++     E+  Y++         ++ S+   +R+L E++A    N+D  S +G S     Y E+  + ++ + L++  S + IL+ S L     N+  +L        ++ +   GL   IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +    +      I  S  + +  SGL    +++G L++DISGS+  SL+ + + + +
Sbjct:  146 ENLKRGLASLFQMQLSSGTTNEVDISGDCKVTYQAQ-QDKVVKTKALDTCKIERSGFTTVNQVLGVSSKATSVTTYKIEDSFVTAVHAEET---RDFSLNFLQAIAG--KIVSKQKLELKTTEAGPRMVPGKQ---VAGVIKALDSKYTAIPIVGQVLQSACQGCPSL-AEHWQSIRKHLEPENLSNAKAVSSFLAFIQHLRTARREEILQILKAE-KKEVLPQLVDAVTSAQTPDSLEAILDFLDFKSDSSIVLQERFLYACGFAS-------HPDEELLRALLSKFKGS-FASNDIRETVMIIIGALVRKLCQNEGCKLKAVVEAKKLILGGLEKPEKKEDTTMYLLALKN------ALLPEGIPLLLKYAEAGEGPVSHLATTVLQRYD--VSFITDEVKKTLNRIYHQNRKIHEKTVRTTAAAVILKSNPSYMDVKNILLSIGELPKEMNKYMLTFVRDILNFEMPSSKMIRRVLKEMVA---HNYDRFSKSGSSSAYTGYIERSPHAASTYSLDMLYSGSGILRRSNL-----NVFQYLGKAGLHGSQVVIEAQGLESLIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPVSVVKGLILLIDHSQDIQL-QSGLKANMEIQGGLAIDISGSMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. SwissProt
Match: gi|1709167|sp|P55157.1|MTP_HUMAN (RecName: Full=Microsomal triglyceride transfer protein large subunit; Flags: Precursor)

HSP 1 Score: 88.1965 bits (217), Expect = 1.145e-16
Identity = 153/667 (22.94%), Postives = 298/667 (44.68%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DEC-LSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKV--ELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKT-SFVGEDIATPPDSKRKFKPTQLVALKSKLKY---NSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLI---CNN----IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIA-DSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQS---LSYFEKGKYFSTNFGLEL--STNKILKESYLHVSLPNISDFL--------KMELSTGGLSGFIADKPDPNDDS-NAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            +N+ +G+ASLF  + +     + D+SG+C V Y+  ++++++++K  D C ++             S++ +S T   ++ D  ++ V  E   N           +I S+Q + L   +    ++   +      +I AV  KY     VG+       S  K  P+     +S  KY   ++L+  E  + F++  + +R   ++  +  LK + NK +LPQ++D   S  T D+ +A+L     +S ++ +L ERF++A            H + ++   L    + S  SS+  +   I + +L+   C N    +K+  E     L    K  ++E    Y+  L+N        L E + S+       +     + T A++  D  LP + +E+K  L  I+    +  + +VR ++   ++ NNP+   +  IL ++     E+  Y++  +Q       P SK   R+L E++A    N+D  S +G S     Y E+    ++ + L++  S + IL+ S L     NI  ++        ++ +   GL   IA  PD  +++ +++  +   L  V LRP   F+  S+L S   S S +    +      I  S  + +  SGL    +++G L++DISG++  SL+ + + + +
Sbjct:  146 ENIKRGLASLFQTQLSSGTTNEVDISGNCKVTYQA-HQDKVIKIKALDSCKIARSGFTTPNQVLGVSSKATSVTTYKIE-DSFVIAVLAEETHNFGLNFLQTIKGKIVSKQKLELKTTEAGPRLMSGKQ---AAAIIKAVDSKYTAIPIVGQVF----QSHCKGCPSLSELWRSTRKYLQPDNLSKAEAVRNFLAFIQHLRTAKKEEILQILKME-NKEVLPQLVDAVTSAQTSDSLEAILDFLDFKSDSSIILQERFLYACGFAS-------HPNEELLRALISKFKGSIGSSDIRETVMIITGTLVRKLCQNEGCKLKAVVEAKKLILGGLEKAEKKEDTRMYLLALKN------ALLPEGIPSLLKYAEAGEGPISHLATTALQRYD--LPFITDEVKKTLNRIYHQNRKVHEKTVRTAAAAIILNNNPSYMDVKNILLSIGELPQEMNKYMLAIVQDILRFEMPASKIVRRVLKEMVA---HNYDRFSRSGSSSAYTGYIERSPRSASTYSLDILYSGSGILRRSNL-----NIFQYIGKAGLHGSQVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSDLMSKMLSASGDPISVVKGLILLIDHSQELQL-QSGLKANIEVQGGLAIDISGAMEFSLWYRESKTRV 778          
BLAST of EMLSAG00000001530 vs. SwissProt
Match: gi|1133968646|sp|A0A0N6WHT4.1|MTP_MEGAM (RecName: Full=Microsomal triglyceride transfer protein; Flags: Precursor)

HSP 1 Score: 82.8037 bits (203), Expect = 5.485e-15
Identity = 155/692 (22.40%), Postives = 298/692 (43.06%), Query Frame = 0
Query:   86 AKIVAIYFEGDKPH--KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLK--DECLSED---TMKHKLHDESGSTEWSSETLIDLKKDKSILK---VELVENLVKRDPLMGDYEIESRQDIMLSEYDF---------IDDVVP--EDKYLTVKEVIDAVAKKYKTSFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLL-ERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFI----NSLSLIC-------NNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLI-ADSELTSYVVNKLQ-----SNPKSK---RILGELIASGHWNWDVLSTNGQSLSY----FEKGKYFST-NFGLELSTNKILKESYLHV---SLPNISDFLKMELSTGGLSGFIADKPDPNDDSNAHLSVQLSLL-SVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
             KI ++Y    +P   KNL +G+AS+ + +    +  + D SG C V YK   +++++R K  D C +++   T    +   SG +  +SET+I L  +  I+K   VE    L          ++ SRQ + L + +          +  VV   +DK+++V  +++ V  K K           P+    +K     A++SKL+ +SL+  E  ++F++    +R   +   ++ L++  +K  LPQ++D   S  T  +  A+L           +L ERF++A     H     +   + +S          K  S  +KES +      L  +C         +   +E L    DS    +E +    Y+  L+N        L E V  +A        A   +   A++  D +L  +  E+K  +  I+       + +VR ++ + ++ ++P+   +  +L ++     E+  Y+++K+Q       P  K   +++ ++I+    N+D  S  G S ++     +     ST N  +  S + +L+ S +++   S   +   L++ +   GL   IA   D  ++     +   +LL  V LRP   F   S+L S  +S S +    +      + D   V    SGL   ++ +G L++DISG +  SL+ + + +S+
Sbjct:  130 GKIRSLYAHKGEPATIKNLKRGVASMLMMQLKSGKMMEADSSGKCLVEYKA-TKHQVIRTKHLDTCKTQEKGFTTYSPVLGVSGKS--ASETVITL--ENGIIKSADVEETHILSINARHTAATKVLSRQSLTLKKIEVGPTEVAGKDVAGVVKSLDDKFMSVGVIVEKVKAKCKGC---------PNLMDTWK-----AVRSKLEPDSLSKAEAPRSFLTLLHSLRKASKAEILTVLRN-CSKTALPQLVDAVTSAQTTSSLSAILEFLDFSKKEGLVLQERFLYACGFASHPTETMLQSLLDVS--------QGKIGSPDIKESVVIIMGALLRKLCLKGACELPTVVKVKELLLAGPDSTQVESEVQM---YLLALKN------ALLPEAVPLLAKYAESEVGAYSTIAITALQRYDPVL--ITPEVKKTVNRIYHQNQRIYEKNVRAAAADVIMSSSPSYMEVKNVLLSIGHLPHEMNKYMLSKVQDILRFEMPACKLVQQVMKDMIS---HNYDRFSKTGSSSAFSGFMAQTADVISTYNLDILYSGSGVLRRSNMNIYGQSNNALLHGLQVTIEAQGLESLIAATADEGEEELESFAGMSALLFDVQLRPVTFFKGYSDLMSKMFSMSGDPINVVKGL-ILLTDHSQVIPLQSGLRASAEFQGGLAIDISGGMEFSLWYRESKTSV 778          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: EFX89528.1 (hypothetical protein DAPPUDRAFT_220651 [Daphnia pulex])

HSP 1 Score: 135.961 bits (341), Expect = 6.396e-32
Identity = 160/681 (23.49%), Postives = 300/681 (44.05%), Query Frame = 0
Query:  101 NLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDES--GSTEWSS-ETLIDLKKDKSI---LKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI---------ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEE----------YLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIF--INPGEDNSVRISSFEALIENNPNAQLLGEILDNLIADS----ELTSYVVNKLQ----SNPKSKRILGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD---FLKMELSTGGLSGFIADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
            N  KGIASLF  +T+  E  + D SG C   Y        L++K++C  +         +   G +  SS +T    K D  +   L    V ++           + SRQ + L+     +  +      ++ +VI +V      + V +++         A    S +  K   +  ++  L+ + +AT  GA AF++   I+R   +   ++ LKD  NK ILPQ++DV  +  T +++ A + V   +S N  L ERF+  +S      T    + +    +L + I+     SE L E+ + SL+ I      N++             +F D+   CA E+C   YMRV +N+         E +  +  ++   DK +     +A+K + + +  L++ +K  L  ++  ++   D+S R  + + L+++ P++  L  +L +L        EL +Y + +LQ    ++P  +  L ++++      N+ V + NG S + F +  Y + +     S+     NK++K +   V L N  D    L + L TGG+   +    +  D+      ++++L  V LRP   FS  SEL    WSG+   + + L     + D  +V    SG      ++G++S D  G + +S++++ + S +     + L+ SL
Sbjct:  151 NFKKGIASLFQLQTSAVELNELDASGSCTATYTNLGGRSFLKIKNDCQFQRPTTSFAQSKKILGLSSVSSYQTKYSFKSDSDVVDTLTSSEVHSIRVNLRSQAGASVASRQYLRLNGESKSNKKISA---ASLTKVIQSVTMNTNVNLVEDNLQLVEESSVLACETSSCKNLKKV-VNEVRKNLQTSKVATSLGASAFVTLLPIVRQSSKDDILALLKDSKNKQILPQLIDVVAAAQTAESYAAAIEVINFQSENIDLAERFLQVVS----LSTRPSEYLLGGLLKLSKKIK-----SEKLSETALLSLAAITKTFVINQQEKASDKLVKDIHTYFTDNLKTCASEDCNQLYMRVFKNLGSP------ETLPIILTHIDSPDKKTSVWAVKALKALPASV-FLDDRVKQKLEIVYFQVDRPYDSSARTLALDMLLDHQPDSTFLINVLISLSMGGSENLELNTYSLQRLQEYAGNDPVVRSQLKQILSDRPSLNNYHVFAQNGMSTT-FSRDLYRNVDGNGSFSSSTEAANKMMKRAAFDVYLRNPEDTFQLLSVGLFTGGMGSLMGFSTE-GDEEEPTAGMEVTLAGVQLRPVIFFSGQSELMGHVWSGTASERTTALQATVLLQDYRNVVPLQSGFVTTLDVRGSVSFDFGGEIQISIWNRNSHSVVEDIAAWELEGSL 809          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: EEB12549.1 (Microsomal triglyceride transfer protein large subunit precursor, putative [Pediculus humanus corporis])

HSP 1 Score: 132.494 bits (332), Expect = 7.354e-31
Identity = 170/726 (23.42%), Postives = 328/726 (45.18%), Query Frame = 0
Query:   58 VWKKGEDEVVLYTLTPTNERFLVHVSDSAKI--VAIYFEGDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTM-KHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAV-----AKKYKTSFVGEDIATPPDSKRKFKPTQLVAL----KSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNN-KLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICN---------NIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPEL-NEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLI---ADSELTSYVVNKL----QSNPKSKRILGEL---IASGHWNWDVLSTNGQSLSY---FEKGKYFSTNFGLELSTNK-ILKESYLHVSLPN---ISDFLKMELSTGGLSGFI-----ADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
            V K   DE+V++        FLVH  +  KI  V IY + +   +N  KGIASLF ++ T  E  +RD SG+C V YKT +     + K  C S     K K  +   +   +S      K  ++I  VE V +    + +M   + E+   ++ ++Y  ++    + + L    + +A+     A K+K      ++ +P  +  +     L  L    +  L  N+L T + A AF+      R   +       K   NK IL Q+ D+ G++ T ++ + ++ + K  S  +   +ER++W+L++        I     +  ++F+ +   K  +E L+E+ I + + + +         N    +E  ++ L+    C +E C +KY++ LRN+      KL  ++   A++ L   K   +   E +K + S      N+ +      I+   G+  D+S R  + + L+E+NP+ ++L ++L +L     + E+  Y+V ++    + N +  +++  +   +A    N++V +  G + ++   F   +Y + +    L  +K +LK   + V + N    +    + L  GGLS FI     +++ + ND + A   ++LS+L+  +RPF  FS   EL    WSG+   K           D +      +G     ++ G++S D+SG + +SL+++ A S +    G  L+  +
Sbjct:  125 VHKSKLDEIVIHP-------FLVHWKN-GKINGVYIYEKENLSFENFNKGIASLFQFQVTDTEIEERDASGNCLVSYKTIDSFSFSKTKTNCQSSHGRNKKKSFEPVLNANVTSSRTYTYKLSENINAVESVTSFEHHNVIM-PIKKEAGGSVLATQYLVLNGNPFKVESLKSSNLENALTEYSTAGKFKLVKQDLELRSPSTNCDQEDCPSLPKLIKENRENLSENNLGTSKSASAFVKLLSAARTASKDDLAKAFKGSKNKEILTQLCDLAGAVQTKESHEIIMKLIKLNSFEDFDKIERYLWSLAN-------GIRPEESVLKDIFK-MTKMKHDNEKLEETLILTTAAMAHRFYKYYQDENHPLVKEISDYVLNQLENCQDEYCKVKYLKTLRNL------KLSRSIPVCASHAL---KGKTKPGVEGMKCLKSFESSFWNDNVLDTAQRIYFQVGKKYDSSSRTLALDILLESNPSREILKDLLLSLAERDREYEVKQYLVQRVKEISERNDEFFKLVNSIKKELADVLGNYNVAAQRGLTTAFSRSFLNDEYRNGSLSTVLEISKGLLKRGIVDVVVENGGKSTSLFSLGLFAGGLSSFISSDGESEEQEENDVATA--GMELSVLNAQIRPFVFFSGQGELMGHVWSGTASEKTPAYQAIILAIDYLENIPLQNGFLLNLEVLGSVSFDLSGQIEISLWNKNAHSLVEKDAGMSLQGQM 822          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: XP_623644.3 (PREDICTED: microsomal triglyceride transfer protein large subunit [Apis mellifera])

HSP 1 Score: 125.176 bits (313), Expect = 1.653e-28
Identity = 161/666 (24.17%), Postives = 284/666 (42.64%), Query Frame = 0
Query:  101 NLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDE-------SGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVG---EDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLIC-NNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNLIADS---ELTSYVVNKLQS----NPKSKRILGELIASGH---WNWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD----FLKMELSTGGLSGFI--ADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGS-METKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLK 733
            NL +G+ASL  Y+    +  +RD SG C V Y +     + + K  C        K H         S S   + E   DL     I   E    ++   P MG   + S + + L         V  D   T+K+ + AV    + + +    E  A P       + T +   ++ L+ N+L T + A AF+    ++R       +  LK    + + PQ++DV+G   T+ + +A + + K +   ++  ER++WALS      TP    +  I     +   + K +      +   +  L     I+     L   LDS   C  EEC LK++R LRN+   + +     +L  A +  KS   +   K  A    DSI  E+ E  + +   I   P  D+S R  + + ++E  P+ + +G +++ L       E+  Y+  +L+     +P+  + L E++++      N++V S  G S + F +    S +    L T     + ++K   + V L  + D       + L  GGL  F+  +++ D  D+  A   ++L  L V +RPF  FS   EL    WSG+  E   +  A +   Y +  +    SG+  E  ++GA+S D++G + +SL+S+ A S +    G  ++
Sbjct:  153 NLKRGLASLLQYRVFDNDVEERDASGLCTVIYHSLGPETVGKRKTSCEQSTLPSRKRHPNPSFDVRVSSSRNSTYELTQDLLLPSLIRDEERHRMVLAARPEMGTI-VTSERTLELLPGTLNAKTVQAD---TLKQAVAAVQPGCRETSIELQLEPFACPDTGCPTIEQT-IDEYRNALESNALGTGKSASAFLKLVPLVRSASPDELLKILKSPRYRQLKPQLLDVYGVASTVASHQAAMKILKQDERGDE-TERYLWALSLSP---TPDADIAKNILKRSEETNPNDKVAETLALTAAAMARHLGSPAAIEKARTSLEIGLDS---CTGEECKLKFLRALRNL---RSKTAIPKLLKFATSEEKSLSIAA-WKALATLPKDSITSEVKEAARRVFYQIG-GPKRDSSARTLALDIILETGPSKEDVGHLVEYLAGTDPAYEVRKYLSQRLEQVSEKDPRLAKDLNEVLSTSGKDIVNYNVFSQKGLS-TAFTRSFLRSPDSNGSLVTIQEISSGLMKRGIVDVIL-QVEDHEEALFSLGLFAGGLGSFVSTSEEEDIQDNEPATAGMELDFLGVGIRPFVFFSGQGELMGHVWSGTGSERTPAFQALSSIHYHNEYIP-LGSGIVIEIDVQGAVSFDLAGQIQLSLWSRNAQSLVDLKAGVVIQ 798          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: gb|EFA08014.1| (Microsomal triglyceride transfer protein large subunit-like Protein [Tribolium castaneum])

HSP 1 Score: 117.857 bits (294), Expect = 3.211e-26
Identity = 159/688 (23.11%), Postives = 290/688 (42.15%), Query Frame = 0
Query:   85 SAKIVAIYFEGDKPH--KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYL--------------TVKEVIDAVAKKYKTSFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNK-LLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLIC-------NNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILP-ELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS---ELTSYVVNKLQSNPKSKR----ILGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELSTNKI----LKESYLHVSLPNIS---DFLKMELSTGGLSGFIADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFG 729
            S KI  I     +P    N  KGIASLF ++    E  + D SG C   Y T +  +  + K  C+S D    K          +S   +  + D  +  ++ +            Y  ES   ++LS  + I  V+  D+ L              T++ V+D+V++ Y    +        D  + F P  +  L+  +  ++L     AK+F+      R   +   V  L  K N+ ILPQI D+ G + T +   +VL     +   ++ L ER++W+LS   H        +  I  +L +  + +    + +KE+ + +++ +          ++S EE +   +++ +    E+ F K++R L+N+         ++V ++   V   ++ + +    A K I ++ P     +I  I    F+      D S R  + + L+E  P   LL + L  L  +    E+  YV+ +LQ      R     L  LI S     N++VL+  G S +         ++ G  L+  +I    +K   ++V +   S   +   + +  GGLSG +  + +  D+  A   + L++L   +RPF  F+  SEL    WSG+   + +       + D +       G   +  LKG +S D+SG++ +SL+ +TADS++    G
Sbjct:  124 SGKIGKILLPKGEPKSLANFKKGIASLFQFQILDVETTENDASGSCKTVYHTIDTTKFRKTKTNCISSDLPFVKTAHPILDVLVASSRQVTYELDPKLTHIKAI------------YAKES-HSMVLSVKEDIGSVIEADQILNHVKNEKTGPLQGATLESVVDSVSQGYTEDTLQLQKEENDDDGKTF-PNLVNELRDNI--SNLGNLLSAKSFLRLLDAARKATKDEIVKVLGSKKNQKILPQIYDILGYVQTPEAHASVLKKLHFDKEEHQDLSERYLWSLSLSSH-------PNPDILKDLLERHRKNDNYPDKVKETLVLTIAQMAFLTQGERKIVRSVEEII---VNNLNYAKGEDRF-KFLRALKNL---------KSVTTVPLLVKIIEEGTFKEGVLAFKAIKALGPSRWTPDIFRIARKTFLQLDRKYDTSARTLAADILLEAQPGDSLLKDFLHYLKTNDSSVEVKQYVMQRLQMLADEDRNFNQRLSHLIRSDPKLNNYEVLAPYGLSTALKRTFLRSPSSNGSLLTIQEIFGGIVKRGIVNVMMDKDSQSREMFSLGIFAGGLSGLVGGEVE-GDEETATAGMDLTILDTQIRPFVFFNGQSELMGHVWSGTASERTTAFQALILLQDHLEFIRLGPGFVAQLSLKGGVSFDLSGNIEISLWGRTADSNVEKSAG 774          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: EAA13951.4 (AGAP010234-PA, partial [Anopheles gambiae str. PEST])

HSP 1 Score: 103.99 bits (258), Expect = 6.269e-22
Identity = 157/705 (22.27%), Postives = 298/705 (42.27%), Query Frame = 0
Query:   86 AKIVAIYFEGDK--PHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC--------LSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVENLVKR-----DPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTV-KEVIDAVAKKYKTSFVGEDIATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLS--VFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNE----------EYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLK-SDKASKRMKTEAIKLIDSILPEL-NEEIKTILMTIF--INPGEDNSVRISSFEALIENNPNAQLLGEILDNLIADS---ELTSYVVNKLQSNPKSKRILGELIAS-----GHW-NWDVLSTNGQSLSY---FEKGKYFSTNF-GLELSTNKILKESYLHVSLPNISD----FLKMELSTGGLSGFIADK-----PDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
             +I  +YFE     P +N  KGI +LF Y+       + D SG+C  +Y + +  R  + K  C         SE  ++  L   S ST+++  T   L+K KS   V+ + N   R     + +M      S Q     E   ID +V   K L++ KE +  + ++YK+S          D+      +    LK  L  +++     A A +   +  R   ++  V  +K K + ++  QI+D+ G+  T+ + +A  S  +   +  N  L ER++ AL+       PK      +     +   + KF      +S I  L+ +       E          + +N+  +   +C+ E+C LK++R L+N+   +           A+ ++K + +++K +   A+K + S    L N+E +     IF  ++   D+S R  + + L++  P+   L  ++  L +     EL  Y++ KL+         G ++ +     G   N+++L+  G S +    F     F+ +   L+  +  +LK   + ++L ++SD       + L  GG+S F++        D N++ +    ++LS+  V +RP   F+   EL    WSG+             + D+       +G+       GA+S+D++G V +SL+ + A S +    G  +   L
Sbjct:   94 GQIKEVYFEASDALPVRNFKKGICALFQYQLLDGTYSEVDPSGECETKYISHSSTRYHKSKGNCHYDAKRMQRSEYGLRSNLK-TSRSTDFTVSTDGALQKIKSQDYVKYLLNAQDRFGPYYESIMQMNVQGSTQKTSTQEGSDIDGIV---KKLSLEKETL--LTEEYKSSC--------KDNNCDNIISVFKQLKHSLTNDNVGKEASATAMVDMVRAARKATKEDLVRIIKAKSSNDMKGQIVDILGAAQTMASHQAAKSELLSSSDDENMFLAERYLQALAIGTR---PKKEIVADLLEMALKEHMNVKF-----YDSLIQCLAAVTRRYAQLEGNSYETEVVKKVVNFLEEKIDECSREDCKLKFIRGLQNLKCPR----------TADRLIKLAQESTKAVSVAAMKALRSFSVYLWNDEFRAKFEDIFFQVSKRYDSSARTLALDILLDLKPDQDELSHLVQFLKSKDKAYELKQYLLQKLRMAAAQCSEFGAMLKNIIEKDGLLNNYNILAPKGLSTALSRKFSTAPSFNASLTSLQEMSGGVLKRGIVDLTL-DVSDEKMSLFTLGLYAGGMSSFVSSNDEEQITDNNEEEDTTAGMELSVQGVVMRPLEFFNGKGELMGHVWSGTASEPTPAYQAITLLQDNEERFASHNGVTLALSSTGAISIDLNGQVTMSLWGRNAHSKVEQNTGISMTSRL 765          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: gb|KFM66322.1| (Microsomal triglyceride transfer protein large subunit, partial [Stegodyphus mimosarum])

HSP 1 Score: 98.9821 bits (245), Expect = 5.098e-21
Identity = 107/442 (24.21%), Postives = 204/442 (46.15%), Query Frame = 0
Query:  307 NKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLS-LICNNIKSNEEYLN---------WFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFIN--PGEDNSVRISSFEALIENNPNAQLLGEILDNLI--ADSELTSYVVNKL----QSNPKSKRILGELIASGHW-NWDVLSTNGQSLSYFE-----KGKYFSTNFGLELSTNKILKESYLHVSLPNISDFLKMELSTG-GLSGF-IADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADS 722
            ++ IL Q++D+  +  T D+      +   ES +  + ERF+  L++V +       + V I+  L   + + K  SE L+ + + SLS L+    ++N + +N           L   S+C    C L ++  LRN    Q        +      +K       +  EAIK I        +E+  +L+ ++    P ++ + R+ + E LI++NP  + +G I+ +L      E+++ V++KL    Q +   +  + E++ +  + N++ L+ NG S S+            +    +E+    +L+ + L ++L N  + L + LS G  + GF + D+    +       +QLS+L V LRP+  F+  +EL  L WS +       L  N    D     +  +G++ +  LKGALS DISG+  VS++++ + +
Sbjct:    7 DERILTQLLDILAAAQTDDSLDIAFQLIDFESKDIGIAERFLLCLATVPY------PNEVTITKLL--KLFNRKIKSEKLRATMLISLSSLVKTYSRNNPKNMNSLIVQSVSDMLLRELSECDHAGCILNHILALRNAALPQ-------YIPTLLEYIKKGGILGLVSLEAIKDIGE--QHFTKEVNDVLLKVYNQFWPHQEPAARVLAAEILIKSNPTIETIGNIVLSLSDQQQPEISTLVLSKLYTSMQKSDTVRSCVKEVLRNVTFGNYNNLAQNGSSTSFINILQATHDANITYGINMEMRPTGMLRRTSLDLNLINSQENLHL-LSLGLFVEGFGLTDEEQKANPEEHSAGMQLSVLGVNLRPYIFFTGTAELMGLVWSAAGSEPTPALQANFLFMDQYHSIILQNGINVDFILKGALSTDISGAAEVSMWNKNSHA 430          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: AAF53946.2 (microsomal triacylglycerol transfer protein [Drosophila melanogaster])

HSP 1 Score: 89.3521 bits (220), Expect = 2.521e-17
Identity = 153/699 (21.89%), Postives = 287/699 (41.06%), Query Frame = 0
Query:   87 KIVAIYFEGDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC-LSEDTMKHKLHDESGSTEWSSETLI-DLKKDKSILKVELVENL---VKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDIATPPDS-KRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNK----LLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSE-SLKESFINSLSLICNN---------IKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNI-DYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSI-LPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS---ELTSYVVNKL----QSNPKSKRIL-GELIASGHWN-WDVLSTNGQSL---SYFEKGKYFSTNFGLELSTNKILK--------ESYLHVSLPNISDFLKMELSTGGLSGFIADKPD-------PNDDSNAH-----LSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFG 729
            K++A +   D+   NL +GIASL   +    +  + DVSG C V Y  K+  ++ + K +C L +  + +   +  G T+ + ET+  +L  + ++L  E  EN    +   P +G +    +  ++L       + V + +  ++ + I ++ + Y+   +  D+     + K +    QL A  ++L+   +     A A++    + R   ++     L +  +  +LPQ++D+ G++ T D   A       ES        LLE+++ +L+   H     + H       LF  ++         L+ES I +++ +            +K    YL   L S      +E  L Y+R L+N+ D A  E L E+  +           +  +   A++ + +  L   N   +    +IF       D+S R  + + ++   P  + LG  LD L ++    E+ +YV+ KL    +  P+ + +   EL+   H N ++VL   G +        +   F+      LST ++ +        E  LH      S F K+ + T GL   + D          P DD  +        +++S+    LRP   FS  +EL    W GS               D+    + +SG     ++ GA S+D++G V  SL+++ A + I    G
Sbjct:  117 KVIA-HTSKDQSLLNLERGIASLLQLRLDASQEEELDVSGLCRVSYNVKSSTKVEKTKRDCSLWDLRVNYNPEEALGVTQQAQETVFYELSSEGTLLHAESQENHRLNLAAKPDVGSF---VKSSLILQHVSQGSEEVKQLQLGSLDKAIQSLLEWYRVFELESDVDGMISAIKEQTLEDQLKASLTELQSADVGKSSLALAYVKLIPLARITRQEQFEDLLTE--HAEVLPQLVDLLGAVQTFDAHNATFGFLYKESETTSEQLDLLEKYLQSLAVATHPDRKIVEH-------LFGLLEQESIKKHLKLRESVIQTVATLTRQSGLDVEDPLLKEVRSYLLQGLTS------KEPTL-YIRALQNLQDPATIEALLEHAQT---------GEAPNLSVAALQALKAFPLGSFNSSHRLQFESIFYQRKRRFDSSARTLALDIILSLRPTQEQLGNFLDYLASNDRQFEIKTYVLQKLRMLAEKCPRFRALFKSELVKRRHVNNYNVLGQKGLTTVLTRQLSQAPAFNETL---LSTQEVYQGILKRGSVEFLLHAGRSQASSF-KLGIYTAGLGSLVGDGDSGDGNDAIPADDEFSEDEAVTAGMEISVQGAQLRPLVFFSGQTELMGHVWGGSASDSTPAYQATTLSQDNEHYIILTSGATLHWRVLGARSVDLNGKVGFSLWNRNAQTEIQQNTG 782          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: gb|EEC02059.1| (microsomal triglyceride transfer protein, putative, partial [Ixodes scapularis])

HSP 1 Score: 66.2402 bits (160), Expect = 5.113e-11
Identity = 49/153 (32.03%), Postives = 79/153 (51.63%), Query Frame = 0
Query:  584 LELSTNKILKESYLHVSL--PNIS-DFLKMELSTGGLSGFIADKPDPNDDSN-----AHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGF 728
            +EL    +LKES + VSL  P  S + L + L  GGL G +A   D  +D++     A   ++L L+   LRP+  F   SEL    WSG+       L  N  + D        +GL  E +L+G +S+D++GS+ +SL+++ + S + + F
Sbjct:    3 MELIPGGLLKESSVDVSLETPEESLNLLSVGLFAGGL-GNVAGGDDGGNDASQEEEEATAGMRLMLMGAELRPYVFFVGTSELMGHVWSGTGSEPTPALQGNLLMMDHFQYVALLNGLVVELKLQGVISLDLTGSIQISLWNRNSHSVVKTRF 154          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: gb|KPM06676.1| (hypothetical protein QR98_0051540 [Sarcoptes scabiei])

HSP 1 Score: 67.781 bits (164), Expect = 1.058e-10
Identity = 93/394 (23.60%), Postives = 163/394 (41.37%), Query Frame = 0
Query:  382 SSESLKESFINSLSLICNNIKSNEEY-------LNWFLDSFSKCAEEECFLKYMRVLRNI-------------DYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNLIADSELTSYVVNKLQSNPKS------KRILGELIASG-------HWNWDVLSTNGQSLSY-FEKGKYFSTNFG--LELSTNKILKESYLHVSLPN---ISDFLKMELSTGGLSGFIADKPDPNDDSN----------AHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISS 726
            S +SL E FI S S   N +K N+++       +    +   +C   EC + Y+  L N+             +Y+      E+V +M     K+ +   + + E  +L+D      NE++ T L    +    D+ +  +S   LI     A+LL   +D    D  LT  +V  L   P        KR + ++++         H +  +LS +  S  Y   + ++ + ++G  LEL   K+ KE+  +  +       D + + L   GL  F A +     DSN              + L ++   LRPF  FSS SEL    WSGS      +   N  + D   +    +G   E  LKG  S+++ G + +SL+++ + S++ +
Sbjct:  507 SVQSLIEGFIQSNSDSINLLKHNQKFSSFAEKVIKHLQNGLDRCKNTECRIVYLGALGNLRILSKHGVFNTLKNYSLNSGKRESVAAM-----KAIRDCVQFEAENDRLLD------NEKLSTRLRRFLLRIVYDSEIETTS--RLI----GAELLANHIDR---DGNLTIELVQHLDRFPSELATMIWKRAVIKVLSKHRKRSENWHLHSKILSGSSASFRYVMAQSQFANASYGVFLELLKGKLPKETSFNFDISQNDLYQDIITVGLFARGLQSF-AGQDSSEQDSNDLDREQEEEPTLAGMTLKVMDQQLRPFLFFSSTSELMGHVWSGSASEPTPVFRANLLLADYFDIKPLINGFLVEQSLKGIFSLNLKGEIQISLWNRNSHSNVQT 879          
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Match: gb|KFM74933.1| (Microsomal triglyceride transfer protein large subunit, partial [Stegodyphus mimosarum])

HSP 1 Score: 56.225 bits (134), Expect = 2.703e-7
Identity = 67/272 (24.63%), Postives = 126/272 (46.32%), Query Frame = 0
Query:  100 KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHD---ESGSTEWSSETLIDLKKDKSILK--------VELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGE----DIATPPDSKRKFKPTQLV----ALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALS 352
            +NL K IA+L   +       + DV+G+C V YK +  N + + K  C+++   K +       S + + +S+T  +LK   S +         V++  N+ +R  +     I ++ +  LS +D     V ++K++   E +D+V ++ K SF G      I+     K +     LV      +  LK  +LA  + A AF     I +   +    + L+++  + I+PQI+D+  +  T +   A    F    ++++LLERF+ +LS
Sbjct:  129 RNLKKSIATLLQLRHKDQTIKENDVAGNCDVIYKVRG-NSIRKKKMNCVNQLYSKRETQPFGVRSLTVQHNSKTDCELKNAGSYVVDKCASSDFVKMFSNVWQRPTVC----IRAKSE--LSSHD-----VGKEKHVFSDENLDSVLQELKKSFPGTLKEGHISAASAIKEQSSSNNLVESLKKYQDSLKEQNLAKIKSASAFYKLLPIFQNAQKDDIKNVLQNEKLRAIMPQILDLIAASCTRNALSAAFEHFSSSKSSDELLERFLVSLS 388          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|646719578|gb|KDR21635.1| (Microsomal triglyceride transfer protein large subunit [Zootermopsis nevadensis])

HSP 1 Score: 163.696 bits (413), Expect = 4.469e-38
Identity = 185/739 (25.03%), Postives = 322/739 (43.57%), Query Frame = 0
Query:   72 TPTNERFLVHVS--------------DSAKIVAIYF-EG-DKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLH-DESGSTEWSS--ETLIDLKKDKSILKVELVENLVKRDPLMGDYEIESRQD----IMLSEYDFIDDV---VPEDKYLTVKEVIDAVAKKYKTSFVGEDIAT---PPDSKRKFKPTQLVALKSK---LKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNN-KLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICN---------NIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPE-LNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIAD----SELTSYVVNKLQS----NPKSKRILGELIASGHW---NWDVLSTNGQSLSYFEKGKYFSTNFG------LELSTNKILKESYLHVSL---PNISDFLKMELSTGGLSGFIADKPDPNDDSNAH----LSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSLVGIWK 741
             P  E F+VH S              ++ KI  ++  EG D    NL KG+ASLF ++       ++D SG C V Y++ +    L+ K +C+S  T+   LH D+   T  +S  E+   L  D S+++  + +        M    +E R D    +  S+   + D    VP+ K  +++E +  V K  KT+F  + + T   PP  +    PT    +K     LK  +L T   A  FI    + R    +     LK   NK+IL Q+ D+ G+  T+   +A     + +S ++  + ER+ WALS   H     I   ++++ + F          E L E+ + +++ + N          +K   E     +D  S CA EEC  KY+R LRN+       L E V  +  + L     +K+    A+K + S+ P   ++E++     I+   G+  D+S R  + + L+E+NP+ ++L E+L +L +      E+  YV+ ++      +P     +  +I   H    N++ +   G S ++     + S+  G      ++     +LK   + V L    +  +   + L  GGLS FI+   +P+D   A       ++++ L + +RPF  FS   EL    WSG+   K         + D +      SG   E  L G +S D+SG + +SL+++ A S +    G     ++ GI +
Sbjct:  105 APEPEGFVVHASKLEALKNLPYLVHWNTGKIEHVFLSEGEDLSVVNLKKGVASLFQFQILDVTQTEKDASGKCQVSYRSLDPRTFLKTKTDCISGKTVPFILHPDKVMGTLVTSKRESEYRLSTDMSVIQSVVADE-------MHSMVVEMRHDAGGAVRASQQIILTDAAVDVPQIKASSLEEAVQEVEKNLKTTFTKQILVTESEPPACQEDC-PTLYKLVKENRDHLKDETLGTSRSAAIFIKLLNVARGSRMEDIYKVLKSSKNKDILLQLCDLVGATQTVAAHEAARKFLRLDSESDLDVNERYFWALSMGSHPELQVIKDVLKLTYKDF---------PEKLSETLLLTVAALTNRFMKLPGNSQLKIIGEVKVSLVDGLSGCANEECKQKYLRALRNLG------LKETVPVLLRHALY---GTKKTSVTAMKALRSMPPSSWDDEVEKAAARIYYQIGKRFDSSARTLAADILLESNPSREVLRELLLSLASRVDPVHEVRQYVLQRVHQMSDKDPNFGAQVMSIIREEHKKLNNYNGMVQRGLSTAFTRS--FLSSPSGNGSLVTVQEIAGGLLKRGRVDVVLDKQGSSQEIFTLGLFAGGLSSFISSDEEPSDSEEAEEPATAGMEITALGIQVRPFVFFSGQGELMGHVWSGTGSEKTPAFQTLALLQDHLQYLPLQSGFIAELNLMGVVSFDLSGQIQLSLWNRNAHSLVEKNAGI----TITGIMR 811          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|926629512|ref|XP_013780404.1| (PREDICTED: microsomal triglyceride transfer protein large subunit-like [Limulus polyphemus])

HSP 1 Score: 157.918 bits (398), Expect = 3.196e-36
Identity = 177/671 (26.38%), Postives = 307/671 (45.75%), Query Frame = 0
Query:  101 NLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECL---SEDTMKHKLHDESGSTEWSSETLIDLKKDKSILK-VELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKY----LTVKEVIDAVA---KKYKTSFVGEDIATPPD-----SKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSK---FSSESLKESFINSLSLICNNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSI-LPELNEEIKTILMTIF--INPGEDNSVRISSFEALIENNPNAQLLGEILDNLIA--DSELTSYVVNKLQSNPKSKRILGE-----LIASGHWNWDVLSTNGQSLS---YFEKGKYFSTNFGLELSTNKILKESYLHVSLPNISDFLKM---ELSTGGLSGFIADKPDPNDDSN-AHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRS 735
            NL KG+ASL           + DVSG C V Y  ++ + + + K  C+    E    H    +S +   SSET+ +L  D  I+K  +  EN+     +  D  +      + SEY     V+ E+K     L+   + DA+    K+     V E+I + P+        K  P  +   + +L    +AT + A AF+   +  R   +K  V  LK   NK+ILPQ++D+  +  T ++ +A +        N  + ERF   LS   H     +   ++++S  FQ+ +       +  +L  S+      +C++ K  +    +F    + C ++ C L Y+R L+N              SM   +LK  K   +    A+  I +I L  L EE+  +L  ++  +   +D++ R  + E +I+NNP+  +L E+L +L    ++ L+ +++ KL     +  +L       L  S   N+++LS +G S S   Y  +    + +  LEL  + +LK S   V + N  + LK+    L  GGL  F  ++   +++S  A   ++L++L V LRP+  F+   EL  L WSG+   +   L  N  I D     V  +GL  +  L+G LS+D+SGSV +SL+++ + S ++S     L+ S
Sbjct:  143 NLKKGVASLLQLPAKQGLFNEEDVSGRCEVSYD-QDGSFIKKKKHYCVHPKREGQFSHSNEVQSATVTTSSETVYELALDGGIVKSAQGNENIQMHVNIWSDAAVS-----LDSEYKL---VLKEEKSDSSGLSASNLDDALQILIKEVGMQLVEENIISQPEKHVCKGNCKSVPGLVKDYRKELGTEKIATLKSATAFLQLLERFRGASKKNIVDILKSSKNKSILPQLLDLIAASQTENSLQAAIETLDLTGENIDIPERFFLGLSVASHPSHMILSDLMKLTSYNFQNPKVKTTVMMTIGALTRSYCRKNQKLCDS-KVVQTIHGYFEKELASCKDDLCRLMYLRALKNAALPA---------SMPT-LLKYAKRGGKCAVVAVGAISNIGLEYLTEEVMKVLEGVYHQVWSRQDSTARAIAAELIIKNNPSELVLSELLQSLAVSENAGLSRFLLAKLYDLITTDFMLRSKVEKLLKNSEFGNYNILSQSGASTSFTKYSNRDVNATYSVNLELGPSGMLKTSSFDVVISNKKNQLKIFSVGLFAGGLGSFAGEEEVQSEESEEATAGMELNVLGVGLRPYTFFTGTGELMGLVWSGAGSERTPALQANLLIMDQSQYVVLQNGLVVDVSLRGVLSIDLSGSVQISLWNRNSQSVVTSSGALLLQGS 793          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|942320679|gb|JAN42272.1| (Microsomal triglyceride transfer protein large subunit [Daphnia magna])

HSP 1 Score: 150.599 bits (379), Expect = 4.584e-34
Identity = 176/749 (23.50%), Postives = 329/749 (43.93%), Query Frame = 0
Query:   53 VERASVWKKGEDEV-VLYTLTPTNER-------------FLVHVS--DSAKIVAIYFE---GDKPH-----------KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC-----LSEDTMKHKLHDESGSTEWSSETLIDLKKDK----SILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI--------ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLN---------WFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS----ELTSYVVNKLQSNPKSKRI----LGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD---FLKMELSTGGLSGFIA-DKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSI 724
            VE   VW+   D   +L+ L  +N +             F+ H S  D A+  A+Y +   G   H            NL KGIASLF  +T+  E  + D SG+C   Y +      L++K  C      S  +   K+   +  +  S +T  +LK D     +++  E+    VK     G   I SRQ + L+     +   P     ++ + ++++      + +G+++        A    S +  K   +  L+  L+ +++ATP GA AF     I+R   +   ++ LKD  NK ILPQ+MDV  +  T +++ A +     +S +  L ERF+  +S   H     ++  + +S          K  SE L E+ + SL+ +     S+ E  +         + +D+   C++E+C   YMRVLRN+   +   +      +  ++  +D+ +     +A++ + + +  L++ +K  L  ++   G   D+S R  + + L+E+ P+   L E+L +L        EL +Y + +LQ + ++  I    L +L++   +   + V + NG S + F +  Y + +     S+     NK++K +   V + N  D    L + L TGGL   +     +  ++  A   ++++L  V LRP   F+   EL    WSG+   + + L     + D     V  SG      ++G++S D  G + +S++++ + S +
Sbjct:   73 VELTPVWQNPSDAAHMLFELLMSNPKLSVRSRKAQQPDGFIDHSSPLDDAQSTAVYIDWNDGIISHIYAFESESVSLNNLKKGIASLFQLQTSGIEIHELDASGNCTATYNSLGGRTFLKVKSNCQFRRPTSSFSQSQKILGLASVS--SQQTKFNLKSDSDVVDTLISTEVHAVRVKLRSQAGASVI-SRQHLRLNGESKSNKKFPA---ASLAKAVESIKMSTNVNLIGDNLQLVEELVDACETSSCKSLKKA-VNDLRKNLQTSNVATPSGAGAFGKLLPIVRRSSKVDILALLKDSKNKPILPQLMDVVAAAQTHESYTAAIEAINFQSQDIDLAERFLQVVSLSTHPSEDILNGLLTLS---------KKIKSEKLSETALLSLAAVTRTFASHPEKASSPLVTRIHKYVIDNLEACSKEDCKQMYMRVLRNLGSVEMLPI------LLAHIDSTDRKTSVWAVKAVRALPTSV-FLDDRVKDKLQRVYFQMGRPYDSSARTLALDTLLEHEPDETFLLEVLTSLSMGGRENLELNTYTLQRLQESAENDPILHSKLKQLLSDQPFLNTYHVFAQNGMS-TTFSRVLYRNIDGNGTFSSSTEAVNKMMKRAAFDVYVRNSEDAFQLLSVGLFTGGLGSLMGFSSTESEEEEEATAGMEVTLAGVQLRPIVFFTGQGELMGHVWSGTASERTTALQATVLLQDHRQAVVLQSGFIAVLDIRGSVSFDFGGEIQISIWNRNSHSVV 797          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|942346806|gb|JAN55334.1| (Microsomal triglyceride transfer protein large subunit [Daphnia magna])

HSP 1 Score: 150.984 bits (380), Expect = 5.186e-34
Identity = 179/761 (23.52%), Postives = 333/761 (43.76%), Query Frame = 0
Query:   53 VERASVWKKGEDEV-VLYTLTPTNER-------------FLVHVS--DSAKIVAIYFE---GDKPH-----------KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC-----LSEDTMKHKLHDESGSTEWSSETLIDLKKDK----SILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI--------ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLN---------WFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS----ELTSYVVNKLQSNPKSKRI----LGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD---FLKMELSTGGLSGFIA-DKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
            VE   VW+   D   +L+ L  +N +             F+ H S  D A+  A+Y +   G   H            NL KGIASLF  +T+  E  + D SG+C   Y +      L++K  C      S  +   K+   +  +  S +T  +LK D     +++  E+    VK     G   I SRQ + L+     +   P     ++ + ++++      + +G+++        A    S +  K   +  L+  L+ +++ATP GA AF     I+R   +   ++ LKD  NK ILPQ+MDV  +  T +++ A +     +S +  L ERF+  +S   H     ++  + +S          K  SE L E+ + SL+ +     S+ E  +         + +D+   C++E+C   YMRVLRN+   +   +      +  ++  +D+ +     +A++ + + +  L++ +K  L  ++   G   D+S R  + + L+E+ P+   L E+L +L        EL +Y + +LQ + ++  I    L +L++   +   + V + NG S + F +  Y + +     S+     NK++K +   V + N  D    L + L TGGL   +     +  ++  A   ++++L  V LRP   F+   EL    WSG+   + + L     + D     V  SG      ++G++S D  G + +S++++ + S +     + L  SL
Sbjct:   73 VELTPVWQNPSDAAHMLFELLMSNPKLSVRSRKAQQPDGFIDHSSPLDDAQSTAVYIDWNDGIISHIYAFESESVSLNNLKKGIASLFQLQTSGIEIHELDASGNCTATYNSLGGRTFLKVKSNCQFRRPTSSFSQSQKILGLASVS--SQQTKFNLKSDSDVVDTLISTEVHAVRVKLRSQAGASVI-SRQHLRLNGESKSNKKFPA---ASLAKAVESIKMSTNVNLIGDNLQLVEELVDACETSSCKSLKKA-VNDLRKNLQTSNVATPSGAGAFGKLLPIVRRSSKVDILALLKDSKNKPILPQLMDVVAAAQTHESYTAAIEAINFQSQDIDLAERFLQVVSLSTHPSEDILNGLLTLS---------KKIKSEKLSETALLSLAAVTRTFASHPEKASSPLVTRIHKYVIDNLEACSKEDCKQMYMRVLRNLGSVEMLPI------LLAHIDSTDRKTSVWAVKAVRALPTSV-FLDDRVKDKLQRVYFQMGRPYDSSARTLALDTLLEHEPDETFLLEVLTSLSMGGRENLELNTYTLQRLQESAENDPILHSKLKQLLSDQPFLNTYHVFAQNGMS-TTFSRVLYRNIDGNGTFSSSTEAVNKMMKRAAFDVYVRNSEDAFQLLSVGLFTGGLGSLMGFSSTESEEEEEATAGMEVTLAGVQLRPIVFFTGQGELMGHVWSGTASERTTALQATVLLQDHRQAVVLQSGFIAVLDIRGSVSFDFGGEIQISIWNRNSHSVVEDIAAWQLDGSL 809          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|942299215|gb|JAN31540.1| (Microsomal triglyceride transfer protein large subunit [Daphnia magna])

HSP 1 Score: 150.599 bits (379), Expect = 6.711e-34
Identity = 179/761 (23.52%), Postives = 333/761 (43.76%), Query Frame = 0
Query:   53 VERASVWKKGEDEV-VLYTLTPTNER-------------FLVHVS--DSAKIVAIYFE---GDKPH-----------KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC-----LSEDTMKHKLHDESGSTEWSSETLIDLKKDK----SILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI--------ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLN---------WFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS----ELTSYVVNKLQSNPKSKRI----LGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD---FLKMELSTGGLSGFIA-DKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
            VE   VW+   D   +L+ L  +N +             F+ H S  D A+  A+Y +   G   H            NL KGIASLF  +T+  E  + D SG+C   Y +      L++K  C      S  +   K+   +  +  S +T  +LK D     +++  E+    VK     G   I SRQ + L+     +   P     ++ + ++++      + +G+++        A    S +  K   +  L+  L+ +++ATP GA AF     I+R   +   ++ LKD  NK ILPQ+MDV  +  T +++ A +     +S +  L ERF+  +S   H     ++  + +S          K  SE L E+ + SL+ +     S+ E  +         + +D+   C++E+C   YMRVLRN+   +   +      +  ++  +D+ +     +A++ + + +  L++ +K  L  ++   G   D+S R  + + L+E+ P+   L E+L +L        EL +Y + +LQ + ++  I    L +L++   +   + V + NG S + F +  Y + +     S+     NK++K +   V + N  D    L + L TGGL   +     +  ++  A   ++++L  V LRP   F+   EL    WSG+   + + L     + D     V  SG      ++G++S D  G + +S++++ + S +     + L  SL
Sbjct:   69 VELTPVWQNPSDAAHMLFELLMSNPKLSVRSRKAQQPDGFIDHSSPLDDAQSTAVYIDWNDGIISHIYAFESESVSLNNLKKGIASLFQLQTSGIEIHELDASGNCTATYNSLGGRTFLKVKSNCQFRRPTSSFSQSQKILGLASVS--SQQTKFNLKSDSDVVDTLISTEVHAVRVKLRSQAGASVI-SRQHLRLNGESKSNKKFPA---ASLAKAVESIKMSTNVNLIGDNLQLVEELVDACETSSCKSLKKA-VNDLRKNLQTSNVATPSGAGAFGKLLPIVRRSSKVDILALLKDSKNKPILPQLMDVVAAAQTHESYTAAIEAINFQSQDIDLAERFLQVVSLSTHPSEDILNGLLTLS---------KKIKSEKLSETALLSLAAVTRTFASHPEKASSPLVTRIHKYVIDNLEACSKEDCKQMYMRVLRNLGSVEMLPI------LLAHIDSTDRKTSVWAVKAVRALPTSV-FLDDRVKDKLQRVYFQMGRPYDSSARTLALDTLLEHEPDETFLLEVLTSLSMGGRENLELNTYTLQRLQESAENDPILHSKLKQLLSDQPFLNTYHVFAQNGMS-TTFSRVLYRNIDGNGTFSSSTEAVNKMMKRAAFDVYVRNSEDAFQLLSVGLFTGGLGSLMGFSSTESEEEEEATAGMEVTLAGVQLRPIVFFTGQGELMGHVWSGTASERTTALQATVLLQDHRQAVVLQSGFIAVLDIRGSVSFDFGGEIQISIWNRNSHSVVEDIAAWQLDGSL 805          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|942416169|gb|JAN90014.1| (Microsomal triglyceride transfer protein large subunit [Daphnia magna])

HSP 1 Score: 150.599 bits (379), Expect = 7.407e-34
Identity = 179/761 (23.52%), Postives = 333/761 (43.76%), Query Frame = 0
Query:   53 VERASVWKKGEDEV-VLYTLTPTNER-------------FLVHVS--DSAKIVAIYFE---GDKPH-----------KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC-----LSEDTMKHKLHDESGSTEWSSETLIDLKKDK----SILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI--------ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLN---------WFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS----ELTSYVVNKLQSNPKSKRI----LGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD---FLKMELSTGGLSGFIA-DKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
            VE   VW+   D   +L+ L  +N +             F+ H S  D A+  A+Y +   G   H            NL KGIASLF  +T+  E  + D SG+C   Y +      L++K  C      S  +   K+   +  +  S +T  +LK D     +++  E+    VK     G   I SRQ + L+     +   P     ++ + ++++      + +G+++        A    S +  K   +  L+  L+ +++ATP GA AF     I+R   +   ++ LKD  NK ILPQ+MDV  +  T +++ A +     +S +  L ERF+  +S   H     ++  + +S          K  SE L E+ + SL+ +     S+ E  +         + +D+   C++E+C   YMRVLRN+   +   +      +  ++  +D+ +     +A++ + + +  L++ +K  L  ++   G   D+S R  + + L+E+ P+   L E+L +L        EL +Y + +LQ + ++  I    L +L++   +   + V + NG S + F +  Y + +     S+     NK++K +   V + N  D    L + L TGGL   +     +  ++  A   ++++L  V LRP   F+   EL    WSG+   + + L     + D     V  SG      ++G++S D  G + +S++++ + S +     + L  SL
Sbjct:  106 VELTPVWQNPSDAAHMLFELLMSNPKLSVRSRKAQQPDGFIDHSSPLDDAQSTAVYIDWNDGIISHIYAFESESVSLNNLKKGIASLFQLQTSGIEIHELDASGNCTATYNSLGGRTFLKVKSNCQFRRPTSSFSQSQKILGLASVS--SQQTKFNLKSDSDVVDTLISTEVHAVRVKLRSQAGASVI-SRQHLRLNGESKSNKKFPA---ASLAKAVESIKMSTNVNLIGDNLQLVEELVDACETSSCKSLKKA-VNDLRKNLQTSNVATPSGAGAFGKLLPIVRRSSKVDILALLKDSKNKPILPQLMDVVAAAQTHESYTAAIEAINFQSQDIDLAERFLQVVSLSTHPSEDILNGLLTLS---------KKIKSEKLSETALLSLAAVTRTFASHPEKASSPLVTRIHKYVIDNLEACSKEDCKQMYMRVLRNLGSVEMLPI------LLAHIDSTDRKTSVWAVKAVRALPTSV-FLDDRVKDKLQRVYFQMGRPYDSSARTLALDTLLEHEPDETFLLEVLTSLSMGGRENLELNTYTLQRLQESAENDPILHSKLKQLLSDQPFLNTYHVFAQNGMS-TTFSRVLYRNIDGNGTFSSSTEAVNKMMKRAAFDVYVRNSEDAFQLLSVGLFTGGLGSLMGFSSTESEEEEEATAGMEVTLAGVQLRPIVFFTGQGELMGHVWSGTASERTTALQATVLLQDHRQAVVLQSGFIAVLDIRGSVSFDFGGEIQISIWNRNSHSVVEDIAAWQLDGSL 842          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|942296213|gb|JAN30039.1| (Microsomal triglyceride transfer protein large subunit [Daphnia magna])

HSP 1 Score: 150.214 bits (378), Expect = 7.548e-34
Identity = 179/761 (23.52%), Postives = 333/761 (43.76%), Query Frame = 0
Query:   53 VERASVWKKGEDEV-VLYTLTPTNER-------------FLVHVS--DSAKIVAIYFE---GDKPH-----------KNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC-----LSEDTMKHKLHDESGSTEWSSETLIDLKKDK----SILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI--------ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLN---------WFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS----ELTSYVVNKLQSNPKSKRI----LGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD---FLKMELSTGGLSGFIA-DKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
            VE   VW+   D   +L+ L  +N +             F+ H S  D A+  A+Y +   G   H            NL KGIASLF  +T+  E  + D SG+C   Y +      L++K  C      S  +   K+   +  +  S +T  +LK D     +++  E+    VK     G   I SRQ + L+     +   P     ++ + ++++      + +G+++        A    S +  K   +  L+  L+ +++ATP GA AF     I+R   +   ++ LKD  NK ILPQ+MDV  +  T +++ A +     +S +  L ERF+  +S   H     ++  + +S          K  SE L E+ + SL+ +     S+ E  +         + +D+   C++E+C   YMRVLRN+   +   +      +  ++  +D+ +     +A++ + + +  L++ +K  L  ++   G   D+S R  + + L+E+ P+   L E+L +L        EL +Y + +LQ + ++  I    L +L++   +   + V + NG S + F +  Y + +     S+     NK++K +   V + N  D    L + L TGGL   +     +  ++  A   ++++L  V LRP   F+   EL    WSG+   + + L     + D     V  SG      ++G++S D  G + +S++++ + S +     + L  SL
Sbjct:   70 VELTPVWQNPSDAAHMLFELLMSNPKLSVRSRKAQQPDGFIDHSSPLDDAQSTAVYIDWNDGIISHIYAFESESVSLNNLKKGIASLFQLQTSGIEIHELDASGNCTATYNSLGGRTFLKVKSNCQFRRPTSSFSQSQKILGLASVS--SQQTKFNLKSDSDVVDTLISTEVHAVRVKLRSQAGASVI-SRQHLRLNGESKSNKKFPA---ASLAKAVESIKMSTNVNLIGDNLQLVEELVDACETSSCKSLKKA-VNDLRKNLQTSNVATPSGAGAFGKLLPIVRRSSKVDILALLKDSKNKPILPQLMDVVAAAQTHESYTAAIEAINFQSQDIDLAERFLQVVSLSTHPSEDILNGLLTLS---------KKIKSEKLSETALLSLAAVTRTFASHPEKASSPLVTRIHKYVIDNLEACSKEDCKQMYMRVLRNLGSVEMLPI------LLAHIDSTDRKTSVWAVKAVRALPTSV-FLDDRVKDKLQRVYFQMGRPYDSSARTLALDTLLEHEPDETFLLEVLTSLSMGGRENLELNTYTLQRLQESAENDPILHSKLKQLLSDQPFLNTYHVFAQNGMSTT-FSRVLYRNIDGNGTFSSSTEAVNKMMKRAAFDVYVRNSEDAFQLLSVGLFTGGLGSLMGFSSTESEEEEEATAGMEVTLAGVQLRPIVFFTGQGELMGHVWSGTASERTTALQATVLLQDHRQAVVLQSGFIAVLDIRGSVSFDFGGEIQISIWNRNSHSVVEDIAAWQLDGSL 806          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|665789446|ref|XP_008560360.1| (PREDICTED: microsomal triglyceride transfer protein large subunit [Microplitis demolitor])

HSP 1 Score: 143.665 bits (361), Expect = 1.028e-31
Identity = 157/666 (23.57%), Postives = 298/666 (44.74%), Query Frame = 0
Query:  101 NLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKV-----ELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI--ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSN--EEYLNWFLD-SFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFI---NPGEDNSVRISSFEALIENNPNAQLLGEILDNL-IADS--ELTSYVVNKLQS----NPKSKRILGELIASGHW---NWDVLSTNGQSLSYFEKGKYFSTNFGLELSTNKI----LKESYLHVSLPNISD---FLKMELSTGGLSGFIADKPDPNDDSNAHLS---VQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLK 733
            NL +G+ASLF Y+T   +  + D SG C V Y++   + M ++K  C  + T K +  +     +  S  + D K + ++L +     E  E  +K  P +G      R   M+ E      V  + +   VK+ +  +   ++   +G  +   + PDS        +   +  L+ ++L T + A AF+    +MR    +  V  LK      +  QI+DV G+  T  T +A + + + + + ++  ER++WAL S+     P I   V   SE  + +Q+ K S     E++  +   +   +     +E +   L+     C+ EEC  K++R LRN+      +   ++ ++ ++ +   K++     +A+K +D+    +  EIKT     F     P +D+++R  + + ++EN+P+ + L   L  L   DS  E+  Y+  +L+     +P     L   + +  W   N++VL+  G S ++       S + G  ++  ++    LK   + V L   +       + L  GGL  FI+     +D     L+   ++L  L V +RPF  F+   EL    WSG+   +         ++    +   +SG   E  ++GA+S D++G + +SL+S+TA S +  G G  ++
Sbjct:  149 NLKRGLASLFQYRTLDGDYREHDASGTCNVTYESTGPSSMRKIKKNCDQDLTAKREHPNPIMGVDVLSTRVADYKLNAALLPIVIEEFEQHEVSLKTKPEVGATVTSQR---MVKEVGGT-KVAKKIQAANVKDAVAYLQPGFREVKIGSQVESVSCPDSGCLTLEKLIEENREALENSALGTAKSAAAFLKLIPVMREATAEDLVKILKSPRYFPLKTQILDVLGAAATPATHQAAMKILRTDDSGDE-TERYLWAL-SMAPLPHPDIIKDVLKKSE--ETLQNEKVS-----ETYALTAGAMARQLNDPVVKEMVRVSLEIGLDTCSSEECRQKFLRGLRNL------RSKASIAALLDSAVNGTKSTSVTAWQALKSLDTQF--ITSEIKTAARRAFYQIGGPKKDSTIRTIAADIILENDPSTEDLRGFLKYLSTQDSMFEVRRYISQRLEQLAEKDPVFNDKLEAALTAEAWRVRNYNVLAHKGLSTAFTRPFLKSSASNGSLVTVQEVNSGLLKRGVVDVVLATAAHEEALFSLGLFAGGLGSFISSSSSDDDSEEYELATAGMELGFLGVGIRPFVFFTGQGELMGHVWSGTGSERTPAFQAIANLHRHHEIVPLTSGFVAEIDIEGAVSFDLAGQIQLSLWSRTAQSLVEMGAGIAVR 793          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|936597739|ref|XP_014212365.1| (PREDICTED: microsomal triglyceride transfer protein large subunit [Copidosoma floridanum] >gi|936597741|ref|XP_014212366.1| PREDICTED: microsomal triglyceride transfer protein large subunit [Copidosoma floridanum])

HSP 1 Score: 142.895 bits (359), Expect = 1.780e-31
Identity = 184/800 (23.00%), Postives = 331/800 (41.38%), Query Frame = 0
Query:   27 GETVVQKYEYSXAWFANVSSET--INFKVERASVWKKGEDEVVLYTLTPTNERFLVHVS---DSAK-----------IVAIYFEGDKP--HKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDESGSTEWSSETLIDLKKDKSILKVELVE------NLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDIATP------PDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLNWFLDSFS----KCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPEL-NEEIKTILMTIFIN-PGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS---ELTSYVVNKLQSNPKSKRILGELIASGH-------WNWDVLSTNGQSLSYFEKGKYFSTNFGLELSTNKI----LKESYLHVSLPNIS---DFLKMELSTGGLSGFIA-----DKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSLVGIWKEETLISNIHEGSGKVVLDMEGDIRI 766
            G  V  K   S  W      ET  I+ K +   +W K           P  E F+ H S   D+ K           I  I+   D+     NL +GIAS+F YKT      +RD SG C V YK      + ++K+ C S    KH+  +       S+   I  +  ++++   ++E      +LV +  L     + + +   L    F+ + V    Y         V  K+ + FV   I T       P+S        L      L+  +L T + A AF+    ++R    +     LK   N +ILPQ+ D++GS  T+   +A + + + +   +   ER++WALS+  +     I   ++ S E+ Q+        + L E++  + + +          +    DS       C  E+C +K++R L N+         + V+ +   +L+   +SK +   A K I S+   L   ++K + M  F    G+  D++VR  +   ++EN+P+   L  +L  L       E+  Y+V ++Q    +     E + +         +N++  +  G S ++       + + G  ++  +I    LK   + + L + S    F  + L  GGL+ F++     D   P D+  A   ++LS+L V +RPF  FS   EL    WSG+   + +       ++    V    SG   E  ++GA+S+D++G V +SL+S+ A S +  G G       + I     +++N  +   +  L++E  + +
Sbjct:   54 GFQVTAKVRVSPIWKDPTDPETTLISIKTDSLQLWIKSRK-------APKPEGFVKHTSRLEDAPKEPIFLLWKKGQIKTIFANSDESISSLNLKRGIASIFQYKTVDSVFQERDASGLCNVTYKFVRPKVLNKIKEFCKS---TKHQHSNPILGVRVSNLNSITYELTETLIPKHVIEEEKHEMHLVAK--LDARSSVTTHRTFRLLPETFVGETVVASTY-------PEVFNKFNSRFVDISIETQNEHTPCPESGCLTLEAALENYSKALESANLGTAKSASAFLKIVPLIREASAENLAKILKSPRNHDILPQLYDLYGSASTLAAHQAAMKILRQDELGDNT-ERYLWALSTSAYPDASIIKDVLKRSEEVIQN--------DKLSETYALTAAAMAKR-HGGLSVIELVKDSLELGLHTCTGEQCKMKFLRSLGNLG-------SKGVVPI---LLRHTNSSKSLSVIAWKAISSLCASLITGDVKKLAMKTFFQLNGQKIDSTVRTLTLNVILENDPSVDELHALLLYLTKRDKVYEVQKYLVQRIQQLASTDVQFNEKLEAALKRDFYKLFNYNTYAQRGLSTAFTRDFVRSAGSNGSLVTIQEINSGLLKRGVVDIVLESGSHKYTFFSLGLFAGGLNSFVSSNEPEDNEIPTDNEPATAGMELSVLDVDIRPFVFFSGQGELMGHVWSGTASERTAAFQTIVNLHRHREVIFLGSGFVVEIGVEGAISIDLAGHVQLSLWSRNAQSIVELGAG-------IAIQGSSKILTNFVQSRAEFTLNLEPKLEL 807          
BLAST of EMLSAG00000001530 vs. nr
Match: gi|1022758096|gb|KZS04667.1| (Microsomal triglyceride transfer protein large subunit [Daphnia magna])

HSP 1 Score: 142.124 bits (357), Expect = 3.304e-31
Identity = 168/732 (22.95%), Postives = 323/732 (44.13%), Query Frame = 0
Query:   53 VERASVWKKGEDEV-VLYTLTPTNERFLVHVSDSAKIVAIYFEGDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDEC-----LSEDTMKHKLHDESGSTEWSSETLIDLKKDK----SILKVELVENLVKRDPLMGDYEIESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVAKKYKTSFVGEDI--------ATPPDSKRKFKPTQLVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSESLKESFINSLSLICNNIKSNEEYLN---------WFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGE--DNSVRISSFEALIENNPNAQLLGEILDNLIADS----ELTSYVVNKLQSNPKSKRI----LGELIASGHW--NWDVLSTNGQSLSYFEKGKYFSTNFGLELST-----NKILKESYLHVSLPNISD---FLKMELSTGGLSGFIA-DKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYDSVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRSL 736
            VE   VW+   D   +L+ L  +N +  V  S  A+    + +   P  +  +  A LF  +T+  E  + D SG+C   Y +      L++K  C      S  +   K+   +  +  S +T  +LK D     +++  E+    VK     G   I SRQ + L+     +   P     ++ + ++++      + +G+++        A    S +  K   +  L+  L+ +++ATP GA AF     I+R   +   ++ LKD  NK ILPQ+MDV  +  T +++ A +     +S +  L ERF+  +S   H     ++  + +S          K  SE L E+ + SL+ +     S+ E  +         + +D+   C++E+C   YMRVLRN+   +   +      +  ++  +D+ +     +A++ + + +  L++ +K  L  ++   G   D+S R  + + L+E+ P+   L E+L +L        EL +Y + +LQ + ++  I    L +L++   +   + V + NG S + F +  Y + +     S+     NK++K +   V + N  D    L + L TGGL   +     +  ++  A   ++++L  V LRP   F+   EL    WSG+   + + L     + D     V  SG      ++G++S D  G + +S++++ + S +     + L  SL
Sbjct:   73 VELTPVWQNPSDAAHMLFELLMSNPKLSVR-SRKAQQPDGFIDHSSPLDDA-QSTAVLFQLQTSGIEIHELDASGNCTATYNSLGGRTFLKVKSNCQFRRPTSSFSQSQKILGLASVS--SQQTKFNLKSDSDVVDTLISTEVHAVRVKLRSQAGASVI-SRQHLRLNGESKSNKKFPA---ASLAKAVESIKMSTNVNLIGDNLQLVEELVDACETSSCKSLKKA-VNDLRKNLQTSNVATPSGAGAFGKLLPIVRRSSKVDILALLKDSKNKPILPQLMDVVAAAQTHESYTAAIEAINFQSQDIDLAERFLQVVSLSTHPSEDILNGLLTLS---------KKIKSEKLSETALLSLAAVTRTFASHPEKASSPLVARIHKYVIDNLEACSKEDCKQMYMRVLRNLGSVEMLPI------LLAHIDSTDRKTSVWAVKAVRALPTSV-FLDDRVKDKLQRVYFQMGRPYDSSARTLALDTLLEHEPDETFLLEVLTSLSMGGRENLELNTYTLQRLQESAENDPILHSKLKQLLSDQPFLNTYHVFAQNGMS-TTFSRVLYRNIDGNGTFSSSTEAVNKMMKRAAFDVYVRNSEDAFQLLSVGLFTGGLGSLMGFSSTESEEEEEATAGMEVTLAGVQLRPIVFFTGQGELMGHVWSGTASERTTALQATVLLQDHRQAVVLQSGFIAVLDIRGSVSFDFGGEIQISIWNRNSHSVVEDIAAWQLDGSL 778          
BLAST of EMLSAG00000001530 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold45_size475391-snap-gene-3.17 (protein:Tk10519 transcript:maker-scaffold45_size475391-snap-gene-3.17-mRNA-1 annotation:"microsomal triglyceride transfer protein large subunit")

HSP 1 Score: 166.777 bits (421), Expect = 5.562e-43
Identity = 198/772 (25.65%), Postives = 353/772 (45.73%), Query Frame = 0
Query:   43 NVSSETINFKVERA--SVWKKGEDEVVLYTLTPTNERFLVHVSDSAKIVAIYFE-----GDKPHKNLLKGIASLFLYKTTPWEGWQRDVSGDCYVRYKTKNENRMLRLKDECLSEDTMKHKLHDESGSTEWSSETLIDLKKD---KSILKVE--------LVENLVKRDPLMGDYEI--ESRQDIMLSEYDFIDDVVPEDKYLTVKEVIDAVA-------KKYKTSFVGEDIATPPDSKRKFKPTQ----LVALKSKLKYNSLATPEGAKAFISAXKIMRXIDEKTAVSFLKDKLNKNILPQIMDVFGSIHTIDTFKAVLSVFKPESTNNKLLERFIWALSSVEHFWTPKIHHSVQISSELFQHIQHSKFSSES-LKESFINSLSLICNNIKSNEEYLNWFLDSFSKCAEEECFLKYMRVLRNIDYAQQEKLGENVLSMANNVLKSDKASKRMKTEAIKLIDSILPELNEEIKTILMTIFINPGEDNSVRISSFEALIENNPNAQLLGEILDNLIA--DSELTSYVVNKLQSNPKSKRILGELIA--SGHWNWDVLSTNG------QSLSYFEKGKYFSTNFGLELSTNKILKESYLHVSLPNISD---FLKMELSTGGLSGFIADKPDPNDDSNAHLSVQLSLLSVPLRPFHLFSSMSELTSLYWSGSMETKQSLLAFNRYIYD-SVSVHVFSSGLHFESQLKGALSMDISGSVIVSLFSQTADSSISSGFGFYLKRS--LVGIWKE--ETLISNIHEGSGKVVLDMEGDI 764
            N   + + F+V     +V K   + V    LT T   F VH S   KI  ++       GD    N  +GIASLF Y+++ W+G + DVSGDC V Y T + + + + K  C          H +     +  E ++D+ +D   ++I K++        + EN ++    + +  I  E+ Q + L E    D    + +  +   V +++A       K +K   V E+    P      +P Q    + +LK  L+  +LA    AKAF+    +++ +D+   VS LKDK  K  LPQI+DV GS  TID   A L +     T  +LLER+ WA +       P+    V +  ++ ++ +  K ++ + L+E+ + +L  +   ++ +E          S C+  E +                          +NV+     ++++KT                    L+T+F +P  D+S R  S E L+   P  +L  EIL  L A   +E++ Y +N+++   +S   L +L+   S   NW++L+ NG      ++L+    G   + ++G+E+S  K+LK S   + L N  +    L++++   GL   +    D   + +A   ++L++L   LRPF  F SMS+L  LYWSG  E K S L  ++ +++ +  VH  S+GL  +S ++  +S D SG   +S++ ++  + + +     LK S  ++  W +   + +S  HE + +  L++E +I
Sbjct:  133 NPQEQLLQFQVSNPVYNVTKASSESVAQSGLTGT---FFVHTS-YGKIQQLFAPKALALGDL---NFFRGIASLFQYQSSSWQGSETDVSGDCQVLY-TPDHHGVHKTKQAC----------HCKDSPAIYKDEQILDVSQDGFFRAIYKLQGDVIETCQVHENHIREITSLREVGIVLETFQHLHLKEQVDSD----QSEIASAPAVQESIALLEKTQGKMHKVGIVSENALETP------QPVQFKNLISSLKRSLRPEALAKELAAKAFLQLLPVIQRMDKADLVSVLKDKTLKETLPQILDVLGSAGTIDAHFAALEL---AGTKTELLERYFWATAQTAK---PE----VAVVQDILKYSETMKETTNTKLQETVMLTLGTLGRRLEGSEVS--------SVCSFRESY--------------------------HNVMPPSSMNQKVKT-------------------TLLTLFKDPNNDSSARTLSVEILLSLKPGLRLFEEILGVLEAAKANEMSLYSLNRMREYAESDAYLKKLLQEHSSRLNWNLLANNGFSSTFARTLTNTPSGNA-TFSYGMEIS-QKLLKRSSFELLLRNDKEHTKILQLDIFASGLGSLMDSAGD--GEGSATAGMELTVLGNSLRPFVFFESMSDLIGLYWSGQAEKKTSALQGSQLLHNHNTQVHT-SNGLILKSAVQSCVSFDFSGQAKISMWDKSCQTVVENSAAIVLKSSHQVLLPWDQSSSSAMSIQHEVATRAQLNLEAEI 808          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000001530 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 13
Match NameE-valueIdentityDescription
-1.388e-2223.87symbol:MTTP "Microsomal triglyceride transfer prot... [more]
-1.473e-2223.87symbol:MTTP "Microsomal triglyceride transfer prot... [more]
-1.658e-2122.99symbol:MTTP "Microsomal triglyceride transfer prot... [more]
-1.839e-2122.99symbol:MTTP "Microsomal triglyceride transfer prot... [more]
-3.950e-2023.66symbol:Mttp "microsomal triglyceride transfer prot... [more]
-1.859e-1823.62symbol:Mttp "microsomal triglyceride transfer prot... [more]
-7.325e-1822.29symbol:Mtp "Microsomal triacylglycerol transfer pr... [more]
-3.210e-1721.89symbol:MTTP "Uncharacterized protein" species:9615... [more]
-7.172e-1722.94symbol:MTTP "Microsomal triglyceride transfer prot... [more]
-1.460e-1622.94symbol:MTTP "Microsomal triglyceride transfer prot... [more]

Pages

back to top
BLAST of EMLSAG00000001530 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 3
Match NameE-valueIdentityDescription
gi|592857657|gb|GAXK01099905.1|2.580e-1924.18TSA: Calanus finmarchicus comp253228_c0_seq1 trans... [more]
gi|592822310|gb|GAXK01132258.1|3.184e+026.79TSA: Calanus finmarchicus comp26304_c0_seq1 transc... [more]
gi|592869582|gb|GAXK01087980.1|9.385e+032.63TSA: Calanus finmarchicus comp3807147_c0_seq1 tran... [more]
back to top
BLAST of EMLSAG00000001530 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000015300.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1263:7207... [more]
back to top
BLAST of EMLSAG00000001530 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
gi|1709166|sp|P55156.1|MTP_BOVIN1.086e-2223.87RecName: Full=Microsomal triglyceride transfer pro... [more]
gi|46396062|sp|Q865F1.1|MTP_PIG1.440e-2122.99RecName: Full=Microsomal triglyceride transfer pro... [more]
gi|284018098|sp|O08601.2|MTP_MOUSE1.458e-1823.62RecName: Full=Microsomal triglyceride transfer pro... [more]
gi|1709168|sp|P55158.1|MTP_MESAU7.649e-1721.38RecName: Full=Microsomal triglyceride transfer pro... [more]
gi|1709167|sp|P55157.1|MTP_HUMAN1.145e-1622.94RecName: Full=Microsomal triglyceride transfer pro... [more]
gi|1133968646|sp|A0A0N6WHT4.1|MTP_MEGAM5.485e-1522.40RecName: Full=Microsomal triglyceride transfer pro... [more]
back to top
BLAST of EMLSAG00000001530 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 11
Match NameE-valueIdentityDescription
EFX89528.16.396e-3223.49hypothetical protein DAPPUDRAFT_220651 [Daphnia pu... [more]
EEB12549.17.354e-3123.42Microsomal triglyceride transfer protein large sub... [more]
XP_623644.31.653e-2824.17PREDICTED: microsomal triglyceride transfer protei... [more]
gb|EFA08014.1|3.211e-2623.11Microsomal triglyceride transfer protein large sub... [more]
EAA13951.46.269e-2222.27AGAP010234-PA, partial [Anopheles gambiae str. PES... [more]
gb|KFM66322.1|5.098e-2124.21Microsomal triglyceride transfer protein large sub... [more]
AAF53946.22.521e-1721.89microsomal triacylglycerol transfer protein [Droso... [more]
gb|EEC02059.1|5.113e-1132.03microsomal triglyceride transfer protein, putative... [more]
gb|KPM06676.1|1.058e-1023.60hypothetical protein QR98_0051540 [Sarcoptes scabi... [more]
gb|KFM74933.1|2.703e-724.63Microsomal triglyceride transfer protein large sub... [more]

Pages

back to top
BLAST of EMLSAG00000001530 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|646719578|gb|KDR21635.1|4.469e-3825.03Microsomal triglyceride transfer protein large sub... [more]
gi|926629512|ref|XP_013780404.1|3.196e-3626.38PREDICTED: microsomal triglyceride transfer protei... [more]
gi|942320679|gb|JAN42272.1|4.584e-3423.50Microsomal triglyceride transfer protein large sub... [more]
gi|942346806|gb|JAN55334.1|5.186e-3423.52Microsomal triglyceride transfer protein large sub... [more]
gi|942299215|gb|JAN31540.1|6.711e-3423.52Microsomal triglyceride transfer protein large sub... [more]
gi|942416169|gb|JAN90014.1|7.407e-3423.52Microsomal triglyceride transfer protein large sub... [more]
gi|942296213|gb|JAN30039.1|7.548e-3423.52Microsomal triglyceride transfer protein large sub... [more]
gi|665789446|ref|XP_008560360.1|1.028e-3123.57PREDICTED: microsomal triglyceride transfer protei... [more]
gi|936597739|ref|XP_014212365.1|1.780e-3123.00PREDICTED: microsomal triglyceride transfer protei... [more]
gi|1022758096|gb|KZS04667.1|3.304e-3122.95Microsomal triglyceride transfer protein large sub... [more]

Pages

back to top
BLAST of EMLSAG00000001530 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 1
Match NameE-valueIdentityDescription
maker-scaffold45_size475391-snap-gene-3.175.562e-4325.65protein:Tk10519 transcript:maker-scaffold45_size47... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1263supercontigLSalAtl2s1263:7207..10466 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1263-augustus-gene-0.4
Biotypeprotein_coding
EvidenceIEA
NoteMicrosomal triglyceride transfer protein large subunit
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000001530 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000001530EMLSAT00000001530-697377Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1263:7207..10466+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000001530-684296 ID=EMLSAG00000001530-684296|Name=EMLSAG00000001530|organism=Lepeophtheirus salmonis|type=gene|length=3260bp|location=Sequence derived from alignment at LSalAtl2s1263:7207..10466+ (Lepeophtheirus salmonis)
TTTACAAACAGACTTCGAAGATATCAAATGGCAATGCTCACAAGGAAGTG CACTACACATGTGAAATAATAAATGAATAAACAAAATAAATCCTTCTAAA AACACAGTGAAAACTCTCGTTTCACATGTTTGTCTTCTTTTTTCTTGTTT TTATTATAGATTTGTGTCTTCCATCTCAGTCGTACATTAACATTCTTTTC GGATTCATGAATACACGAGATAACGATTCAACACCATGTATTACTACAAA ACGCCGACTCTATCAACAGTTGTAGTTGTAGTTGTGGGAATATTTTTAGG TCATACAGGTAAGTGTGTATCCGAGTGTCTTCGAGTGCGTGTTCCCCTTC CCTCCAGACTCATAGACAGTTGTAGCTACCTGTCAATAATTCTTAGCACT AACATGTCTGCACTACTCATAGAATGTTGATCAACATATTTATTCTGAAT CTATCACTTCCCTTGTTATTAGTTTCTGGTGAGACAGTAGTTCAAAAATA TGAATATTCTSCCGCCTGGTTTGCCAATGTATCCAGTGAAACCATTAATT TCAAGGTGGAGCGTGCATCCGTATGGAAGAAGGGAGAAGATGAAGTAGTA CTCTATACTCTCACTCCCACGAACGAACGGTTCCTAGTGCATGTCTCTGA TAGTGCTAAAATTGTAGCCATTTACTTTGAAGGGGATAAACCTCATAAGA ACCTACTCAAAGGTATTGCTTCCCTCTTTCTATACAAAACAACTCCTTGG GAAGGTTGGCAAAGAGATGTCTCCGGTGACTGCTATGTTCGATATAAAAC TAAGAATGAGAATCGGATGTTGAGGTTAAAGGATGAGTGTCTATCTGAAG ATACAATGAAGCATAAGCTTCATGATGAATCGGGATCCACGGAATGGAGT TCCGAGACTCTCATTGATTTGAAAAAGGATAAATCGATACTCAAAGTGGA GTTAGTCGAGAATTTGGTAAAAAGGGATCCGTTGATGGGGGATTATGAGA TTGAGTCACGGCAAGACATCATGTTGAGTGGTAAGTTGATTGATTTTTTA AAAGGTTGTTATTATATAATTATTCATCCAACGTATTAGAGTATGACTTC ATAGATGATGTTGTCCCAGAGGATAAATATCTCACTGTAAAGGAAGTCAT AGATGCAGTGGCTAAAAAGTATAAGACTTCATTCGTGGGAGAAGATATTG CTACTCCACCAGACTCTAAACGAAAAGTAATCAAAATTCACCATTATTTT TAATAAATTATATTACAATCATCTTCTTTTTAATTTTAGTTCAAGCCCAC TCAATTAGTTGCATTAAAATCCAAGCTAAAATATAATTCCTTGGCGACCC CCGAAGGAGCCAAGGCTTTTATATCGGCTGMCAAGATAATGAGAAAWATT GACGAGAAGACAGCAGTTAGTTTTCTAAAAGACAAGTTGAACAAAAATAT ATTGTAGGAACCAAATATGAAACATCTCTCAATATAATACAAGACTCATA TCCAATAATTTAATCTATTATTTCAGACCACAAATAATGGATGTCTTTGG CTCTATTCATACGATTGATACATTCAAAGCCGTGCTCTCTGTTTTTAAGC CTGAAAGTACAAATAACAAGTTATTAGAGAGATTCATTTGGGCTCTATCT TCTGTGGAGCATTTTTGGACCCCTAAAATTCACCATAGCGTACAAATATC ATCAGAATTATTCCAGCATATACAACATTCCAAATTTTCTTCAGAATCTC TCAAAGAAAGTTTCATAAATAGTTTAAGTCTCATATGTAATAACATCAAG TCCAATGAGGAGTATTTGAATTGGTTTTTGGACTCATTTAGCAAATGCGC GGAGGAGGAGTGTTTCCTCAAGTACATGAGAGTTCTTAGAAATATTGACT ACGCACAACAGGAGAAACTAGGAGAGAATGTTTTAAGCATGGCTAACAAT GTTTTGAAATCGGATAAAGCATCCAAACGTATGAAGACAGAAGCTATTAA ACTCATTGATTCAATCCTTCCGGAATTGAATGAAGAAATAAAAACGATTT TAATGACGATTTTTATTAATCCTGGAGAGGACAACTCTGTTCGTATTTCC TCTTTCGAAGCCCTGATAGAAAATAATCCAAATGCTCAACTCCTCGGTGA AATTTTAGATAATCTAATCGCAGATTCAGAACTTACCTCATATGTAGTAA ATAAGTTACAGAGTAATCCTAAGAGTAAACGTATACTCGGGGAGCTTATT GCCTCAGGACACTGGAACTGGGATGTACTCAGTACAAATGGTCAATCCTT ATCTTATTTTGAAAAGGGAAAATACTTTTCAACCAACTTTGGATTGGAAT TATCAACAAACAAAATCCTTAAGGAGAGTTATTTACATGTCAGTTTACCA AACATATCTGATTTCCTGAAAATGGAGCTTTCTACTGGAGGACTCTCAGG ATTTATAGCAGACAAACCAGATCCTAATGATGATTCCAATGCTCATTTGA GTGTTCAACTTTCATTATTAAGTGTTCCTCTGAGGCCTTTTCACCTCTTT AGCTCCATGTCAGAGCTTACTTCCCTCTACTGGTCGGGTTCCATGGAGAC GAAACAGTCTCTTCTAGCATTTAATAGATATATTTATGACTCTGTATCCG TTCACGTATTCTCATCGGGACTACATTTTGAATCCCAATTGAAGGGTGCA CTCTCCATGGATATTTCTGGCTCGGTCATAGTGTCTCTTTTCTCACAAAC AGCTGATAGTTCTATATCAAGTGGATTTGGTTTTTACTTAAAACGATCTC TTGTAGGGATATGGAAGGAAGAGACCTTGATTTCAAATATCCATGAAGGC TCGGGAAAAGTTGTACTTGATATGGAAGGGGATATACGNATTTGATGGTC GCTCCTGCATTAAAATGATGTTGCAGCCGGTTGATTTYMAGTAATTATTA TTATTTTGGAGGATATTTTAAGTTCATATTAATTGAATATATTATTTATT KTTTAGSGWAAWAACTTCGACATTATCAAAGAACCACAAACTTGGAAAAG TAACTACCAAAGAAAACTCAAAAGATATAAACATTCCAGGACAGACCCTT TCTCTTCACCAAAAGATCTCTCAACTCTGCAATGAAGTCTCATAAATGTC AGAAATAAACAATTATATTTGAATATAAATAGAATAGTAGTAGGGTATGA CTACTGGGTCCTCATAAAAAGTAATGTTGAGGAAATATCCCTCATGATAA ATAAATAAAA
back to top
Add to Basket