EMLSAG00000001764, EMLSAG00000001764-684530 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592761956|gb|GAXK01192457.1| (TSA: Calanus finmarchicus comp1035040_c0_seq2 transcribed RNA sequence) HSP 1 Score: 51.6026 bits (122), Expect = 1.280e-8 Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 0 Query: 24 SLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLIIGEYSEGPDKALSTTS 82 +LY + +G+QFW++K +F+ GKL V C A I IY S ++G ++E P L T S Sbjct: 267 TLYITTLGLQFWVKKKHFMDGKLVVSCNAFIPQIYNMSSTSHVVGRFTE-PHHFLETKS 440
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592761957|gb|GAXK01192456.1| (TSA: Calanus finmarchicus comp1035040_c0_seq1 transcribed RNA sequence) HSP 1 Score: 51.6026 bits (122), Expect = 1.856e-8 Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 0 Query: 24 SLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLIIGEYSEGPDKALSTTS 82 +LY + +G+QFW++K +F+ GKL V C A I IY S ++G ++E P L T S Sbjct: 267 TLYITTLGLQFWVKKKHFMDGKLVVSCNAFIPQIYNMSSTSHVVGRFTE-PHHFLETKS 440
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592758280|gb|GAXK01196133.1| (TSA: Calanus finmarchicus comp700321_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.8094 bits (81), Expect = 9.508e-3 Identity = 16/47 (34.04%), Postives = 26/47 (55.32%), Query Frame = 0 Query: 22 KGSLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLIIG 68 KG L S + + + + +F G L V+C + I DIY + SK++ G Sbjct: 901 KGVLISSKISLDIVLERRHFRYGDLVVKCTSDIYDIYFQSSKIIFAG 1041
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592758279|gb|GAXK01196134.1| (TSA: Calanus finmarchicus comp700321_c0_seq2 transcribed RNA sequence) HSP 1 Score: 35.039 bits (79), Expect = 1.622e-2 Identity = 16/47 (34.04%), Postives = 26/47 (55.32%), Query Frame = 0 Query: 22 KGSLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLIIG 68 KG L S + + + + +F G L V+C + I DIY + SK++ G Sbjct: 901 KGVLISSKISLDIVLERRHFRYGDLVVKCTSDIYDIYFQSSKIIFAG 1041
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592912032|gb|GAXK01046343.1| (TSA: Calanus finmarchicus comp580888_c2_seq2 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 6.468e-1 Identity = 12/37 (32.43%), Postives = 23/37 (62.16%), Query Frame = 0 Query: 25 LYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEK 61 L+ + +G++ + KD+F GKLKV C+ + ++ K Sbjct: 754 LFVTRIGLRIRLTKDHFHWGKLKVACLGEVKAVFWAK 864
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592912033|gb|GAXK01046342.1| (TSA: Calanus finmarchicus comp580888_c2_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 6.545e-1 Identity = 12/37 (32.43%), Postives = 23/37 (62.16%), Query Frame = 0 Query: 25 LYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEK 61 L+ + +G++ + KD+F GKLKV C+ + ++ K Sbjct: 857 LFVTRIGLRIRLTKDHFHWGKLKVACLGEVKAVFWAK 967
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592916944|gb|GAXK01041431.1| (TSA: Calanus finmarchicus comp2061746_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.907e+0 Identity = 16/60 (26.67%), Postives = 31/60 (51.67%), Query Frame = 0 Query: 12 ISNENLLSLPKGSLYESIVGIQFWIRKDYFLAGKLKVQCVARISD--IYLEKSKVLIIGE 69 + N + + L S++G++F ++YF G K++C A I+ +S+VL G+ Sbjct: 224 VVNRRTVEHSQSGLETSVLGLRFPATREYFHRGVAKIKCEAEIAGGVWATSQSQVLTGGD 403
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592815441|gb|GAXK01139127.1| (TSA: Calanus finmarchicus comp195918_c1_seq3 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.108e+0 Identity = 17/44 (38.64%), Postives = 24/44 (54.55%), Query Frame = 0 Query: 3 VLRYPSTEIISNENLLSLPKGSLYESIVGIQFWIRKDYFLAGKL 46 +LR S E+ LL GS++ V +Q W+R D +LAG L Sbjct: 143 ILRSSSVEL-EGRLLLKQLLGSVWTHNVVLQIWVRSDQWLAGWL 271
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592815442|gb|GAXK01139126.1| (TSA: Calanus finmarchicus comp195918_c1_seq2 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.611e+0 Identity = 17/44 (38.64%), Postives = 24/44 (54.55%), Query Frame = 0 Query: 3 VLRYPSTEIISNENLLSLPKGSLYESIVGIQFWIRKDYFLAGKL 46 +LR S E+ LL GS++ V +Q W+R D +LAG L Sbjct: 143 ILRSSSVEL-EGRLLLKQLLGSVWTHNVVLQIWVRSDQWLAGWL 271
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Match: gi|592774920|gb|GAXK01179648.1| (TSA: Calanus finmarchicus comp1182319_c1_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.673e+0 Identity = 11/45 (24.44%), Postives = 27/45 (60.00%), Query Frame = 0 Query: 22 KGSLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLI 66 K +S++ ++F IR+ F GK+ ++C A + + +++ V++ Sbjct: 246 KDGRLDSVLQLKFRIRESQFQQGKIFLKCTAILGNFFMKSEGVVL 380
BLAST of EMLSAG00000001764 vs. L. salmonis peptides
Match: EMLSAP00000001764 (pep:novel supercontig:LSalAtl2s:LSalAtl2s12:1925067:1946656:-1 gene:EMLSAG00000001764 transcript:EMLSAT00000001764 description:"maker-LSalAtl2s12-snap-gene-19.2") HSP 1 Score: 188.734 bits (478), Expect = 4.316e-63 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 0 Query: 1 MLVLRYPSTEIISNENLLSLPKGSLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLIIGEYSEGPDKALSTTSFATEMNILKKN 93 MLVLRYPSTEIISNENLLSLPKGSLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLIIGEYSEGPDKALSTTSFATEMNILKKN Sbjct: 1 MLVLRYPSTEIISNENLLSLPKGSLYESIVGIQFWIRKDYFLAGKLKVQCVARISDIYLEKSKVLIIGEYSEGPDKALSTTSFATEMNILKKN 93 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001764 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001764 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 10
BLAST of EMLSAG00000001764 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001764 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001764 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001764 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001764 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s12:1925067..1946656- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001764-684530 ID=EMLSAG00000001764-684530|Name=EMLSAG00000001764|organism=Lepeophtheirus salmonis|type=gene|length=21590bp|location=Sequence derived from alignment at LSalAtl2s12:1925067..1946656- (Lepeophtheirus salmonis)back to top Add to Basket
|