EMLSAG00000002152, EMLSAG00000002152-684918 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000002152 vs. C. finmarchicus
Match: gi|592885092|gb|GAXK01073283.1| (TSA: Calanus finmarchicus comp149300_c1_seq34 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.406e+0 Identity = 13/39 (33.33%), Postives = 24/39 (61.54%), Query Frame = 0 Query: 7 DPEQNNKGIEPSVLEPVDVDDNSEFPNDENILDPMTPKS 45 D ++ + ++ VL+ ++VDD ++ NDENI D + S Sbjct: 621 DQDETDFCVKEEVLDTIEVDDETKTSNDENIADEVNAAS 737
BLAST of EMLSAG00000002152 vs. C. finmarchicus
Match: gi|592770623|gb|GAXK01183945.1| (TSA: Calanus finmarchicus comp57790_c1_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.232e+0 Identity = 15/38 (39.47%), Postives = 17/38 (44.74%), Query Frame = 0 Query: 42 TPKSQRKRRSLTEKSTNNPLTPSNKSINPKSIYFETDL 79 P+ KRRS+TE N SI FETDL Sbjct: 2339 APRRGMKRRSITEGGPQTAAAVVTAVQNSNSIIFETDL 2452
BLAST of EMLSAG00000002152 vs. C. finmarchicus
Match: gi|592810665|gb|GAXK01143903.1| (TSA: Calanus finmarchicus comp480782_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 7.899e+0 Identity = 11/17 (64.71%), Postives = 13/17 (76.47%), Query Frame = 0 Query: 40 PMTPKSQRKRRSLTEKS 56 PMTP+ QR RRS + KS Sbjct: 3940 PMTPQEQRPRRSFSRKS 3990
BLAST of EMLSAG00000002152 vs. L. salmonis peptides
Match: EMLSAP00000002152 (pep:novel supercontig:LSalAtl2s:LSalAtl2s139:393773:394012:-1 gene:EMLSAG00000002152 transcript:EMLSAT00000002152 description:"snap_masked-LSalAtl2s139-processed-gene-4.24") HSP 1 Score: 158.303 bits (399), Expect = 1.399e-51 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 0 Query: 1 MVLDGHDPEQNNKGIEPSVLEPVDVDDNSEFPNDENILDPMTPKSQRKRRSLTEKSTNNPLTPSNKSINPKSIYFETDL 79 MVLDGHDPEQNNKGIEPSVLEPVDVDDNSEFPNDENILDPMTPKSQRKRRSLTEKSTNNPLTPSNKSINPKSIYFETDL Sbjct: 1 MVLDGHDPEQNNKGIEPSVLEPVDVDDNSEFPNDENILDPMTPKSQRKRRSLTEKSTNNPLTPSNKSINPKSIYFETDL 79 The following BLAST results are available for this feature:
BLAST of EMLSAG00000002152 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000002152 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 3
BLAST of EMLSAG00000002152 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000002152 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000002152 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000002152 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000002152 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s139:393773..394012- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000002152-684918 ID=EMLSAG00000002152-684918|Name=EMLSAG00000002152|organism=Lepeophtheirus salmonis|type=gene|length=240bp|location=Sequence derived from alignment at LSalAtl2s139:393773..394012- (Lepeophtheirus salmonis)back to top Add to Basket
|