EMLSAG00000003410, EMLSAG00000003410-686176 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592793411|gb|GAXK01161157.1| (TSA: Calanus finmarchicus comp34687_c0_seq2 transcribed RNA sequence) HSP 1 Score: 35.4242 bits (80), Expect = 8.873e-3 Identity = 19/44 (43.18%), Postives = 23/44 (52.27%), Query Frame = 0 Query: 9 ETSRRFQVLPRLKYMKTKNPIYYPILLLLHQNSPYDGLHPHLDP 52 E S RFQ P+ K MKTK+P Y P L + +HPH P Sbjct: 228 EISTRFQAQPKQKCMKTKSPAYSPTL--------HVRVHPHCHP 335
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592793412|gb|GAXK01161156.1| (TSA: Calanus finmarchicus comp34687_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.4242 bits (80), Expect = 8.918e-3 Identity = 19/44 (43.18%), Postives = 23/44 (52.27%), Query Frame = 0 Query: 9 ETSRRFQVLPRLKYMKTKNPIYYPILLLLHQNSPYDGLHPHLDP 52 E S RFQ P+ K MKTK+P Y P L + +HPH P Sbjct: 228 EISTRFQAQPKQKCMKTKSPAYSPTL--------HVRVHPHCHP 335
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592879266|gb|GAXK01078635.1| (TSA: Calanus finmarchicus comp209040_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.958e+0 Identity = 15/33 (45.45%), Postives = 20/33 (60.61%), Query Frame = 0 Query: 13 RFQVLPRLKYMKTKNPIYYPILLLLHQNSPYDG 45 R Q+LP + ++ KNP ILL + QNSP G Sbjct: 2175 RVQLLPLEEAIQYKNPTRQNILLFVLQNSPECG 2273
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592951719|gb|GAXK01006834.1| (TSA: Calanus finmarchicus comp68135_c1_seq3 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 2.670e+0 Identity = 12/27 (44.44%), Postives = 19/27 (70.37%), Query Frame = 0 Query: 20 LKYMKTKNPIYYPI----LLLLHQNSP 42 L+YMK+K +Y+PI +LLL + +P Sbjct: 119 LEYMKSKGTLYWPISTLRILLLSKENP 199
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592951721|gb|GAXK01006832.1| (TSA: Calanus finmarchicus comp68135_c1_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 2.793e+0 Identity = 12/27 (44.44%), Postives = 19/27 (70.37%), Query Frame = 0 Query: 20 LKYMKTKNPIYYPI----LLLLHQNSP 42 L+YMK+K +Y+PI +LLL + +P Sbjct: 277 LEYMKSKGTLYWPISTLRILLLSKENP 357
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592951728|gb|GAXK01006825.1| (TSA: Calanus finmarchicus comp68135_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 2.955e+0 Identity = 12/27 (44.44%), Postives = 19/27 (70.37%), Query Frame = 0 Query: 20 LKYMKTKNPIYYPI----LLLLHQNSP 42 L+YMK+K +Y+PI +LLL + +P Sbjct: 892 LEYMKSKGTLYWPISTLRILLLSKENP 972
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592951727|gb|GAXK01006826.1| (TSA: Calanus finmarchicus comp68135_c0_seq2 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.277e+0 Identity = 12/27 (44.44%), Postives = 19/27 (70.37%), Query Frame = 0 Query: 20 LKYMKTKNPIYYPI----LLLLHQNSP 42 L+YMK+K +Y+PI +LLL + +P Sbjct: 474 LEYMKSKGTLYWPISTLRILLLSKENP 554
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592951724|gb|GAXK01006829.1| (TSA: Calanus finmarchicus comp68135_c0_seq5 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 4.389e+0 Identity = 12/27 (44.44%), Postives = 19/27 (70.37%), Query Frame = 0 Query: 20 LKYMKTKNPIYYPI----LLLLHQNSP 42 L+YMK+K +Y+PI +LLL + +P Sbjct: 69 LEYMKSKGTLYWPISTLRILLLSKENP 149
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592938645|gb|GAXK01019908.1| (TSA: Calanus finmarchicus comp13369_c2_seq4 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.652e+0 Identity = 13/28 (46.43%), Postives = 18/28 (64.29%), Query Frame = 0 Query: 28 PIYYPILLLLHQNSPYDGLHPHLDPLEV 55 P YP+LLLL +S D LH +D L++ Sbjct: 2711 PSVYPVLLLLLHDSVEDDLHQPVDGLDM 2794
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Match: gi|592938646|gb|GAXK01019907.1| (TSA: Calanus finmarchicus comp13369_c2_seq3 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.652e+0 Identity = 13/28 (46.43%), Postives = 18/28 (64.29%), Query Frame = 0 Query: 28 PIYYPILLLLHQNSPYDGLHPHLDPLEV 55 P YP+LLLL +S D LH +D L++ Sbjct: 2711 PSVYPVLLLLLHDSVEDDLHQPVDGLDM 2794
BLAST of EMLSAG00000003410 vs. L. salmonis peptides
Match: EMLSAP00000003410 (pep:novel supercontig:LSalAtl2s:LSalAtl2s187:537982:544622:1 gene:EMLSAG00000003410 transcript:EMLSAT00000003410 description:"maker-LSalAtl2s187-snap-gene-5.3") HSP 1 Score: 124.79 bits (312), Expect = 5.212e-39 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0 Query: 1 MSTNNKDTETSRRFQVLPRLKYMKTKNPIYYPILLLLHQNSPYDGLHPHLDPLEVHESQG 60 MSTNNKDTETSRRFQVLPRLKYMKTKNPIYYPILLLLHQNSPYDGLHPHLDPLEVHESQG Sbjct: 1 MSTNNKDTETSRRFQVLPRLKYMKTKNPIYYPILLLLHQNSPYDGLHPHLDPLEVHESQG 60 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003410 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000003410 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 14
Pagesback to top
BLAST of EMLSAG00000003410 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000003410 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003410 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003410 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000003410 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s187:537982..544622+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003410-686176 ID=EMLSAG00000003410-686176|Name=EMLSAG00000003410|organism=Lepeophtheirus salmonis|type=gene|length=6641bp|location=Sequence derived from alignment at LSalAtl2s187:537982..544622+ (Lepeophtheirus salmonis)back to top Add to Basket
|