EMLSAG00000003458, EMLSAG00000003458-686224 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592876679|gb|GAXK01080958.1| (TSA: Calanus finmarchicus comp3377598_c0_seq1 transcribed RNA sequence) HSP 1 Score: 52.373 bits (124), Expect = 9.368e-9 Identity = 28/68 (41.18%), Postives = 38/68 (55.88%), Query Frame = 0 Query: 5 VILISLGCSGENKDNNKNVDNWLDGLLGSKFKQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 ++L L SG + +WLD +LG KQGV+SA+FE N T DG A +DCKV+L+ K Sbjct: 118 LVLSLLWLSGIYLSTSATSPSWLDSVLGQP-KQGVFSASFEGVNNTVLEFEDGGNASIDCKVFLKQEK 318
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592870194|gb|GAXK01087368.1| (TSA: Calanus finmarchicus comp1173609_c0_seq6 transcribed RNA sequence) HSP 1 Score: 46.2098 bits (108), Expect = 7.148e-7 Identity = 18/37 (48.65%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 36 KQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 +QGV++A FE EN T + DGD +LDC+V+L+ K Sbjct: 355 RQGVFTADFEGENNTLLEVGDGDNIILDCRVFLKQEK 465
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592870198|gb|GAXK01087364.1| (TSA: Calanus finmarchicus comp1173609_c0_seq2 transcribed RNA sequence) HSP 1 Score: 46.9802 bits (110), Expect = 1.394e-6 Identity = 18/37 (48.65%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 36 KQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 +QGV++A FE EN T + DGD +LDC+V+L+ K Sbjct: 355 RQGVFTADFEGENNTLLEVGDGDNIILDCRVFLKQEK 465
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592870199|gb|GAXK01087363.1| (TSA: Calanus finmarchicus comp1173609_c0_seq1 transcribed RNA sequence) HSP 1 Score: 46.9802 bits (110), Expect = 1.495e-6 Identity = 18/37 (48.65%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 36 KQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 +QGV++A FE EN T + DGD +LDC+V+L+ K Sbjct: 355 RQGVFTADFEGENNTLLEVGDGDNIILDCRVFLKQEK 465
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592870196|gb|GAXK01087366.1| (TSA: Calanus finmarchicus comp1173609_c0_seq4 transcribed RNA sequence) HSP 1 Score: 46.2098 bits (108), Expect = 1.605e-6 Identity = 18/37 (48.65%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 36 KQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 +QGV++A FE EN T + DGD +LDC+V+L+ K Sbjct: 355 RQGVFTADFEGENNTLLEVGDGDNIILDCRVFLKQEK 465
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592953866|gb|GAXK01004687.1| (TSA: Calanus finmarchicus comp1247453_c0_seq4 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.466e+0 Identity = 10/29 (34.48%), Postives = 20/29 (68.97%), Query Frame = 0 Query: 44 FENENGTTYSIRDGDTALLDCKVYLRHNK 72 FE+ + T ++ +GDTA++ CK+ +N+ Sbjct: 430 FEDPDTETVTVTEGDTAVITCKIGYLNNQ 516
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592953867|gb|GAXK01004686.1| (TSA: Calanus finmarchicus comp1247453_c0_seq3 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.475e+0 Identity = 10/29 (34.48%), Postives = 20/29 (68.97%), Query Frame = 0 Query: 44 FENENGTTYSIRDGDTALLDCKVYLRHNK 72 FE+ + T ++ +GDTA++ CK+ +N+ Sbjct: 430 FEDPDTETVTVTEGDTAVITCKIGYLNNQ 516
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592953868|gb|GAXK01004685.1| (TSA: Calanus finmarchicus comp1247453_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.584e+0 Identity = 10/29 (34.48%), Postives = 20/29 (68.97%), Query Frame = 0 Query: 44 FENENGTTYSIRDGDTALLDCKVYLRHNK 72 FE+ + T ++ +GDTA++ CK+ +N+ Sbjct: 614 FEDPDTETVTVTEGDTAVITCKIGYLNNQ 700
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592953869|gb|GAXK01004684.1| (TSA: Calanus finmarchicus comp1247453_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.590e+0 Identity = 10/29 (34.48%), Postives = 20/29 (68.97%), Query Frame = 0 Query: 44 FENENGTTYSIRDGDTALLDCKVYLRHNK 72 FE+ + T ++ +GDTA++ CK+ +N+ Sbjct: 614 FEDPDTETVTVTEGDTAVITCKIGYLNNQ 700
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Match: gi|592767598|gb|GAXK01186970.1| (TSA: Calanus finmarchicus comp438846_c3_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.070e+0 Identity = 18/52 (34.62%), Postives = 28/52 (53.85%), Query Frame = 0 Query: 21 KNVDNWLDGLLGSKFKQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 K++DN+ G++ KF Q + FE ++RD T LL+ +YL H K Sbjct: 13010 KSMDNF-KGIMKGKFLQN--ALVFE-------ALRDETTDLLNVDIYLEHEK 13135
BLAST of EMLSAG00000003458 vs. L. salmonis peptides
Match: EMLSAP00000003458 (pep:novel supercontig:LSalAtl2s:LSalAtl2s189:443803:467582:-1 gene:EMLSAG00000003458 transcript:EMLSAT00000003458 description:"maker-LSalAtl2s189-snap-gene-4.6") HSP 1 Score: 147.517 bits (371), Expect = 1.327e-47 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0 Query: 1 SNEFVILISLGCSGENKDNNKNVDNWLDGLLGSKFKQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 SNEFVILISLGCSGENKDNNKNVDNWLDGLLGSKFKQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK Sbjct: 1 SNEFVILISLGCSGENKDNNKNVDNWLDGLLGSKFKQGVYSAAFENENGTTYSIRDGDTALLDCKVYLRHNK 72 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003458 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000003458 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 13
Pagesback to top
BLAST of EMLSAG00000003458 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000003458 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003458 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003458 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000003458 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s189:443803..467582- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003458-686224 ID=EMLSAG00000003458-686224|Name=EMLSAG00000003458|organism=Lepeophtheirus salmonis|type=gene|length=23780bp|location=Sequence derived from alignment at LSalAtl2s189:443803..467582- (Lepeophtheirus salmonis)back to top Add to Basket
|