EMLSAG00000003923, EMLSAG00000003923-686689 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003923 vs. C. finmarchicus
Match: gi|592824260|gb|GAXK01130308.1| (TSA: Calanus finmarchicus comp70901_c0_seq5 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 8.321e+0 Identity = 10/16 (62.50%), Postives = 11/16 (68.75%), Query Frame = 0 Query: 19 SHLPREWRCLAEEDEG 34 S P+ W CLA EDEG Sbjct: 240 STAPKTWLCLAGEDEG 287
BLAST of EMLSAG00000003923 vs. C. finmarchicus
Match: gi|592880482|gb|GAXK01077419.1| (TSA: Calanus finmarchicus comp427958_c2_seq2 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 8.779e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 7 ESMEHPENEENLSHLPREWRCLAEEDE 33 E+ E E++ H+PREW +EE E Sbjct: 884 ETFTEAEMEDSEEHVPREWGDASEEPE 964
BLAST of EMLSAG00000003923 vs. C. finmarchicus
Match: gi|592880483|gb|GAXK01077418.1| (TSA: Calanus finmarchicus comp427958_c2_seq1 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 8.791e+0 Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 0 Query: 7 ESMEHPENEENLSHLPREWRCLAEEDE 33 E+ E E++ H+PREW +EE E Sbjct: 901 ETFTEAEMEDSEEHVPREWGDASEEPE 981
BLAST of EMLSAG00000003923 vs. C. finmarchicus
Match: gi|592824263|gb|GAXK01130305.1| (TSA: Calanus finmarchicus comp70901_c0_seq2 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 8.911e+0 Identity = 10/16 (62.50%), Postives = 11/16 (68.75%), Query Frame = 0 Query: 19 SHLPREWRCLAEEDEG 34 S P+ W CLA EDEG Sbjct: 240 STAPKTWLCLAGEDEG 287
BLAST of EMLSAG00000003923 vs. C. finmarchicus
Match: gi|592824264|gb|GAXK01130304.1| (TSA: Calanus finmarchicus comp70901_c0_seq1 transcribed RNA sequence) HSP 1 Score: 25.409 bits (54), Expect = 8.992e+0 Identity = 10/16 (62.50%), Postives = 11/16 (68.75%), Query Frame = 0 Query: 19 SHLPREWRCLAEEDEG 34 S P+ W CLA EDEG Sbjct: 240 STAPKTWLCLAGEDEG 287
BLAST of EMLSAG00000003923 vs. L. salmonis peptides
Match: EMLSAP00000003923 (pep:novel supercontig:LSalAtl2s:LSalAtl2s211:1251944:1252879:-1 gene:EMLSAG00000003923 transcript:EMLSAT00000003923 description:"maker-LSalAtl2s211-snap-gene-12.17") HSP 1 Score: 70.4774 bits (171), Expect = 1.587e-18 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0 Query: 1 MKNSPYESMEHPENEENLSHLPREWRCLAEEDEG 34 MKNSPYESMEHPENEENLSHLPREWRCLAEEDEG Sbjct: 1 MKNSPYESMEHPENEENLSHLPREWRCLAEEDEG 34 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003923 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000003923 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 5
BLAST of EMLSAG00000003923 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000003923 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003923 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003923 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000003923 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s211:1251944..1252879- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003923-686689 ID=EMLSAG00000003923-686689|Name=EMLSAG00000003923|organism=Lepeophtheirus salmonis|type=gene|length=936bp|location=Sequence derived from alignment at LSalAtl2s211:1251944..1252879- (Lepeophtheirus salmonis)back to top Add to Basket
|