EMLSAG00000005242, EMLSAG00000005242-688008 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005242
Unique NameEMLSAG00000005242-688008
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
Nauplii I 5242-1 unknown
  1. Nauplius I
-Missing-
no visible phenotype
01.02.2016 - 14:40
10.02.2016 - 01:41
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
RNAi_AL 5242+4808+7974+9433 female
  1. PreAdult2
-Missing-
-Missing-
28.08.2017 - 11:02
05.10.2017 - 00:03
Homology
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:Octbeta2R "Octopamine beta2 receptor" species:7227 "Drosophila melanogaster" [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IEA] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0010579 "positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0004989 "octopamine receptor activity" evidence=IDA] [GO:0045887 "positive regulation of synaptic growth at neuromuscular junction" evidence=IMP] InterPro:IPR000276 InterPro:IPR004827 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PROSITE:PS00237 PROSITE:PS50262 EMBL:AE014297 GO:GO:0005887 OrthoDB:EOG78D7KR eggNOG:NOG262978 GeneTree:ENSGT00720000108411 GO:GO:0045887 GO:GO:0043565 GO:GO:0010579 GO:GO:0003700 GO:GO:0004989 EMBL:AJ880689 RefSeq:NP_001034049.1 RefSeq:NP_001247076.1 RefSeq:NP_001247077.1 RefSeq:NP_001247078.1 UniGene:Dm.29778 ProteinModelPortal:Q4LBB9 SMR:Q4LBB9 BioGrid:66644 IntAct:Q4LBB9 MINT:MINT-976968 STRING:7227.FBpp0099980 EnsemblMetazoa:FBtr0100019 EnsemblMetazoa:FBtr0304844 EnsemblMetazoa:FBtr0304845 EnsemblMetazoa:FBtr0304846 GeneID:41549 KEGG:dme:Dmel_CG33976 UCSC:CG33976-RA CTD:41549 FlyBase:FBgn0038063 InParanoid:Q4LBB9 PhylomeDB:Q4LBB9 GenomeRNAi:41549 NextBio:824342 Bgee:Q4LBB9 Uniprot:Q4LBB9)

HSP 1 Score: 259.996 bits (663), Expect = 6.200e-77
Identity = 137/292 (46.92%), Postives = 189/292 (64.73%), Query Frame = 0
Query:   37 ELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-SGTDSSGNITLHEIHSNN 327
            ELN +     S +  N S A  + +      +PD++ LD +  V K+ +++LIII AI  NLLV+ISV R  +LR I NYF+VSLA+AD++VA  AMTFN  V++TG WNF   +CDLWNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V  +M+   W +P L+SFLPIF+GWYTT +H ++  QNP +C F VN+ YA ISS+++FW P  IM+  Y  I++EA RQ+          +Q ++   + +      +Q +G   SG+ SS  +TLHE+   +
Sbjct:  111 ELNATQPFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQE----------KQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392          

HSP 2 Score: 75.0998 bits (183), Expect = 6.012e-13
Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0
Query:  483 EQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFRSR 535
            E+C  P IVVSILFWIGYFNSTLNP+IY   NRDF++AF + L   FC W++ R
Sbjct:  438 EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:Octbeta1R "Octopamine beta1 receptor" species:7227 "Drosophila melanogaster" [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS] [GO:0004935 "adrenergic receptor activity" evidence=IEA] [GO:0051482 "positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway" evidence=IDA] [GO:0005887 "integral component of plasma membrane" evidence=IC;IDA] [GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0004989 "octopamine receptor activity" evidence=IDA] [GO:0010579 "positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway" evidence=IDA] [GO:0045886 "negative regulation of synaptic growth at neuromuscular junction" evidence=IMP] InterPro:IPR000276 InterPro:IPR002233 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR01103 PROSITE:PS00237 PROSITE:PS50262 EMBL:AE014297 GO:GO:0005887 OrthoDB:EOG78D7KR eggNOG:NOG262978 GeneTree:ENSGT00720000108411 GO:GO:0010579 GO:GO:0045886 GO:GO:0071875 GO:GO:0004935 GO:GO:0004989 EMBL:AJ617526 EMBL:AJ880687 EMBL:AJ880688 RefSeq:NP_001034064.1 RefSeq:NP_001262843.1 RefSeq:NP_651057.1 UniGene:Dm.16604 ProteinModelPortal:Q9VCZ3 SMR:Q9VCZ3 PaxDb:Q9VCZ3 PRIDE:Q9VCZ3 EnsemblMetazoa:FBtr0084260 EnsemblMetazoa:FBtr0331930 GeneID:42652 KEGG:dme:Dmel_CG6919 CTD:474286 FlyBase:FBgn0038980 InParanoid:Q9VCZ3 OMA:YRIYQEA PhylomeDB:Q9VCZ3 GenomeRNAi:42652 NextBio:829888 PRO:PR:Q9VCZ3 Bgee:Q9VCZ3 Uniprot:Q9VCZ3)

HSP 1 Score: 246.899 bits (629), Expect = 2.067e-72
Identity = 121/234 (51.71%), Postives = 166/234 (70.94%), Query Frame = 0
Query:   62 ESDTGGSPDDESLDTLFLV-LKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPS---QQHLII 291
            ++  G + D +    L LV +K  I+  II+ AI  N+LV++SV R+ +LR I NYF+VSLAVAD+LVA  AMTFNA V I+G+W FG ++CD+WNS DV+FST S +HLCCISVDRY+AIV+PL Y   MT +   +M+ + W +P L+SFLPI  GWYTT E+ ++ K NP  C FKVN+ YA +SS+++FW P  +ML MY+RIY+EA RQ+  + RS V +   ++HL I
Sbjct:   89 QASEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQI 322          

HSP 2 Score: 67.781 bits (164), Expect = 1.160e-10
Identity = 29/56 (51.79%), Postives = 38/56 (67.86%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTF 529
            Y+  ++C  + C  PR++V ILFWIGYFNS LNP+IY   NRDF+ AF   L+  F
Sbjct:  370 YIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLF 423          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:Octbeta3R "Octopamine beta3 receptor" species:7227 "Drosophila melanogaster" [GO:0016021 "integral component of membrane" evidence=ISS] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS] [GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS] [GO:0005887 "integral component of plasma membrane" evidence=IDA] [GO:0004989 "octopamine receptor activity" evidence=IDA] [GO:0010579 "positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway" evidence=IDA] InterPro:IPR000276 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PROSITE:PS00237 PROSITE:PS50262 EMBL:AE014297 GO:GO:0005887 OrthoDB:EOG78D7KR GeneTree:ENSGT00740000114976 GO:GO:0010579 GO:GO:0004989 EMBL:AJ884591 EMBL:AJ884592 EMBL:AJ884593 EMBL:AJ884594 EMBL:BT029269 RefSeq:NP_001034043.2 RefSeq:NP_001034046.3 RefSeq:NP_001034048.2 RefSeq:NP_650210.2 UniGene:Dm.26051 ProteinModelPortal:Q4LBB6 EnsemblMetazoa:FBtr0290334 GeneID:3885573 KEGG:dme:Dmel_CG42244 UCSC:CG42244-RB CTD:3885573 FlyBase:FBgn0250910 eggNOG:NOG290697 InParanoid:Q9VG56 OMA:SSAKHEF PhylomeDB:Q4LBB6 ChiTaRS:Octbeta3R GenomeRNAi:3885573 NextBio:854861 Bgee:Q4LBB6 Uniprot:Q4LBB6)

HSP 1 Score: 238.039 bits (606), Expect = 9.317e-66
Identity = 115/202 (56.93%), Postives = 149/202 (73.76%), Query Frame = 0
Query:   82 KSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITG-EWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSS 282
            K  I   II+ A+  N LV+ISV R  +LR I NYF+VSLA+AD+LVA  AMTFNA VE++G +W FG  +C+++NSLDV+FST S LHLCCISVDRY+AIV+PL+Y   MT K    M+   W  P LISF PIFLGWYTT+EHL     +PD+C F VN+ YA ISS+++FW P  +ML MY RI+KEA+RQ++++ R+S
Sbjct:  142 KGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTS 343          

HSP 2 Score: 74.3294 bits (181), Expect = 1.778e-12
Identity = 30/53 (56.60%), Postives = 40/53 (75.47%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILR 526
            Y+  ++CG   CPCP ++V +LFWIGYFNSTLNP+IY   NRDF++AF + L 
Sbjct: 1188 YVITSLCG-PACPCPDVLVVVLFWIGYFNSTLNPLIYAYFNRDFREAFRNTLE 1239          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:Htr1a "5-hydroxytryptamine (serotonin) receptor 1A" species:10090 "Mus musculus" [GO:0001662 "behavioral fear response" evidence=IMP] [GO:0001965 "G-protein alpha-subunit binding" evidence=ISO] [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0004993 "serotonin receptor activity" evidence=ISO;IMP;IDA] [GO:0005886 "plasma membrane" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=ISO] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISO] [GO:0007198 "adenylate cyclase-inhibiting serotonin receptor signaling pathway" evidence=ISO] [GO:0007210 "serotonin receptor signaling pathway" evidence=ISO;IMP;IDA] [GO:0007610 "behavior" evidence=IEA] [GO:0008144 "drug binding" evidence=ISO] [GO:0008283 "cell proliferation" evidence=IEA] [GO:0014062 "regulation of serotonin secretion" evidence=IMP] [GO:0016020 "membrane" evidence=ISO] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0031117 "positive regulation of microtubule depolymerization" evidence=ISO] [GO:0035640 "exploration behavior" evidence=IMP] [GO:0042053 "regulation of dopamine metabolic process" evidence=IMP] [GO:0042310 "vasoconstriction" evidence=IEA] [GO:0042428 "serotonin metabolic process" evidence=IMP] [GO:0043025 "neuronal cell body" evidence=ISO] [GO:0043203 "axon hillock" evidence=ISO] [GO:0046883 "regulation of hormone secretion" evidence=IEA] [GO:0050795 "regulation of behavior" evidence=IEA] [GO:0051378 "serotonin binding" evidence=ISO] [GO:0060259 "regulation of feeding behavior" evidence=ISO] [GO:0097114 "N-methyl-D-aspartate receptor clustering" evidence=ISO] InterPro:IPR000276 InterPro:IPR000610 InterPro:IPR002231 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR00512 PRINTS:PR01101 PROSITE:PS00237 PROSITE:PS50262 MGI:MGI:96273 GO:GO:0005887 GO:GO:0004993 GO:GO:0007198 GO:GO:0008283 GO:GO:0050795 GO:GO:0046883 GO:GO:0042310 PANTHER:PTHR24247:SF20 KO:K04153 CTD:3350 HOVERGEN:HBG106962 GO:GO:0001662 GO:GO:0035640 GO:GO:0042053 GO:GO:0014062 GO:GO:0042428 GeneTree:ENSGT00740000115201 eggNOG:NOG249628 HOGENOM:HOG000239242 GuidetoPHARMACOLOGY:1 TreeFam:TF316350 EMBL:U39391 EMBL:AK043668 EMBL:AK049814 EMBL:AK049884 EMBL:AK140194 EMBL:CH466568 EMBL:BC138669 EMBL:BC138681 EMBL:U33820 EMBL:L20339 PIR:I49375 RefSeq:NP_032334.2 UniGene:Mm.4716 ProteinModelPortal:Q64264 SMR:Q64264 STRING:10090.ENSMUSP00000022235 BindingDB:Q64264 ChEMBL:CHEMBL3737 PhosphoSite:Q64264 PRIDE:Q64264 Ensembl:ENSMUST00000022235 GeneID:15550 KEGG:mmu:15550 UCSC:uc007rtu.2 InParanoid:Q8BGS4 OMA:REWRQGV OrthoDB:EOG7NCV3Q NextBio:288480 PRO:PR:Q64264 Bgee:Q64264 CleanEx:MM_HTR1A Genevestigator:Q64264 Uniprot:Q64264)

HSP 1 Score: 163.696 bits (413), Expect = 7.048e-43
Identity = 134/479 (27.97%), Postives = 211/479 (44.05%), Query Frame = 0
Query:   64 DTGGSPDDESLDTL---FLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEA-LRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAH-SINSDDSTTSSKVLC-NRKNR--IELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAI----CGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
             TGG  +D  L  +   + V+ S +L  +I  A+  N  VV ++     L+++ NY + SLAV DL+V+   +   AL ++  +W  G + CDL+ +LDV   T S LHLC I++DRY+AI  P+ Y +  T + AA +I + W    LIS +P  LGW T ++     + NP+EC    +  Y   S+   F+ P+ +ML +Y RI++ A  R ++++++                     E +  G   GT S+                 PP +  +     S     S E+                             A  TP  N ++     +  L VI       S  H  + S+   TS    C  RKN    E   KM    E +    LG+  +G  +L     + +  VA+    C +  C  P ++ +I+ W+GY NS LNPVIY   N+DF++AF  I++  FC
Sbjct:   20 GTGG--NDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLIS-IPPMLGWRTPED-----RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKV--------------------EKKGAGTSFGTSSA-----------------PPPKKSLNGQPGSGDCRRSAENR----------------------------AVGTPCANGAVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGI-IMGTFIL---CWLPFFIVALVLPFC-ESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC 420          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:HTR4 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004993 "serotonin receptor activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0007268 "synaptic transmission" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IEA] [GO:0032098 "regulation of appetite" evidence=IEA] InterPro:IPR000276 InterPro:IPR001520 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR01059 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0005887 GO:GO:0004993 GO:GO:0007268 GO:GO:0007210 GO:GO:0032098 CTD:3360 KO:K04160 OrthoDB:EOG7CG707 PANTHER:PTHR24249:SF33 GeneTree:ENSGT00720000108411 TreeFam:TF325181 EMBL:AADN03006650 EMBL:AADN03006674 RefSeq:XP_004944885.1 UniGene:Gga.22866 Ensembl:ENSGALT00000002105 GeneID:416150 KEGG:gga:416150 Uniprot:F1NJL4)

HSP 1 Score: 161.384 bits (407), Expect = 1.225e-42
Identity = 91/208 (43.75%), Postives = 127/208 (61.06%), Query Frame = 0
Query:   89 IIILAIFNNLLVVISVFRYHRLRHIN-NYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAI-VKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTK--EHLEWRK----QNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIY---KEALRQKESIRRSSVPS 285
            +I++AI  NLLV+++V R  +LR I  NYF+VSLA ADLLV+   M F A+  +   W +G + C +  SLDV  +T S LHLCCIS+DRY+AI  +PL Y + MT    AVM+G  W  PT ISFLPI  GW +    + ++ R+     N   CIF VN+PYA   S + F+ P  +M+  Y+RIY   +E  RQ   ++R+  P+
Sbjct:   29 VILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDNWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYRNKMTPLRIAVMLGGCWVIPTFISFLPIMQGWNSIGIIDLIQQRQFNKASNSTYCIFMVNKPYAITCSVVAFYFPFLLMVLAYYRIYVTAREHARQIRVLQRAGTPA 236          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:octr-1 "Protein OCTR-1, isoform a" species:6239 "Caenorhabditis elegans" [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 HOGENOM:HOG000239242 GO:GO:0004930 GeneTree:ENSGT00740000114939 EMBL:FO080820 UniGene:Cel.9150 GeneID:184469 KEGG:cel:CELE_F14D12.6 UCSC:F14D12.6a CTD:184469 NextBio:924846 RefSeq:NP_001024568.1 ProteinModelPortal:Q7JP62 SMR:Q7JP62 EnsemblMetazoa:F14D12.6a WormBase:F14D12.6a ArrayExpress:Q7JP62 Uniprot:Q7JP62)

HSP 1 Score: 160.614 bits (405), Expect = 5.610e-42
Identity = 128/451 (28.38%), Postives = 191/451 (42.35%), Query Frame = 0
Query:   80 VLKSGILILIIILAIFNNLLVVISVFRYHRLR-HINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLC-NRKNRIELSEKMTSIFEGEIASPLGV-WTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRK 527
            VL    ++ +++L IF NLLVV++V+R  +LR    N+ +VSLAVAD+LV    M      EI GEW  G I+C++W +LDV F T S LH+C IS+DRYF++  PL Y +  T     + IGV+W    LI   PIF GW   +           EC    +  Y   SS  +F+ PV I++ +Y +IY   +R           S+Q L         R + L     +S T+   N+  +E+  N                      S   EDE   +  +     +  +     S  L R            +PPAS+          R++               K  C  RK +++  E+  ++  G I S   + W            + +  + + G      P +V    FW+GY NS +NPVIY + NR+FK      L K
Sbjct:   22 VLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIF-GWRPERAE--------GECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRH----------SRQRL----KETERRDHTLNMLTIRSSTNERYNME-YELEEN----------------------SDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASD--------LTRKL-------------EEKKFCEKRKRKLKAKERQATLLLGIILSAFILSW------------LPFFLIYVIGAFGHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHK 393          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:Htr4 "5 hydroxytryptamine (serotonin) receptor 4" species:10090 "Mus musculus" [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0004993 "serotonin receptor activity" evidence=ISO] [GO:0005515 "protein binding" evidence=IPI] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005768 "endosome" evidence=IEA] [GO:0005886 "plasma membrane" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0007189 "adenylate cyclase-activating G-protein coupled receptor signaling pathway" evidence=ISO] [GO:0007210 "serotonin receptor signaling pathway" evidence=ISO] [GO:0007214 "gamma-aminobutyric acid signaling pathway" evidence=ISO] [GO:0007268 "synaptic transmission" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=ISO] [GO:0016020 "membrane" evidence=ISO] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0032098 "regulation of appetite" evidence=IEA] InterPro:IPR000276 InterPro:IPR001520 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR01059 PROSITE:PS00237 PROSITE:PS50262 MGI:MGI:109246 GO:GO:0005887 EMBL:CH466528 GO:GO:0004993 HOVERGEN:HBG106962 HOGENOM:HOG000239242 TreeFam:TF316350 GO:GO:0008284 GO:GO:0007268 GO:GO:0032098 GuidetoPHARMACOLOGY:9 CTD:3360 eggNOG:NOG262978 KO:K04160 OMA:YRIYITA OrthoDB:EOG7CG707 GO:GO:0005768 PANTHER:PTHR24249:SF33 EMBL:Y09585 EMBL:Y09587 EMBL:Y09588 EMBL:AJ011369 EMBL:AK141587 EMBL:AK141625 RefSeq:NP_032339.2 RefSeq:XP_006525738.1 RefSeq:XP_006525739.1 RefSeq:XP_006525740.1 RefSeq:XP_006525741.1 RefSeq:XP_006525742.1 RefSeq:XP_006525743.1 RefSeq:XP_006525746.1 UniGene:Mm.20440 ProteinModelPortal:P97288 SMR:P97288 IntAct:P97288 BindingDB:P97288 ChEMBL:CHEMBL2183 PhosphoSite:P97288 PRIDE:P97288 DNASU:15562 Ensembl:ENSMUST00000027560 GeneID:15562 KEGG:mmu:15562 UCSC:uc008fda.1 UCSC:uc008fdb.1 UCSC:uc008fdc.1 GeneTree:ENSGT00720000108411 InParanoid:Q3URB5 NextBio:288518 PRO:PR:P97288 Bgee:P97288 CleanEx:MM_HTR4 Genevestigator:P97288 Uniprot:P97288)

HSP 1 Score: 159.073 bits (401), Expect = 1.767e-41
Identity = 95/232 (40.95%), Postives = 134/232 (57.76%), Query Frame = 0
Query:   86 LILIIILAIFNNLLVVISVFRYHRLRHIN-NYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAI-VKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTK--EHLEWRK----QNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIY---KEALRQKESIRRSSV-------PSQQHLIIDSDRVRTR 299
            L ++I++AI  NLLV+++V R  +LR I  NYF+VSLA ADLLV+   M F A+  +   W +G + C +  SLDV  +T S  HLCCIS+DRY+AI  +PL Y + MT    A+M+G  W  P  ISFLPI  GW      + +E RK     N   C+F VN+PYA   S + F+ P  +M+  Y+RIY   KE  +Q + ++R+         P+ QH    + R+RT 
Sbjct:   26 LAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQH---STHRMRTE 254          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:HTR4 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0004993 "serotonin receptor activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0007268 "synaptic transmission" evidence=IEA] [GO:0008284 "positive regulation of cell proliferation" evidence=IEA] [GO:0032098 "regulation of appetite" evidence=IEA] InterPro:IPR000276 InterPro:IPR001520 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR01059 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0005737 GO:GO:0005887 GO:GO:0004993 TreeFam:TF316350 GO:GO:0008284 GO:GO:0007268 GO:GO:0032098 OMA:YRIYITA OrthoDB:EOG7CG707 PANTHER:PTHR24249:SF33 GeneTree:ENSGT00720000108411 EMBL:AAEX03003108 ProteinModelPortal:E2RK32 Ensembl:ENSCAFT00000029146 Uniprot:E2RK32)

HSP 1 Score: 157.918 bits (398), Expect = 2.014e-41
Identity = 95/229 (41.48%), Postives = 132/229 (57.64%), Query Frame = 0
Query:   89 IIILAIFNNLLVVISVFRYHRLRHIN-NYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAI-VKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTK--EHLEWRKQNPDE----CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIY---KEALRQKESIRRSSVPSQ-------QHLIIDSDRVRTR 299
            +I++AI  NLLV+++V R  +LR I  NYF+VSLA  DLLV+   M F A+  +   W +G + C +  SLDV  +T S  HLCCIS+DRY+AI  +PL Y + MT    A+M+G  W  P  ISFLPI  GW      + +E RK N +     CIF VN+PYA   S + F+ P  +M+  Y+RIY   KE   Q + ++R+  PS+       QH    + R+RT 
Sbjct:   30 VILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFVDLLVSVLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWIIPMFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGAPSEGRPQPADQH---STHRMRTE 255          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:octr-1 "Protein OCTR-1, isoform b" species:6239 "Caenorhabditis elegans" [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PROSITE:PS00237 PROSITE:PS50262 GO:GO:0016021 eggNOG:NOG249628 HOGENOM:HOG000239242 OrthoDB:EOG7NCV3Q GO:GO:0004930 GeneTree:ENSGT00740000114939 EMBL:FO080820 RefSeq:NP_001024569.1 UniGene:Cel.9150 ProteinModelPortal:Q7JP61 SMR:Q7JP61 STRING:6239.F14D12.6b EnsemblMetazoa:F14D12.6b GeneID:184469 KEGG:cel:CELE_F14D12.6 UCSC:F14D12.6a CTD:184469 WormBase:F14D12.6b InParanoid:Q7JP61 OMA:NMEYELE NextBio:924846 ArrayExpress:Q7JP61 Uniprot:Q7JP61)

HSP 1 Score: 159.073 bits (401), Expect = 2.111e-41
Identity = 130/458 (28.38%), Postives = 191/458 (41.70%), Query Frame = 0
Query:   80 VLKSGILILIIILAIFNNLLVVISVFRYHRLR-HINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTS-------SKVLC-NRKNRIELSEKMTSIFEGEIASPLGV-WTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRK 527
            VL    ++ +++L IF NLLVV++V+R  +LR    N+ +VSLAVAD+LV    M      EI GEW  G I+C++W +LDV F T S LH+C IS+DRYF++  PL Y +  T     + IGV+W    LI   PIF GW   +           EC    +  Y   SS  +F+ PV I++ +Y +IY   +R                       R R  E +        D + N+      +N  YN                 +    E+ S P+      + E + V  N  M    C      R  S   P           +  +VS+A   N +    S        K  C  RK +++  E+  ++  G I S   + W            + +  + + G      P +V    FW+GY NS +NPVIY + NR+FK      L K
Sbjct:   22 VLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIF-GWRPERAE--------GECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHS---------------------RQRLKETERR------DHTLNMLTIRSSTNERYN-----------------MEYELEENSDPI------EDEKEKVVTNRDMINKVCWQ---LRKISEELPR----------QGVKVSIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSW------------LPFFLIYVIGAFGHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHK 395          
BLAST of EMLSAG00000005242 vs. GO
Match: - (symbol:si:dkey-247m21.3 "si:dkey-247m21.3" species:7955 "Danio rerio" [GO:0032098 "regulation of appetite" evidence=IEA] [GO:0005887 "integral component of plasma membrane" evidence=IEA] [GO:0007268 "synaptic transmission" evidence=IEA] [GO:0004930 "G-protein coupled receptor activity" evidence=IEA] [GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0004993 "serotonin receptor activity" evidence=IEA] [GO:0007165 "signal transduction" evidence=IEA] [GO:0004871 "signal transducer activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] InterPro:IPR000276 InterPro:IPR001520 InterPro:IPR017452 Pfam:PF00001 PRINTS:PR00237 PRINTS:PR01059 PROSITE:PS00237 PROSITE:PS50262 ZFIN:ZDB-GENE-091204-249 GO:GO:0005887 GO:GO:0004993 TreeFam:TF316350 GO:GO:0007268 GO:GO:0007210 GO:GO:0032098 PANTHER:PTHR24249:SF33 GeneTree:ENSGT00720000108411 EMBL:BX248308 ProteinModelPortal:F1QPB4 Ensembl:ENSDART00000025860 OMA:RIYVTAM Uniprot:F1QPB4)

HSP 1 Score: 157.918 bits (398), Expect = 2.349e-41
Identity = 91/216 (42.13%), Postives = 129/216 (59.72%), Query Frame = 0
Query:   85 ILILIIILAIFNNLLVVISVFRYHRLRHIN-NYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAI-VKPLKYTSYMT-VKVAAVMIGVAWTAPTLISFLPIFLGWYT--TKEHLEWRKQNPDE---CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESI----RRSSVPSQQH 288
            +L+ III+    NLLV++++ +  +LR    N+F+VSLA ADLLVA   M   A+   TG+WN+G   C +  SLDV  +T S LHLCCI++DRY+AI  +PL Y + MT V+V+ +++G  W  P  ISFLPI   W T   +  +E RK N      C+F VNQPYA + SA+ F+ P+ +M+  Y RIY  A+     I    R  S P+  +
Sbjct:   26 VLVTIIIMTALGNLLVMVALCKDRQLRKKKTNFFIVSLAFADLLVALVVMPLAAIELTTGKWNYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYNNKMTPVRVSLMLVG-CWVIPFFISFLPIMQSWNTIGIESFIEQRKLNSSRNSTCVFMVNQPYALVCSAVAFYVPLVLMVLAYQRIYVTAMGHARRIGSLHRAGSAPTSTY 240          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592900196|gb|GAXK01058179.1| (TSA: Calanus finmarchicus comp287066_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 281.952 bits (720), Expect = 4.508e-85
Identity = 184/434 (42.40%), Postives = 236/434 (54.38%), Query Frame = 0
Query:  103 SVFRYHRLRHINNYFXXXXXXXXXXXXCFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDE-CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRR----SSVPSQQHLIIDS-DRVRTRFNELQANGFKSGTDSSGNITLHEIHSXXXXXXXXXXXLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            SV  Y +LR INNYFLVSLA ADL+VACFAMTFNA  EI G W FG  +CDLWNS+DVH STVSTLHLC IS DR++AIVKP  Y  +M    A  MI  AW  P  ISF+PIFLGWYTTKEHL+ R++  D+ C F  N PYAFISS LTFW PV +M+ +Y+R+Y+EA++QK ++ +     ++P  ++ + DS     +R +    N  K G       T H+ +S +            PA     +I P   D     N     K +        S+  +   +   +RN S+   +  N+L V +    R  +  S   +            K  + L   M +     +  P  +W              YLT  ICG E C CP  VVS+LFWIGYFNSTLNPVIY MTNRDFK AF  IL++ FC
Sbjct:  376 SVVLYRKLRGINNYFLVSLAFADLIVACFAMTFNATQEILGRWIFGPAVCDLWNSIDVHASTVSTLHLCAISFDRFYAIVKPFDYDHFMNTYSAMGMIAAAWLCPVFISFVPIFLGWYTTKEHLKEREETEDKICKFVTNVPYAFISSTLTFWFPVILMVLVYYRVYREAMKQKTAMEKMTNIRALPVAKNSVNDSFGGEVSRTDTFDVNNGKVGE------TRHKNNSVS------------PAEKDG-QIKPDKSDSIGATNGGEDIKNKAA---KRISLETAMIDARAKARN-SVFASSGTNILEVFSVLKERKRLNSSWRRE-----------HKAFVTLGVVMGTFLLCWL--PFFIW--------------YLTTTICG-EACYCPDEVVSLLFWIGYFNSTLNPVIYAMTNRDFKLAFIGILKRIFC 1524          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592900195|gb|GAXK01058180.1| (TSA: Calanus finmarchicus comp287066_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 270.011 bits (689), Expect = 9.941e-81
Identity = 177/431 (41.07%), Postives = 225/431 (52.20%), Query Frame = 0
Query:  103 SVFRYHRLRHINNYFXXXXXXXXXXXXCFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDE-CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNEL--QANGFKSGTDSSGNITLHEIHSXXXXXXXXXXXLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            SV  Y +LR INNYFLVSLA ADL+VACFAMTFNA  EI G W FG  +CDLWNS+DVH STVSTLHLC IS DR++AIVKP  Y  +M    A  MI  AW  P  ISF+PIFLGWYTTKEHL+ R++  D+ C F  N PYAFISS LTFW PV +M+ +Y+R+Y+EA+  K+      + + + L +  + V   F     + + F    +  G I                     P  + S  I  +   E +    +     ET  ++               +RN S+   +  N+L V +    R  +  S   +            K  + L   M +     +  P  +W              YLT  ICG E C CP  VVS+LFWIGYFNSTLNPVIY MTNRDFK AF  IL++ FC
Sbjct:  376 SVVLYRKLRGINNYFLVSLAFADLIVACFAMTFNATQEILGRWIFGPAVCDLWNSIDVHASTVSTLHLCAISFDRFYAIVKPFDYDHFMNTYSAMGMIAAAWLCPVFISFVPIFLGWYTTKEHLKEREETEDKICKFVTNVPYAFISSTLTFWFPVILMVLVYYRVYREAM--KQKTAMEKMTNIRALPVAKNSVNDSFGGEVSRTDTFDVNNEKDGQIK--------------------PDKSDS--IGATNGGEDIKNKAAKRISLETAMIDAR-----------AKARN-SVFASSGTNILEVFSVLKERKRLNSSWRRE-----------HKAFVTLGVVMGTFLLCWL--PFFIW--------------YLTTTICG-EACYCPDEVVSLLFWIGYFNSTLNPVIYAMTNRDFKLAFIGILKRIFC 1476          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592834516|gb|GAXK01123028.1| (TSA: Calanus finmarchicus comp2170137_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 259.996 bits (663), Expect = 5.171e-78
Identity = 130/189 (68.78%), Postives = 150/189 (79.37%), Query Frame = 0
Query:  103 SVFRYHRLRHINNYFXXXXXXXXXXXXCFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLII 291
            SV  Y RLRH+NNYFLVSLA ADL VA FAMTFNA VEITG+WNFG  +CD WNS+DVH STVSTLHLCCISVDRY+AI KPL+Y   +TVK A +MI +AW  PT ISFLPIF+GWYTT E+L+ + Q+PDEC F VN+P+AFISS+LTFW PV +ML +YHRIY EA R   +IRR SVP   HL I
Sbjct:  284 SVILYRRLRHVNNYFLVSLAFADLFVALFAMTFNATVEITGQWNFGAFMCDFWNSMDVHVSTVSTLHLCCISVDRYYAIAKPLQYHMTITVKRAMMMISMAWIIPTCISFLPIFMGWYTTTEYLQHKDQHPDECRFIVNKPFAFISSSLTFWLPVMVMLTLYHRIYLEARRHMRAIRRHSVPIVCHLGI 850          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592956604|gb|GAXK01001952.1| (TSA: Calanus finmarchicus comp1920325_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 100.523 bits (249), Expect = 4.491e-23
Identity = 49/94 (52.13%), Postives = 64/94 (68.09%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFCWFRSR-VEHSQKEWSVLMFDGICSLDLLTLSFHKIYF 566
            YLT  ICGD  CPCP ++V+ILFWIGYFNSTLNP+IYVMTN +FK+AF+ I+RK FC   ++     +  W + +F  I  L+ L   F  I+F
Sbjct:  309 YLTTTICGD-SCPCPHVIVAILFWIGYFNSTLNPIIYVMTNHEFKEAFTSIIRKVFCCANNKDTTDYEYRWGIYLFKSIQCLNEL---FWTIFF 578          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592924274|gb|GAXK01034141.1| (TSA: Calanus finmarchicus comp1641236_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 104.375 bits (259), Expect = 9.329e-23
Identity = 71/192 (36.98%), Postives = 108/192 (56.25%), Query Frame = 0
Query:  103 SVFRYHRLRHINNY-FXXXXXXXXXXXXCFAMTFNAL-VEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWY---TTKEHLEWRKQNPDE-------CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSS 282
            SVFR   LR    Y F+VSLA+ADL V+  AM FNA+ V + G W F   +CD++N++DV FST S L+LC IS+DRY  I  PL+YT ++T +   ++  + WT   LISFLPI +  +     +   E R++   E       C    +  Y+  SS ++F  P  +ML +Y +++       ++I+ S+
Sbjct:  429 SVFRTKNLRRQKAYYFVVSLAMADLSVSVGAMVFNAIQVILNGHWLFSMWLCDIYNAMDVVFSTASILNLCLISLDRYIRIKDPLQYTQWITRRSVPILACLVWTTSALISFLPIMMDLHIPQAKEAGTEGRREEAGEISGENTSCWLDFSPVYSITSSCISFLLPCVVMLSIYFKLWSIGRVHVKNIKAST 1004          

HSP 2 Score: 41.9726 bits (97), Expect = 5.425e-3
Identity = 20/48 (41.67%), Postives = 28/48 (58.33%), Query Frame = 0
Query:  478 AICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
             +C D  C  P +   +L W+GY NS  NPVIY + N +F++ F  IL
Sbjct: 1287 GLCKD--CVAPGLF-KVLTWLGYSNSAFNPVIYSIFNSEFREGFRRIL 1421          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592924275|gb|GAXK01034140.1| (TSA: Calanus finmarchicus comp1641236_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 103.99 bits (258), Expect = 1.253e-22
Identity = 71/192 (36.98%), Postives = 108/192 (56.25%), Query Frame = 0
Query:  103 SVFRYHRLRHINNY-FXXXXXXXXXXXXCFAMTFNAL-VEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWY---TTKEHLEWRKQNPDE-------CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSS 282
            SVFR   LR    Y F+VSLA+ADL V+  AM FNA+ V + G W F   +CD++N++DV FST S L+LC IS+DRY  I  PL+YT ++T +   ++  + WT   LISFLPI +  +     +   E R++   E       C    +  Y+  SS ++F  P  +ML +Y +++       ++I+ S+
Sbjct:  429 SVFRTKNLRRQKAYYFVVSLAMADLSVSVGAMVFNAIQVILNGHWLFSMWLCDIYNAMDVVFSTASILNLCLISLDRYIRIKDPLQYTQWITRRSVPILACLVWTTSALISFLPIMMDLHIPQAKEAGTEGRREEAGEISGENTSCWLDFSPVYSITSSCISFLLPCVVMLSIYFKLWSIGRVHVKNIKAST 1004          

HSP 2 Score: 39.6614 bits (91), Expect = 2.872e-2
Identity = 18/44 (40.91%), Postives = 26/44 (59.09%), Query Frame = 0
Query:  478 AICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAF 521
             +C D  C  P +   +L W+GY NS  NPVIY + N +F++ F
Sbjct: 1287 GLCKD--CVAPGLF-KVLTWLGYSNSAFNPVIYSIFNSEFREGF 1409          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592754415|gb|GAXK01199998.1| (TSA: Calanus finmarchicus comp3798148_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 99.7525 bits (247), Expect = 1.308e-22
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 0
Query:  131 FAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVK-PLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAP 256
              M   A+ E+ G W  G  +C L+N+ DV   TVS LHLC +S+DRY+AIVK PL Y +  T    A+MI +AW     I F+ +F G YTT+  +    +NP  C F+ N  Y+ I+   +FW P
Sbjct:  289 LVMIPRAIYELLGWWPLGSFLCQLYNAFDVTCCTVSILHLCAVSIDRYYAIVKEPLLYQTNATRWRTAIMIALAWAMGLFIGFVSVFSGIYTTEVAINTFVENPIVCEFEPNHIYSIIAGCASFWLP 669          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592833629|gb|GAXK01123915.1| (TSA: Calanus finmarchicus comp666680_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 103.605 bits (257), Expect = 2.738e-22
Identity = 119/428 (27.80%), Postives = 188/428 (43.93%), Query Frame = 0
Query:  108 HRLRHINNYFXXXXXXXXXXXXCFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPD-ECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEA---LRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSXXXXXXXXXXXLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFV-EGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDD-----STTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
              L+ + NY ++SLAVADLLVA   M   A+ EI+ +W  G  +CD+W S DV   T S LHL  I++DRY+A+  P  Y    +     V+I + W    ++S  P+F GW   K    W ++  D +CI   +  Y   +++ TF+ P+ ++L +Y RI+  A   LR + + +++ +P  Q  +I +  +   F        K   + +GN+                        T+S+ +S    ++ L  + SS   +E K + E N         SP+       + P  N+     N   R  SM     +DD     +    +     K  I L  K     E + A  L + T    +      +  L   +C  E C     V S   W+GYFNSTLNP+IY + + +F+ AF  IL
Sbjct:  530 RHLQSVANYLILSLAVADLLVAILVMPLGAVYEISKKWILGPNLCDMWTSSDVLCCTASILHLLAIALDRYWAVTHP-HYIHSRSSTTIWVLISLVWIMSIVVSLAPLF-GWKDDK----WSERVEDGDCIVSQDISYQIFATSATFFVPLILILLLYWRIFLTARTRLRNRLA-QKTRLP--QASVIQTATLAASFKN---KDVKVTKNDNGNV-----------------------KTTSFSVS----EKILKSDTSSLCHQENKLITEINRQPQDEADESPSSQSGEFQSTPRINSCPRHKNGAIRHSSMG--CQTDDLAPLATPKERRKPKKEKKHISLEAKR----EKKAAKTLAIVTGAFIICWLPFFVIALVNPLC--ENC-INNYVFSFFLWLGYFNSTLNPIIYTVFSPEFRQAFKKIL 1669          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592799822|gb|GAXK01154746.1| (TSA: Calanus finmarchicus comp1768349_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 101.679 bits (252), Expect = 1.117e-21
Identity = 70/177 (39.55%), Postives = 96/177 (54.24%), Query Frame = 0
Query:  103 SVFRYHRLRHINNYFXXXXXXXXXXXXCFAMTFNALVE-ITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESI 278
            +VF+   L    NY + SLAVAD LV    M F+A  E +   W FG + C+LW+SLDV  ST S LHLC IS+DRY+AI  P  Y   M  K A  +I + W   + ISF P  L W  T E        P +C F  +  Y   SS ++F+ P+A+M+  Y +I++ A    +S+
Sbjct: 1031 AVFQERNLHSATNYLIASLAVADSLVGLVVMPFSATYEGMDQAWVFGPVWCELWHSLDVLASTASILHLCVISLDRYWAITDPFNYPVKMNDKRAGYLIVLVWVCSSSISF-PAILWWRVTAEG----PAPPWKCPFTDDIGYLVFSSTVSFYGPLAVMVFTYIKIFQAATAYSKSL 1546          

HSP 2 Score: 44.2838 bits (103), Expect = 1.043e-3
Identity = 18/43 (41.86%), Postives = 29/43 (67.44%), Query Frame = 0
Query:  488 PRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            P +  ++L W+G+ NS++NPVIY   + +F+ AF+ IL   FC
Sbjct:  590 PEVTFAVLTWLGWVNSSMNPVIYACCSVEFRRAFAKIL--CFC 712          
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Match: gi|592956605|gb|GAXK01001951.1| (TSA: Calanus finmarchicus comp1920325_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 97.8265 bits (242), Expect = 1.340e-21
Identity = 41/57 (71.93%), Postives = 49/57 (85.96%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            YLT  ICGD  CPCP ++V+ILFWIGYFNSTLNP+IYVMTN +FK+AF+ I+RK FC
Sbjct:  309 YLTTTICGDS-CPCPHVIVAILFWIGYFNSTLNPIIYVMTNHEFKEAFTSIIRKVFC 476          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000005242 (pep:novel supercontig:LSalAtl2s:LSalAtl2s279:103641:347799:1 gene:EMLSAG00000005242 transcript:EMLSAT00000005242 description:"snap_masked-LSalAtl2s279-processed-gene-3.3")

HSP 1 Score: 1186.79 bits (3069), Expect = 0.000e+0
Identity = 578/578 (100.00%), Postives = 578/578 (100.00%), Query Frame = 0
Query:    1 MYGLIVILTFIASIKLTISDSVTPSINIISSIKPLTELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFCWFRSRVEHSQKEWSVLMFDGICSLDLLTLSFHKIYFLKASNLFLNYDI 578
            MYGLIVILTFIASIKLTISDSVTPSINIISSIKPLTELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFCWFRSRVEHSQKEWSVLMFDGICSLDLLTLSFHKIYFLKASNLFLNYDI
Sbjct:    1 MYGLIVILTFIASIKLTISDSVTPSINIISSIKPLTELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFCWFRSRVEHSQKEWSVLMFDGICSLDLLTLSFHKIYFLKASNLFLNYDI 578          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000003021 (pep:novel supercontig:LSalAtl2s:LSalAtl2s171:196627:197691:1 gene:EMLSAG00000003021 transcript:EMLSAT00000003021 description:"augustus_masked-LSalAtl2s171-processed-gene-2.0")

HSP 1 Score: 134.806 bits (338), Expect = 4.907e-35
Identity = 77/199 (38.69%), Postives = 111/199 (55.78%), Query Frame = 0
Query:   84 GILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGE-WNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHL--EWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIR 279
             ILI   +  +  N L+++SV +   L    NYF+ SLA+AD LV    M F+A  E   + W FG   CD+W+S+DV  ST S L+LC IS+DRY+AI  P+ Y   MT K AA++I + W   ++ISF P    W    E++  EW+      C F  +  Y   SS ++F+ P+ IM+  Y +IYK AL    S++
Sbjct:   34 AILISFGVATVLGNSLIIVSVLKKRSLHTATNYFITSLAIADFLVGLVVMPFSATYEAMDQRWIFGPDWCDIWHSMDVLASTASILNLCVISLDRYWAITDPMTYPYKMTGKRAAILIVLVWVCSSVISF-PAIAWWRLVAENVPPEWK------CPFTEDMGYLIFSSTVSFYGPLTIMVFAYAKIYKAALEHTRSLK 225          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000011472 (pep:novel supercontig:LSalAtl2s:LSalAtl2s791:25681:66356:-1 gene:EMLSAG00000011472 transcript:EMLSAT00000011472 description:"maker-LSalAtl2s791-augustus-gene-0.7")

HSP 1 Score: 130.183 bits (326), Expect = 3.923e-32
Identity = 73/217 (33.64%), Postives = 122/217 (56.22%), Query Frame = 0
Query:   70 DDESLDTLFLVLKSGILILIIILAIF-NNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEW--RKQNPD---ECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRR 280
            D+ +  TL  ++ +G  + I     F  N +V+ ++    RL+ ++N F++SLA ADL V    M  ++   +TG+W FGY++C  W  +D   ST S  +LC +S+DRY++I  PL+Y    T K A +MIG+AW A  +  F+P+ LGW+    H+ +  ++Q P+   +  F  N  +  ++S L F+ PV +M+ +  RI+    R+ E I R
Sbjct:   30 DEAAFATLSTLIPTGFGLYIFSFTTFVGNAMVLHAIRTEKRLQTVSNMFIMSLASADLTVGLIVMPISSAYALTGDWKFGYVVCQFWLVIDYTASTASIFNLCILSLDRYWSISTPLQYLRKRTKKRALIMIGLAWLASAMW-FIPV-LGWH----HILYNGKRQQPEGVCDTEFATNITFKVVTSILNFYIPVIMMIVINVRIFLAIRRRSEDIER 240          

HSP 2 Score: 58.5362 bits (140), Expect = 2.896e-9
Identity = 36/99 (36.36%), Postives = 51/99 (51.52%), Query Frame = 0
Query:  432 CNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLT----VAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILR 526
            C+  N    + K     E + A+ LGV  +G  +L     + Y T    VA CG+        V ++  W GYFNSTLNP++Y + NR+FK AF  +LR
Sbjct:  521 CSTSNLTPANPKTVLAKEKKAATQLGV-IVGAFIL---CWLPYFTLFMVVAYCGEANQCVSSTVHTVTIWFGYFNSTLNPILYPLCNRNFKRAFKRMLR 615          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000007974 (pep:novel supercontig:LSalAtl2s:LSalAtl2s471:105708:107132:1 gene:EMLSAG00000007974 transcript:EMLSAT00000007974 description:"augustus_masked-LSalAtl2s471-processed-gene-1.0")

HSP 1 Score: 124.79 bits (312), Expect = 5.827e-31
Identity = 95/267 (35.58%), Postives = 151/267 (56.55%), Query Frame = 0
Query:   38 LNDSIREPNSVIR----NNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRH-INNYFLVSLAVADLLVACFAMTFNAL-VEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVK-PLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQN--PDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALR--QKESIRRSSVPSQQHLIIDS 293
            L  S+   + ++R    NN +    + +ES       D +L  +FL+        II++++  NLLV +SV R ++LR  I NYF++SLAVAD LVA  AM FN + +  +G W FG  ICDL+N++DV F T S L+L  IS+ RY+ I+K PL Y    +     ++I   W    +I+F+PIF   YTT+++LE +       +C F VN  Y  ISS+++FW P A +   Y+ IY  A +  ++++ R+ S  + Q ++ ++
Sbjct:    7 LTQSVVADDGILRGGSINNETALKVSCFESAPSIHGTDIALGIVFLI--------IILMSLLGNLLVFVSVIRTYKLRQQIANYFVISLAVADFLVAVVAMFFNGITIVFSGHWLFGPFICDLYNAMDVVFCTASILNLLFISLYRYYQIIKEPLSYGETFSKGRVLLIIAFIWAISFVIAFVPIFTRIYTTQKYLEEQALGLLDCQCNFIVNVSYCIISSSISFWIPSAGIWYFYYHIYXLAAKTAKEDAQRKQSNCTTQSMLTNN 265          

HSP 2 Score: 51.6026 bits (122), Expect = 4.121e-7
Identity = 22/39 (56.41%), Postives = 27/39 (69.23%), Query Frame = 0
Query:  492 VSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            VS +FW+GYFNS LNP IY    +DF+ AF+D L   FC
Sbjct:  391 VSFVFWLGYFNSLLNPFIYAWKFKDFQYAFADTLGCIFC 429          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000009433 (pep:novel supercontig:LSalAtl2s:LSalAtl2s601:31744:33432:-1 gene:EMLSAG00000009433 transcript:EMLSAT00000009433 description:"augustus_masked-LSalAtl2s601-processed-gene-1.0")

HSP 1 Score: 114.39 bits (285), Expect = 5.034e-27
Identity = 62/191 (32.46%), Postives = 108/191 (56.54%), Query Frame = 0
Query:   95 FNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFK---VNQP-YAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRS 281
            F N++V+ +V    +LR   N F+VSLA ADL++    +  +A+ E+   W FG   C +W ++DV   T S LHL  IS+DRY A+  P+ Y + M+ K A ++I  AW    +I F P+ +GW   ++  +  K   + C+ +   + +P Y   S+  +F+AP+ +M+   ++IY+ A +  ++IR+ 
Sbjct:   43 FGNMMVIAAVHMTQKLRGATNLFIVSLAWADLMLGIIVLPTSAMYEVFHIWIFGVHWCAIWLAVDVWMCTASILHLVVISLDRYIAVTHPVTYPNIMSSKRAKLLILGAWVLSFVICFPPL-VGWNEDEDLFDENKSEDNSCMPECKLIQEPGYVIYSAVGSFYAPMLVMIFFNYKIYRTATKTTKAIRKG 232          

HSP 2 Score: 58.5362 bits (140), Expect = 2.660e-9
Identity = 28/57 (49.12%), Postives = 35/57 (61.40%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            YL  + C D  C  P IV S+ FW+GY NS  NPVIY M +R+F+ AF  I+ K  C
Sbjct:  449 YLITSFCAD--C-VPGIVFSVFFWLGYCNSAFNPVIYAMFSREFRGAFKKIICKLIC 502          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000001770 (pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316:1005829:1 gene:EMLSAG00000001770 transcript:EMLSAT00000001770 description:"maker-LSalAtl2s12-augustus-gene-10.6")

HSP 1 Score: 111.309 bits (277), Expect = 6.685e-26
Identity = 63/186 (33.87%), Postives = 107/186 (57.53%), Query Frame = 0
Query:   96 NNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQ-NPDECIFKV---NQPYAFISSALTFWAPVAIMLCMYHRIYKEAL-RQKE 276
             N++V+IS     +L+ I+NYFL SLA+AD+++   +M    +  I  EW  G  ICD W S+D   S  S ++L  IS DRYF++ +PL Y +  T + AA+MI  AW    ++ + P  L W     ++E ++   P++C  +    N+  + ++  + F+ PV+IM+ +Y R++ E + RQ+E
Sbjct:   52 GNVMVMISFKMDKQLQTISNYFLFSLAIADVIIGMISMPLFTVFIIQKEWTLGANICDAWLSVDYLASNASVMNLIVISFDRYFSVTRPLTYRARRTTRKAALMIFSAWAIXAVV-WPPSILAW----PYIEGKRTIPPNDCYIQYIYSNEFMSIVTVMIAFFIPVSIMIGLYVRVWWETVKRQRE 232          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000004808 (pep:novel supercontig:LSalAtl2s:LSalAtl2s253:921047:991978:-1 gene:EMLSAG00000004808 transcript:EMLSAT00000004808 description:"maker-LSalAtl2s253-augustus-gene-9.7")

HSP 1 Score: 97.8265 bits (242), Expect = 1.315e-21
Identity = 63/238 (26.47%), Postives = 115/238 (48.32%), Query Frame = 0
Query:   77 LFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIF-------LGWYT-------TKEHLEWRKQNPD-------------------ECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRS 281
            L ++L + I+  ++I+ +  N+LVVI++   + L ++ N+F+ SLA+AD+L+    M F+   E+ G W FG   C +  ++DV   T S +++C I++DRY++I + + Y +  T     +MI   W    LIS  P+        L W+T        +  +E+ +   D                   +C    +  Y   S+  +F+ P  IM+ +Y +IY  A   ++  RR+
Sbjct:   45 LQVILLAIIMTAMMIVIVIGNMLVVIAIATENNLTNVQNWFIASLAIADMLIGLIVMPFSLADELMGYWMFGEXYCXIHAAVDVLLCTASIMNICLIALDRYWSITRAIDYLNARTPAKVTIMIITVWILSGLISIPPLLGWKQDQDLTWFTQILVEQGNRTQMEFIQDLQDSGRMNMENFTSTLELVVYPQCGLSQDLGYVLYSAFGSFYIPSCIMVFVYIKIYYAA---RDRARRN 279          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000003687 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1:1117397:1240427:-1 gene:EMLSAG00000003687 transcript:EMLSAT00000003687 description:"maker-LSalAtl2s1-snap-gene-13.14")

HSP 1 Score: 96.2857 bits (238), Expect = 1.364e-21
Identity = 63/210 (30.00%), Postives = 99/210 (47.14%), Query Frame = 0
Query:   96 NNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEIT-GEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVK-VAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPD--ECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIY-------------------KEALRQKESIRRSS 282
             N  V++++    RL+ I NYF++SL  AD LV  F +     + +T G W  G+I+CD W S+D+   T S L LC IS+DRY AI +P +Y+  +  K +   +I   W    +I+  P+           E  +  P+  EC +     Y   S+  TF+ P+ ++L  Y RI                    ++   Q +SI+RSS
Sbjct:   25 GNSTVIMAILTVPRLQTITNYFILSLGFADFLVGLFVLPAAISLHMTEGVWVLGWILCDAWISMDILLCTASILSLCAISIDRYLAISQPFRYSKRLRTKGLVMKIIAAVWILSAVITCPPMS----------EPNRHGPNLTECHYNEKPGYIVYSACGTFYVPLIVILYTYGRIVVVVKERTKYFVDMQGGTEGRQTSNQPQSIKRSS 224          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000011964 (pep:novel supercontig:LSalAtl2s:LSalAtl2s84:1368584:1370834:1 gene:EMLSAG00000011964 transcript:EMLSAT00000011964 description:"maker-LSalAtl2s84-augustus-gene-13.5")

HSP 1 Score: 95.5153 bits (236), Expect = 8.049e-21
Identity = 69/241 (28.63%), Postives = 125/241 (51.87%), Query Frame = 0
Query:   74 LDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEW--NFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTV-KVAAVMIGVAWTAPTLISFLPIFLGWYTTKEH-LEWRKQNPDECIFKVNQPYAFISSALT--FWAPVAIMLCMYHRIYKEA------LRQKESIRRSSVP-SQQHLIIDSDRVRTRFN 301
              T   VL +  L + I++  F NLLV++S     ++R   N+F+ SLA+ D+L+   +M F  +  + G W    G ++CDLW S+D     VS   +  I++DR+ ++    +Y ++ T  K+ AV++ + W    L+ F+ IF GW    EH +  R   P EC+ +  +   F +S +   +W P+ I++ +Y  I++ A       R KE  R+  +  +++ L   S+ ++T+ N
Sbjct:  135 FGTALTVLIAIFLAICIVITTFGNLLVLVSFVVERQIRQPPNFFIASLAITDVLIGTVSMPFYTIYVLVGYWPDELGPMLCDLWLSVDYTVCLVSQFTVLSITIDRFCSVKFATQYRTWRTGNKIMAVVVTI-WVVSALLFFVSIF-GW----EHFIGKRDLLPGECMVQFLKDPLFNTSLIIGYYWIPLVILIVLYSFIFQTAWTLSKKTRGKEKERQKCLNMARKPLAAPSEALKTKSN 369          
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Match: EMLSAP00000007798 (pep:novel supercontig:LSalAtl2s:LSalAtl2s457:44439:45841:-1 gene:EMLSAG00000007798 transcript:EMLSAT00000007798 description:"maker-LSalAtl2s457-snap-gene-0.38")

HSP 1 Score: 88.9669 bits (219), Expect = 3.034e-19
Identity = 63/194 (32.47%), Postives = 98/194 (50.52%), Query Frame = 0
Query:   96 NNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEW--NFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEH-LEWRKQNPDECIFKVNQPYAFISSALT--FWAPVAIMLCMYHRIYKEA--LRQKESIRRSS 282
             N LV+I+     +LR   N+F+VSLA  DLL+   ++   ++  + G W    G I+CDLW S+D     VS L +  I++DR+ ++  P  Y          ++I   W    LI F+PIF GW    EH ++ R   P EC  +  +   F +S +   FW P+ I++ +Y  IY+ A  L +K   +R S
Sbjct:   66 GNFLVLIAFGVKQKLRESKNFFIVSLAFTDLLIGMISLPLFSVYILVGFWPPQLGPILCDLWLSIDHTVCLVSQLTVLSITIDRFCSVRFPAHYQIIKDRNKTILIIIGTWAISALIFFIPIF-GW----EHFIDKRDLLPGECKVQFLKDPLFNTSLIICYFWIPLIILIYLYGSIYRTAWTLSKKSMNKRES 254          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|77416550|sp|Q4LBB9.2|OCTB2_DROME (RecName: Full=Octopamine receptor beta-2R; Short=DmOct-beta-12; Short=DmOct-beta-2R)

HSP 1 Score: 259.996 bits (663), Expect = 2.817e-78
Identity = 137/292 (46.92%), Postives = 189/292 (64.73%), Query Frame = 0
Query:   37 ELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-SGTDSSGNITLHEIHSNN 327
            ELN +     S +  N S A  + +      +PD++ LD +  V K+ +++LIII AI  NLLV+ISV R  +LR I NYF+VSLA+AD++VA  AMTFN  V++TG WNF   +CDLWNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V  +M+   W +P L+SFLPIF+GWYTT +H ++  QNP +C F VN+ YA ISS+++FW P  IM+  Y  I++EA RQ+          +Q ++   + +      +Q +G   SG+ SS  +TLHE+   +
Sbjct:  111 ELNATQPFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQE----------KQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392          

HSP 2 Score: 75.0998 bits (183), Expect = 4.688e-13
Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0
Query:  483 EQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFRSR 535
            E+C  P IVVSILFWIGYFNSTLNP+IY   NRDF++AF + L   FC W++ R
Sbjct:  438 EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|75026733|sp|Q9VCZ3.1|OCTB1_DROME (RecName: Full=Octopamine receptor beta-1R; Short=DmOA2; Short=DmOct-beta-1R)

HSP 1 Score: 246.899 bits (629), Expect = 1.032e-73
Identity = 121/234 (51.71%), Postives = 166/234 (70.94%), Query Frame = 0
Query:   62 ESDTGGSPDDESLDTLFLV-LKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPS---QQHLII 291
            ++  G + D +    L LV +K  I+  II+ AI  N+LV++SV R+ +LR I NYF+VSLAVAD+LVA  AMTFNA V I+G+W FG ++CD+WNS DV+FST S +HLCCISVDRY+AIV+PL Y   MT +   +M+ + W +P L+SFLPI  GWYTT E+ ++ K NP  C FKVN+ YA +SS+++FW P  +ML MY+RIY+EA RQ+  + RS V +   ++HL I
Sbjct:   89 QASEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQI 322          

HSP 2 Score: 67.781 bits (164), Expect = 9.079e-11
Identity = 29/56 (51.79%), Postives = 38/56 (67.86%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTF 529
            Y+  ++C  + C  PR++V ILFWIGYFNS LNP+IY   NRDF+ AF   L+  F
Sbjct:  370 YIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLF 423          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|347595820|sp|Q4LBB6.4|OCTB3_DROME (RecName: Full=Octopamine receptor beta-3R; Short=DmOct-beta-3R)

HSP 1 Score: 238.039 bits (606), Expect = 2.050e-66
Identity = 115/202 (56.93%), Postives = 149/202 (73.76%), Query Frame = 0
Query:   82 KSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITG-EWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSS 282
            K  I   II+ A+  N LV+ISV R  +LR I NYF+VSLA+AD+LVA  AMTFNA VE++G +W FG  +C+++NSLDV+FST S LHLCCISVDRY+AIV+PL+Y   MT K    M+   W  P LISF PIFLGWYTT+EHL     +PD+C F VN+ YA ISS+++FW P  +ML MY RI+KEA+RQ++++ R+S
Sbjct:  142 KGFIFSSIILAAVLGNALVIISVQRNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQRKALSRTS 343          

HSP 2 Score: 74.3294 bits (181), Expect = 1.393e-12
Identity = 30/53 (56.60%), Postives = 40/53 (75.47%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILR 526
            Y+  ++CG   CPCP ++V +LFWIGYFNSTLNP+IY   NRDF++AF + L 
Sbjct: 1188 YVITSLCG-PACPCPDVLVVVLFWIGYFNSTLNPLIYAYFNRDFREAFRNTLE 1239          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|1169213|sp|P42289.1|DRD1_XENLA (RecName: Full=D(1A) dopamine receptor; AltName: Full=Dopamine D1 receptor)

HSP 1 Score: 164.851 bits (416), Expect = 1.095e-43
Identity = 93/212 (43.87%), Postives = 128/212 (60.38%), Query Frame = 0
Query:   78 FLVLKSGILILIIILAIFNNLLVVISVFRYHRLR-HINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKE------HLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSS 282
            F VL    L ++I+  +  N LV  +V R+  LR  + N+F++SLAV+DLLVA   M + A+ EI G W FG   C++W + D+  ST S L+LC ISVDRY+AI  P +Y   MT KVA +MIGVAWT   LISF+P+ L W+  K       ++    +  D C   +N+ YA  SS ++F+ PVAIM+  Y RIY+ A +Q   IRR S
Sbjct:   21 FRVLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFG-TFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFIMIGVAWTLSVLISFIPVQLNWHKAKTTSFFDLNITLHDRTMDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAAKQ---IRRIS 228          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|341940152|sp|Q64264.2|5HT1A_MOUSE (RecName: Full=5-hydroxytryptamine receptor 1A; Short=5-HT-1A; Short=5-HT1A; AltName: Full=Serotonin receptor 1A)

HSP 1 Score: 163.696 bits (413), Expect = 1.570e-43
Identity = 134/479 (27.97%), Postives = 211/479 (44.05%), Query Frame = 0
Query:   64 DTGGSPDDESLDTL---FLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEA-LRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAH-SINSDDSTTSSKVLC-NRKNR--IELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAI----CGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
             TGG  +D  L  +   + V+ S +L  +I  A+  N  VV ++     L+++ NY + SLAV DL+V+   +   AL ++  +W  G + CDL+ +LDV   T S LHLC I++DRY+AI  P+ Y +  T + AA +I + W    LIS +P  LGW T ++     + NP+EC    +  Y   S+   F+ P+ +ML +Y RI++ A  R ++++++                     E +  G   GT S+                 PP +  +     S     S E+                             A  TP  N ++     +  L VI       S  H  + S+   TS    C  RKN    E   KM    E +    LG+  +G  +L     + +  VA+    C +  C  P ++ +I+ W+GY NS LNPVIY   N+DF++AF  I++  FC
Sbjct:   20 GTGG--NDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLIS-IPPMLGWRTPED-----RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKV--------------------EKKGAGTSFGTSSA-----------------PPPKKSLNGQPGSGDCRRSAENR----------------------------AVGTPCANGAVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGI-IMGTFIL---CWLPFFIVALVLPFC-ESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC 420          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|6224984|sp|O70528.1|5HT4R_CAVPO (RecName: Full=5-hydroxytryptamine receptor 4; Short=5-HT-4; Short=5-HT4; AltName: Full=Serotonin receptor 4)

HSP 1 Score: 160.999 bits (406), Expect = 6.639e-43
Identity = 95/229 (41.48%), Postives = 134/229 (58.52%), Query Frame = 0
Query:   89 IIILAIFNNLLVVISVFRYHRLRHIN-NYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAI-VKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTK--EHLEWRKQNPDE----CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIY---KEALRQKESIRRSSVPSQ-------QHLIIDSDRVRTR 299
            +I++AI  NLLV+++V R  +LR I  NYF+VSLA ADLLV+   M F A+  +   W +G + C +  SLDV  +T S  HLCCIS+DRY+AI  +PL Y + MT    A+M+G  W  P  ISFLPI  GW      + +E RK N +     C+F VN+PYA   S + F+ P  +M+  Y+RIY   KE  RQ + ++R+  P++       QH    + R+RT 
Sbjct:   29 VILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRPQPADQH---STHRMRTE 254          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|341940619|sp|P97288.3|5HT4R_MOUSE (RecName: Full=5-hydroxytryptamine receptor 4; Short=5-HT-4; Short=5-HT4; AltName: Full=Serotonin receptor 4)

HSP 1 Score: 159.073 bits (401), Expect = 4.338e-42
Identity = 95/232 (40.95%), Postives = 134/232 (57.76%), Query Frame = 0
Query:   86 LILIIILAIFNNLLVVISVFRYHRLRHIN-NYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAI-VKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTK--EHLEWRK----QNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIY---KEALRQKESIRRSSV-------PSQQHLIIDSDRVRTR 299
            L ++I++AI  NLLV+++V R  +LR I  NYF+VSLA ADLLV+   M F A+  +   W +G + C +  SLDV  +T S  HLCCIS+DRY+AI  +PL Y + MT    A+M+G  W  P  ISFLPI  GW      + +E RK     N   C+F VN+PYA   S + F+ P  +M+  Y+RIY   KE  +Q + ++R+         P+ QH    + R+RT 
Sbjct:   26 LAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQH---STHRMRTE 254          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|1706280|sp|P53452.1|DRD1L_TAKRU (RecName: Full=D(1)-like dopamine receptor)

HSP 1 Score: 159.458 bits (402), Expect = 1.282e-41
Identity = 92/211 (43.60%), Postives = 126/211 (59.72%), Query Frame = 0
Query:   80 VLKSGILILIIILAIFNNLLVVISVFRYHRLR-HINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWY--TTKEHLEWRKQ-----NPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSS 282
            VL    L L+I   +  N LV ++V ++  LR  + N+F++SLA++DLLVA   M + A  EI G W FG   C++W + D+  ST S L+LC ISVDRY+AI  P +Y   MT KVA +MI VAWT   LISF+P+ L W+   T  ++E          PD C   +N+ YA  SS ++F+ PVAIM+  Y RIY+ A +Q   IRR S
Sbjct:   24 VLTGCFLSLLIFTTLLGNTLVCVAVTKFRHLRSKVTNFFVISLAISDLLVAILVMPWKAATEIMGFWPFGEF-CNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVACLMISVAWTLSVLISFIPVQLNWHKAQTASYVELNGTYAGDLPPDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQ---IRRIS 230          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|112812|sp|P19327.1|5HT1A_RAT (RecName: Full=5-hydroxytryptamine receptor 1A; Short=5-HT-1A; Short=5-HT1A; AltName: Full=Serotonin receptor 1A)

HSP 1 Score: 158.303 bits (399), Expect = 1.295e-41
Identity = 130/462 (28.14%), Postives = 211/462 (45.67%), Query Frame = 0
Query:   78 FLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEA-LRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSS--GNITLHEIHSNNNYNRYPPNR-LGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLT-PPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAI----CGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            + V+ S +L  +I  A+  N  VV ++     L+++ NY + SLAV DL+V+   +   AL ++  +W  G + CDL+ +LDV   T S LHLC I++DRY+AI  P+ Y +  T + AA +I + W    LIS +P  LGW T ++     + +PD C    +  Y   S+   F+ P+ +ML +Y RI++ A  R ++++R+                     E +  G   GT S+     +L+    + ++ R   NR +G P +  + R      D+   L V    +       GN    L     P PS + S +  PA     +  NA+A+R                              KM    E +    LG+  +G  +L     + +  VA+    C +  C  P ++ +I+ W+GY NS LNPVIY   N+DF++AF  I++  FC
Sbjct:   35 YQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLIS-IPPMLGWRTPED-----RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKV--------------------EKKGAGTSLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVR----QGDDEATLEVIEVHR------VGNSKEHL-----PLPSESGSNSYAPACLERKNERNAEAKR------------------------------KMALARERKTVKTLGI-IMGTFIL---CWLPFFIVALVLPFC-ESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC 420          
BLAST of EMLSAG00000005242 vs. SwissProt
Match: gi|118251|sp|P25115.1|DRD5_RAT (RecName: Full=D(1B) dopamine receptor; AltName: Full=D(5) dopamine receptor; AltName: Full=Dopamine D5 receptor)

HSP 1 Score: 159.458 bits (402), Expect = 1.479e-41
Identity = 92/230 (40.00%), Postives = 134/230 (58.26%), Query Frame = 0
Query:   80 VLKSGILILIIILAIFNNLLVVISVFRYHRLR-HINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKE-------------------HLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEA---LRQKESIRRSSVPSQ 286
            V+ +G+L L+I+  +  N+LV  ++ R   LR  + N F+VSLAV+DL VA   M + A+ E+ G W FG   CD+W + D+  ST S L+LC ISVDRY+AI +P +Y   MT +VA VM+G+AWT   LISF+P+ L W+  K                     LE R +N D     +N+ YA  SS ++F+ PVAIM+  Y RIY+ A   +R+  S+ R++  +Q
Sbjct:   39 VVTAGLLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFG-TFCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVGLAWTLSILISFIPVQLNWHRDKAGSQGQEGLLSNGTPWEEGWELEGRTENCDS---SLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQ 264          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: gb|EFA10770.2| (Octopamine receptor beta-3R-like Protein [Tribolium castaneum])

HSP 1 Score: 309.686 bits (792), Expect = 2.848e-97
Identity = 196/547 (35.83%), Postives = 292/547 (53.38%), Query Frame = 0
Query:   47 SVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITG-EWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDS-DRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDES---LPLNVSSSTKKETKFVEGNFSMTLSRCASPTP--------------SRNCSLTPPASNNL---LSVINAKARRVS----------------------------------------------MAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
            SV++N +S   N      T G+P     + L L++K  I   II+ A+  N LV+ISV R+ +LR I NY++VSLA+AD+LVA  AMTFNA VE+TG +W FGY +CD+WNSLDV+FST S LHLCCISVDRY+AIV+PL+Y   MT +  + M+   WT P LISF PIFLGWYTT++H+++RK NP+ C F VNQ YA ISS+++FW P  +M+ MY RIYKEA+RQ++++ R+S     ++I++S  + RT + +   + F   +D     T+ +I  N   +    + +    +T+ +  + ++ D S     LN++ ST +   F   ++S++L    +P P              +R C    P   N+   L ++N   +R                                                MA  + +  +    +VL N +  I    K     E + A  LG+      +      + Y+   +CGD+ CP P  ++ +LFW+GYFNS LNP+IY   NRDF++AF D L
Sbjct:   17 SVLQNGTSNDTNVA----TVGNPHPHWTELLLLIVKGFIFGTIIVSAVLGNALVIISVHRHRKLRVITNYYVVSLAMADMLVALCAMTFNASVELTGGKWLFGYFMCDVWNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPITMTHRTVSFMLANVWTLPALISFTPIFLGWYTTEDHIDFRKTNPNVCKFVVNQYYALISSSISFWIPGIVMVTMYCRIYKEAIRQRKALSRTS----SNIILNSIHQHRTSYRDRYGDHFLHPSDGELT-TVGQI--NGRRSTSSGSAVSYGTTTTEFNTAMNSRDNSKAATELNMNVSTFRVDHFKVMDWSLSL---FNPNPYIDCNIDDFVLDNNNRECLPPEPQLGNIEYKLKIVNPTKQRFEHLVTQLKWRLHEGNGVAIYQIGVEDCGVLAGLSHRDMTASLKTLQLMALRLGAATAILHERVLENGRTSIRQQSKSWRA-EHKAARTLGIIMGAFMLCWLPFFLWYVITTLCGDDLCPTPDWLIGMLFWVGYFNSALNPLIYAYFNRDFREAFKDTL 548          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: XP_397139.2 (PREDICTED: octopamine receptor beta-1R [Apis mellifera])

HSP 1 Score: 272.707 bits (696), Expect = 9.774e-85
Identity = 128/227 (56.39%), Postives = 172/227 (75.77%), Query Frame = 0
Query:   70 DDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPS---QQHLIIDS 293
            +DE    + L +K+ ++  II+ A+F NLLV++SV R+ +LR I NYF+VSLA+AD+LVA FAMTFNA VE++G W FGY +CD+WNSLDV FSTVS LHLCCISVDRY+AIV+PL Y   MT    + M+ V W +PT++SFLPIF GWYTT++HLE+R+  PD C+F+VN+PYA ISS+++FW P  IM+ MY++IYKEA RQ+  + RS V +    +HL I+ 
Sbjct:   44 NDELERVILLTVKATVMGFIILCALFGNLLVIVSVMRHRKLRVITNYFVVSLALADMLVAIFAMTFNASVELSGRWLFGYFMCDVWNSLDVFFSTVSILHLCCISVDRYYAIVQPLDYPLIMTNLRLSTMLSVVWCSPTVMSFLPIFAGWYTTEKHLEYRRNYPDVCVFQVNKPYAVISSSVSFWLPGIIMIAMYYKIYKEADRQERMLYRSKVAAALLNKHLQING 270          

HSP 2 Score: 55.8398 bits (133), Expect = 2.442e-7
Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILR 526
            Y+  ++C  + C     VV+++FW+GYFNS LNP+IY   NRDF+ AF   L+
Sbjct:  328 YIITSLC--DSCESSDSVVAVVFWVGYFNSALNPLIYAYFNRDFRVAFRKTLK 378          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: EEB10259.1 (class A rhodopsin-like G-protein coupled receptor GPRoar2, putative [Pediculus humanus corporis])

HSP 1 Score: 260.381 bits (664), Expect = 1.777e-80
Identity = 141/301 (46.84%), Postives = 193/301 (64.12%), Query Frame = 0
Query:   48 VIRNNSSLAY----NTVYESDTGGSPDDESLDTLF---LVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEIT-GEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPS---QQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRL 337
            V+ NN+   +    NT+ ++ T  + +   L  +    +VLKS ++  II+ AI  NLLV++SV R+ +LR I NYF+VSLA+AD+LVA +AM FNA V IT G+W FGY +CD+WNSLDV+FSTVS LHLCCISVDRY+AIV+PL Y   +T+    +M+ V W +P L+SFLPIF+GWYTT E+LE+R  +PD+C FKVN+ YA ISS ++FWAP  IM+ MY RIY EA  Q+  + RS V S    +H              LQ NG  +G      +  H+  +N N+     N++
Sbjct:    4 VVDNNTVTGFTSFNNTILDNSTNDNNNQVQLTWILISVMVLKSSVMGFIIVAAICGNLLVIVSVMRHRKLRVITNYFVVSLALADMLVAIWAMCFNASVVITDGKWLFGYFMCDVWNSLDVYFSTVSILHLCCISVDRYYAIVQPLDYPLIITIHKLGIMLAVVWCSPALLSFLPIFMGWYTTNEYLEFRLDHPDDCSFKVNRTYAVISSTVSFWAPGLIMIYMYWRIYMEADIQERMLYRSKVASALLNKH--------------LQINGISAGL---ATLPHHDCENNRNFQPIAINKM 287          

HSP 2 Score: 62.3882 bits (150), Expect = 1.842e-9
Identity = 27/53 (50.94%), Postives = 36/53 (67.92%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILR 526
            Y+  ++CG E+C CP  VV+ +FW GYFNS LNP+IY   NR+F+ AF   L 
Sbjct:  315 YIITSVCG-EKCDCPPGVVAAVFWFGYFNSALNPLIYAYFNREFRIAFKKTLE 366          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: EGK96733.1 (AGAP002886-PB [Anopheles gambiae str. PEST])

HSP 1 Score: 261.536 bits (667), Expect = 2.049e-79
Identity = 132/267 (49.44%), Postives = 180/267 (67.42%), Query Frame = 0
Query:   64 DTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESI---RRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNN 327
            D GG    E +D + LVLK+ I++ II+ AIF NLLV+ISV R+ +LR I NYF+VSLA+AD++VA  AMTFN  V+ITG W FG  +CD+WNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V A+M+   W +P L+SF+PIF GWYTT++H +    NPD C+F VN+PYA ISS+++F+ P  IM+  Y +I++EA RQ++ +   + +++   QH                     SG+ SS  +TLHE+ +  
Sbjct:  120 DAGGG---EWIDVVLLVLKASIMMFIIVAAIFGNLLVIISVKRHRKLRVITNYFVVSLAMADIMVAMMAMTFNFSVQITGSWKFGSFMCDVWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVAIMLLNTWISPALLSFVPIFAGWYTTEKHKQEVLDNPDSCLFIVNKPYAVISSSISFFIPCTIMVFTYFQIFREANRQEKQLALRQGTAMLMHQHNTGGGVGGGGSGGGTNGEAL-SGSGSSKTLTLHEVDAEQ 382          

HSP 2 Score: 75.485 bits (184), Expect = 2.015e-13
Identity = 33/61 (54.10%), Postives = 46/61 (75.41%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFR 533
            Y+  ++C  ++CP P IVV+++FWIGYFNSTLNP+IY   NRDF++AF + L   FC W+R
Sbjct:  421 YIITSLC--DRCPNPDIVVALVFWIGYFNSTLNPLIYAYFNRDFREAFRNTLDCMFCAWWR 479          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: ALI30563.1 (octopamine beta2 receptor, isoform G [Drosophila melanogaster])

HSP 1 Score: 259.996 bits (663), Expect = 1.365e-78
Identity = 137/292 (46.92%), Postives = 189/292 (64.73%), Query Frame = 0
Query:   37 ELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-SGTDSSGNITLHEIHSNN 327
            ELN +     S +  N S A  + +      +PD++ LD +  V K+ +++LIII AI  NLLV+ISV R  +LR I NYF+VSLA+AD++VA  AMTFN  V++TG WNF   +CDLWNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V  +M+   W +P L+SFLPIF+GWYTT +H ++  QNP +C F VN+ YA ISS+++FW P  IM+  Y  I++EA RQ+          +Q ++   + +      +Q +G   SG+ SS  +TLHE+   +
Sbjct:  111 ELNATQPFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQE----------KQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392          

HSP 2 Score: 75.0998 bits (183), Expect = 2.272e-13
Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0
Query:  483 EQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFRSR 535
            E+C  P IVVSILFWIGYFNSTLNP+IY   NRDF++AF + L   FC W++ R
Sbjct:  438 EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: AFH06396.1 (octopamine beta2 receptor, isoform E [Drosophila melanogaster])

HSP 1 Score: 259.996 bits (663), Expect = 1.365e-78
Identity = 137/292 (46.92%), Postives = 189/292 (64.73%), Query Frame = 0
Query:   37 ELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-SGTDSSGNITLHEIHSNN 327
            ELN +     S +  N S A  + +      +PD++ LD +  V K+ +++LIII AI  NLLV+ISV R  +LR I NYF+VSLA+AD++VA  AMTFN  V++TG WNF   +CDLWNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V  +M+   W +P L+SFLPIF+GWYTT +H ++  QNP +C F VN+ YA ISS+++FW P  IM+  Y  I++EA RQ+          +Q ++   + +      +Q +G   SG+ SS  +TLHE+   +
Sbjct:  111 ELNATQPFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQE----------KQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392          

HSP 2 Score: 75.0998 bits (183), Expect = 2.272e-13
Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0
Query:  483 EQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFRSR 535
            E+C  P IVVSILFWIGYFNSTLNP+IY   NRDF++AF + L   FC W++ R
Sbjct:  438 EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: AFH06395.1 (octopamine beta2 receptor, isoform D [Drosophila melanogaster])

HSP 1 Score: 259.996 bits (663), Expect = 1.365e-78
Identity = 137/292 (46.92%), Postives = 189/292 (64.73%), Query Frame = 0
Query:   37 ELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-SGTDSSGNITLHEIHSNN 327
            ELN +     S +  N S A  + +      +PD++ LD +  V K+ +++LIII AI  NLLV+ISV R  +LR I NYF+VSLA+AD++VA  AMTFN  V++TG WNF   +CDLWNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V  +M+   W +P L+SFLPIF+GWYTT +H ++  QNP +C F VN+ YA ISS+++FW P  IM+  Y  I++EA RQ+          +Q ++   + +      +Q +G   SG+ SS  +TLHE+   +
Sbjct:  111 ELNATQPFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQE----------KQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392          

HSP 2 Score: 75.0998 bits (183), Expect = 2.272e-13
Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0
Query:  483 EQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFRSR 535
            E+C  P IVVSILFWIGYFNSTLNP+IY   NRDF++AF + L   FC W++ R
Sbjct:  438 EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: AFH06394.1 (octopamine beta2 receptor, isoform C [Drosophila melanogaster])

HSP 1 Score: 259.996 bits (663), Expect = 1.365e-78
Identity = 137/292 (46.92%), Postives = 189/292 (64.73%), Query Frame = 0
Query:   37 ELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-SGTDSSGNITLHEIHSNN 327
            ELN +     S +  N S A  + +      +PD++ LD +  V K+ +++LIII AI  NLLV+ISV R  +LR I NYF+VSLA+AD++VA  AMTFN  V++TG WNF   +CDLWNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V  +M+   W +P L+SFLPIF+GWYTT +H ++  QNP +C F VN+ YA ISS+++FW P  IM+  Y  I++EA RQ+          +Q ++   + +      +Q +G   SG+ SS  +TLHE+   +
Sbjct:  111 ELNATQPFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQE----------KQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392          

HSP 2 Score: 75.0998 bits (183), Expect = 2.272e-13
Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0
Query:  483 EQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFRSR 535
            E+C  P IVVSILFWIGYFNSTLNP+IY   NRDF++AF + L   FC W++ R
Sbjct:  438 EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: AAF54835.2 (octopamine beta2 receptor, isoform A [Drosophila melanogaster])

HSP 1 Score: 259.996 bits (663), Expect = 1.365e-78
Identity = 137/292 (46.92%), Postives = 189/292 (64.73%), Query Frame = 0
Query:   37 ELNDSIREPNSVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-SGTDSSGNITLHEIHSNN 327
            ELN +     S +  N S A  + +      +PD++ LD +  V K+ +++LIII AI  NLLV+ISV R  +LR I NYF+VSLA+AD++VA  AMTFN  V++TG WNF   +CDLWNSLDV+FST S LHLCCISVDRY+AIVKPLKY   MT +V  +M+   W +P L+SFLPIF+GWYTT +H ++  QNP +C F VN+ YA ISS+++FW P  IM+  Y  I++EA RQ+          +Q ++   + +      +Q +G   SG+ SS  +TLHE+   +
Sbjct:  111 ELNATQPFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQE----------KQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEH 392          

HSP 2 Score: 75.0998 bits (183), Expect = 2.272e-13
Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 0
Query:  483 EQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC-WFRSR 535
            E+C  P IVVSILFWIGYFNSTLNP+IY   NRDF++AF + L   FC W++ R
Sbjct:  438 EECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDR 491          
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Match: EAA08033.5 (AGAP002888-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 254.603 bits (649), Expect = 2.278e-78
Identity = 129/224 (57.59%), Postives = 161/224 (71.88%), Query Frame = 0
Query:   59 TVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSS 282
            TV  + T   P D  ++   L LKS I   III A+  N LV+ISV +  +LR I NYF+VSLA+AD+LVA  AMTFNA VE++G W FG  +CD+WNSLDV+FST S LHLCCISVDRYFAIV+PL+Y  YMT +    M+   W  P LISF PIFLGWYTT EHL   K NPD CIF VN+ YA ISS+++FW P  +M+ MY+RIYKEA+RQ++++ R+S
Sbjct:   95 TVPTASTIVEPADRLVELTVLCLKSLIFGSIIIGAVLGNALVIISVHKNRKLRVITNYFVVSLAMADMLVALCAMTFNASVELSGRWLFGSFMCDVWNSLDVYFSTASILHLCCISVDRYFAIVRPLEYPLYMTQRTVFFMLANVWVLPALISFTPIFLGWYTTAEHLAALKINPDLCIFVVNKSYAIISSSISFWIPGIVMVTMYYRIYKEAVRQRKALSRTS 318          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|1004396063|gb|EFA10770.2| (Octopamine receptor beta-3R-like Protein [Tribolium castaneum])

HSP 1 Score: 309.686 bits (792), Expect = 1.393e-94
Identity = 196/547 (35.83%), Postives = 292/547 (53.38%), Query Frame = 0
Query:   47 SVIRNNSSLAYNTVYESDTGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITG-EWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDS-DRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDES---LPLNVSSSTKKETKFVEGNFSMTLSRCASPTP--------------SRNCSLTPPASNNL---LSVINAKARRVS----------------------------------------------MAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
            SV++N +S   N      T G+P     + L L++K  I   II+ A+  N LV+ISV R+ +LR I NY++VSLA+AD+LVA  AMTFNA VE+TG +W FGY +CD+WNSLDV+FST S LHLCCISVDRY+AIV+PL+Y   MT +  + M+   WT P LISF PIFLGWYTT++H+++RK NP+ C F VNQ YA ISS+++FW P  +M+ MY RIYKEA+RQ++++ R+S     ++I++S  + RT + +   + F   +D     T+ +I  N   +    + +    +T+ +  + ++ D S     LN++ ST +   F   ++S++L    +P P              +R C    P   N+   L ++N   +R                                                MA  + +  +    +VL N +  I    K     E + A  LG+      +      + Y+   +CGD+ CP P  ++ +LFW+GYFNS LNP+IY   NRDF++AF D L
Sbjct:   17 SVLQNGTSNDTNVA----TVGNPHPHWTELLLLIVKGFIFGTIIVSAVLGNALVIISVHRHRKLRVITNYYVVSLAMADMLVALCAMTFNASVELTGGKWLFGYFMCDVWNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPITMTHRTVSFMLANVWTLPALISFTPIFLGWYTTEDHIDFRKTNPNVCKFVVNQYYALISSSISFWIPGIVMVTMYCRIYKEAIRQRKALSRTS----SNIILNSIHQHRTSYRDRYGDHFLHPSDGELT-TVGQI--NGRRSTSSGSAVSYGTTTTEFNTAMNSRDNSKAATELNMNVSTFRVDHFKVMDWSLSL---FNPNPYIDCNIDDFVLDNNNRECLPPEPQLGNIEYKLKIVNPTKQRFEHLVTQLKWRLHEGNGVAIYQIGVEDCGVLAGLSHRDMTASLKTLQLMALRLGAATAILHERVLENGRTSIRQQSKSWRA-EHKAARTLGIIMGAFMLCWLPFFLWYVITTLCGDDLCPTPDWLIGMLFWVGYFNSALNPLIYAYFNRDFREAFKDTL 548          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|909553094|ref|XP_013147964.1| (PREDICTED: octopamine receptor beta-3R-like [Papilio polytes])

HSP 1 Score: 299.671 bits (766), Expect = 1.482e-91
Identity = 186/477 (38.99%), Postives = 260/477 (54.51%), Query Frame = 0
Query:   65 TGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTK---KETKFVEGNFSMTL-----SRCASPTPSRNCSLTPPASNNLLSVIN--------AKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
            +G +P      TL LVLK  + I II+ A+  N LV+ISV R+ +LR + NY++VSLAVAD+LVA  AMTFNA  E+T  W FG ++CD++NSLDV+FS+ S LHLCCISVDRY+AIV+PL+Y   MT +    M+   W  P  ISF+PIF+GWYTT++H ++RKQ+PD C+FK N  YA ISS+++FW P  +M+ MY RI++EA+RQ+E++ R                                 +S NI L+ +H           R    A+  S+ + P      +  N S+ T+   +ET+F  G   M L     S+ ASP  S N S    +S       N        A   R S A +  S D   ++  L ++   +  + K     E + A  LG+      +      + Y+T  +CG E C  P +VV +LFWIGYFNS LNP+IY   NRDF+DAF + L
Sbjct:   50 SGVAPAPHWHHTLLLVLKGLVFITIILGALLGNALVIISVHRHRKLRVLTNYYVVSLAVADMLVALCAMTFNASAELTDAWLFGPLVCDIFNSLDVYFSSASILHLCCISVDRYYAIVRPLEYPVTMTHRTVCFMLANVWLWPAFISFVPIFMGWYTTEQHRQYRKQHPDVCMFKANMVYAIISSSVSFWIPSVVMISMYCRIFREAIRQREALTR---------------------------------TSSNILLNSVHL----------RHTSHAAHHSHYLHPDRRPSDISPNYSTFTEVGPEETEF-GGEVVMALGDICPSKEASPRKSVNVSCDTASSGYCSGGSNKRSSSGQTATGWRPSCASAAASRDLAKAATELNSQGASLRAAGKSWRA-EHKAARTLGIIVGAFLLCWLPFFLWYVTTNVCG-EPCETPDVVVGVLFWIGYFNSALNPLIYAYFNRDFRDAFKNTL 480          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|910324442|ref|XP_013165300.1| (PREDICTED: octopamine receptor beta-3R-like, partial [Papilio xuthus])

HSP 1 Score: 298.901 bits (764), Expect = 3.549e-91
Identity = 184/477 (38.57%), Postives = 259/477 (54.30%), Query Frame = 0
Query:   65 TGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTK---KETKFVEGNFSMTL-----SRCASPTPSRNCSLTPPASNNLLSVIN--------AKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
            +G +P      TL LVLK  + + II+ A+  N LV+ISV R+ +LR + NY++VSLAVAD+LVA  AMTFNA  E+T  W FG ++CD++NSLDV+FS+ S LHLCCISVDRY+AIV+PL+Y   MT +    M+   W  P  ISF+PIF+GWYTT++H ++RK +PD C+FK N  YA ISS+++FW P  +M+ MY RI++EA+RQ+E++ R                                 +S NI L+ +H           R    A+  S+ + P      +  N S+ T+   +ET+F  G   M L     S+ ASP  S N S    +S       N        A   R S A +  S D   ++  L ++   +  + K     E + A  LG+      +      + Y+T  +CG E C  P +VV +LFWIGYFNS LNP+IY   NRDF+DAF + L
Sbjct:   57 SGAAPSSHWHHTLLLVLKGLVFVTIILGALLGNALVIISVHRHRKLRVLTNYYVVSLAVADMLVALCAMTFNASAELTDAWLFGPLVCDIFNSLDVYFSSASILHLCCISVDRYYAIVRPLEYPVTMTHRTVCFMLANVWLWPAFISFVPIFMGWYTTEQHRQYRKHHPDVCMFKANMVYAIISSSVSFWIPSVVMISMYCRIFREAIRQREALTR---------------------------------TSSNILLNSVHL----------RHTSHAAHHSHYLHPDRRPSDISPNYSTFTEVGPEETEF--GEVVMALGDICPSKEASPRKSVNVSCDTASSGYCSGGSNKRSSSGQTATGWRPSCASAAASRDLAKAATELNSQGASLRAAGKSWRA-EHKAARTLGIIVGAFLLCWLPFFLWYVTTNVCG-EPCETPDVVVGVLFWIGYFNSALNPLIYAYFNRDFRDAFKNTL 486          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|913318262|ref|XP_013190150.1| (PREDICTED: octopamine receptor beta-3R-like [Amyelois transitella])

HSP 1 Score: 297.745 bits (761), Expect = 1.778e-90
Identity = 177/463 (38.23%), Postives = 256/463 (55.29%), Query Frame = 0
Query:   69 PDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRY-----PPNRLGVPASTSSYRISPSTEDESLP-LNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
            PD  +  TL L+LK  +   II+ A+  N LV+ISV R+ +LR + NY++VSLAVAD+LVA  AMTFNA  E+T +W FG ++CD++NSLDV+FS+ S LHLCCISVDRY+AIV+PL+Y   MT +    M+   W  P  ISF+PIF+GWYTT+ H ++RK +PD CIFKVN  YA ISS+++FW P  +M+ MY RI++EA+RQ+E++ R+S     +++++S  ++   +    + +        +I+        NY+ +          G     S   I PS E      +NVS  T                 C+  +  R+ S  PP              R S + ++ S D   ++  L  +   +  + K     E + A  LG+      +      I Y+T  +CG E C  P +VV +LFWIGYFNS LNP+IY   NRDF+DAF + L
Sbjct:   80 PDHHTQHTLTLILKGLVFTTIILGALLGNALVIISVHRHRKLRVLTNYYVVSLAVADMLVALCAMTFNASSELTDDWLFGPLVCDIYNSLDVYFSSASILHLCCISVDRYYAIVRPLEYPVTMTHRTVCFMLANVWLWPAFISFVPIFMGWYTTEHHRQYRKAHPDVCIFKVNMVYAVISSSVSFWIPSVVMISMYCRIFREAIRQREALTRTS----SNILLNSVHIKHTSHSAHHSHYLHPDRRPSDIS-------PNYSTFTEVGPEETEFGGEVVMSIGDICPSKEASPRKSVNVSCDTASS------------GYCSGGSNKRSSSGQPP-----------TGWRPSCSSAVASRDLAKAATELNAQGATLRAAGKSWRA-EHKAARTLGIIVGAFLLCWLPFFIWYVTTNVCG-EPCETPSVVVGVLFWIGYFNSALNPLIYAYFNRDFRDAFKNTL 506          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|930671454|gb|KPJ12181.1| (Octopamine receptor beta-3R [Papilio machaon])

HSP 1 Score: 296.975 bits (759), Expect = 1.790e-90
Identity = 184/477 (38.57%), Postives = 257/477 (53.88%), Query Frame = 0
Query:   65 TGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTK---KETKFVEGNFSMTL-----SRCASPTPSRNCSLTPPASNNLLSVIN--------AKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
             G +P      TL LVLK  + + II+ A+  N LV+ISV R+ +LR + NY++VSLAVAD+LVA  AMTFNA  E+T  W FG ++CD++NSLDV+FS+ S LHLCCISVDRY+AIV+PL+Y   MT +    M+   W  P  ISF+PIF+GWYTT++H ++RK +PD C+FK N  YA ISS+++FW P  +M+ MY RI++EA+RQ+E++ R                                 +S NI L+ +H           R    A+  S+ + P      +  N S+ T+   +ET+F  G   M L     S+ ASP  S N S    +S       N        A   R S A +  S D   ++  L  +   +  + K     E + A  LG+      +      + Y+T  +CG E C  P +VV +LFWIGYFNS LNP+IY   NRDF+DAF + L
Sbjct:   54 AGAAPSPHWHHTLLLVLKGLVFVTIILGALLGNALVIISVHRHRKLRVLTNYYVVSLAVADMLVALCAMTFNASAELTDAWLFGPLVCDIFNSLDVYFSSASILHLCCISVDRYYAIVRPLEYPVTMTHRTVCFMLANVWLWPAFISFVPIFMGWYTTEQHRQYRKHHPDVCMFKANMVYAIISSSVSFWIPSVVMISMYCRIFREAIRQREALTR---------------------------------TSSNILLNSVHL----------RHTSHAAHHSHYLHPDRRPSDISPNYSTFTEVGPEETEF-GGEVVMALGDICPSKEASPRKSVNVSCDTASSGYCSGGSNKRSSSGQTATGWRPSCASAAASRDLAKAATELNCQGASLRAAGKSWRA-EHKAARTLGIIVGAFLLCWLPFFLWYVTTNVCG-EPCETPDVVVGVLFWIGYFNSALNPLIYAYFNRDFRDAFKNTL 484          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|1009361458|gb|KYM86546.1| (Octopamine receptor beta-3R [Atta colombica])

HSP 1 Score: 293.893 bits (751), Expect = 4.051e-89
Identity = 185/493 (37.53%), Postives = 266/493 (53.96%), Query Frame = 0
Query:   71 DESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITG-EWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDE------------------CIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNF----SMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELS--EKMTSIFEGE--IASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTF-----CW 531
            DES +   + LK  I+I III A+  N LV+ SV R+ +LR   N ++VSLA+ADLLVA  AMTFNA VE++G +W  G I+CD+WNS+DV+FST S LHLCCISVDRY+AIV+PL+Y + M       M+  AWT P LISF+PIF+GWYTT++HL++ ++N  +                  C+F VN PYA ISS ++FW P  +M+ MY +IYKEA+RQ+ ++ R+S  +    ++++  VR       + G +  + +S  + LH     ++Y R P  R       S+  ++   E    PL    S  +   F    F     ++LS+      S        A   +L      +R   +   +    S T   +L   ++R+  +   + T  +  E   A  LG+      +      + YLT ++CG E C CP  VVS+LFWIGYFNS LNP+IY   NRDF+DAF D L+        CW
Sbjct:   38 DESRNITLIALKGAIMISIIITALLGNALVIASVRRHRKLRVPTNRYVVSLAMADLLVAICAMTFNASVELSGGKWLLGSIMCDVWNSMDVYFSTASILHLCCISVDRYYAIVRPLEYPAIMRTVTVTAMLSSAWTLPALISFIPIFMGWYTTQQHLDFPRRNFHDNPTNFMQLKMLRLLQSQICMFVVNLPYAVISSCVSFWIPGVVMIVMYCKIYKEAVRQRAALSRASSST----VLNNVHVRR-----SSGGSRHHSRTSHQLLLHP-SDASDYGRPPSYR------ASAAELNIENELTYPPLKFHPSISRALSFSLALFFQFGFLSLSQRIHQILSEQV-----AGERVLPRTGGCSRWSWLTGWLLQSRSLTYLSLLAGSRDRVYRTSIRQQTKSWRAEHKAARTLGIIMGAFLLCWLPFFLWYLTTSLCG-EACYCPDTVVSVLFWIGYFNSALNPLIYAYFNRDFRDAFKDTLKSALPCCANCW 508          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|298106408|gb|ADI56273.1| (beta-like octopamine receptor R2 [Amphibalanus improvisus])

HSP 1 Score: 291.197 bits (744), Expect = 2.468e-88
Identity = 176/452 (38.94%), Postives = 242/452 (53.54%), Query Frame = 0
Query:   80 VLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVL-ERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            VLK   +  +I+L++  NLLV++SV  + R+R + NYF++SLA AD+LVA  AMTFNA ++ITG W FGYI+CD+WNS DV FSTVS LHLCCISVDRYFAI++PL+Y S+M  +  A M+  +WT P  ISF+PIFLGWY+T EHL +R ++PD C F VN+ Y  +SS+++FW P  +M+ MY RIY+EA +Q  +I R+  PS  +                   F S TD      L  I                           + E+ +L L+  ++ + +     G      +     +PS N     P +      ++ KA  VS      + D   SS    +R  R+  S     + E + A  LGV  +G  VL        Y T  +CG   C  P ++V ILFWIGY NSTLNP+IY   N +F+DAF D L    C
Sbjct:   53 VLKITAMTAVILLSVLGNLLVIVSVLLHRRIRVVANYFVMSLAFADMLVALCAMTFNASIQITGRWMFGYIMCDMWNSFDVFFSTVSILHLCCISVDRYFAILRPLEYRSHMNKRTVAAMLVASWTTPAAISFVPIFLGWYSTSEHLSYRARHPDTCEFIVNEVYMLVSSSVSFWIPGVVMVVMYSRIYREARKQHRAISRT--PSTIN-------------------FHSSTDCGAGGPLDHI---------------------------TEEELTLALSALNNIRDDPSGGAGGGGGGGT-----SPSANGGARGPGAPPPPRFLHKKASSVSFFSEAATSDLRKSSNT--SRLCRLRFSTSHM-LREHKAAKTLGV-IMGCFVLCWLPFFTWYATATLCG-AACSVPPVLVDILFWIGYLNSTLNPMIYAYFNTEFRDAFRDTLTLVLC 446          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|1059521033|gb|AOG14368.1| (octopamine receptor beta-1R [Cancer borealis])

HSP 1 Score: 291.197 bits (744), Expect = 3.079e-87
Identity = 187/465 (40.22%), Postives = 264/465 (56.77%), Query Frame = 0
Query:   74 LDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPS---QQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIH------SNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSV----INAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
            +D L LVLK  +++ +I++++  NLLV++SV RYH+LR I NYF+VS+A+AD+LVA  AM FNA V++T  W FG ++CDLWNS+DV+FSTVS LHLCCIS+DRY AIV+PL Y   MT +  ++M+ VAW +P  IS LPIFLGWYTT+EHL+     P  C FKVN  YA +SS+++FW P  IML MY +IY+EA RQ+  + RS+V +    +HL I+     TR +    +   SGT+++G     +         +    R  P+  G+PA  ++    P   D  LP    S+     +F + + S       +PTPS     TP +      V    +    R+ S     +   + T  +V   +K +  L  KM    E + A  LG+      +        Y+  ++CGD  C  P  +V+ LFWIGYFNSTLNP+IY   NRDF+ AF   L
Sbjct:   75 VDILVLVLKGLVMLAVIVVSVLGNLLVIVSVARYHKLRVITNYFVVSMALADMLVALMAMMFNASVQLTQTWLFGAVMCDLWNSMDVYFSTVSILHLCCISIDRYTAIVQPLDYPLRMTGRTVSLMLAVAWLSPVFISVLPIFLGWYTTQEHLDRLATTPGLCEFKVNVVYAVVSSSVSFWIPGIIMLVMYFKIYREADRQEMMVFRSTVAALLLNKHLHING---MTRGSVKITDDAPSGTNAAGGDATKDTKKPQGPSEDGAVGRGAPHHNGMPAFEAT---CPGNYDTHLP--PPSTVVSRVEFPQSDES-------TPTPSPGN--TPTSRRGKTGVKRRFLGVGVRKSSTGVGPDGMLNVTVPEV---KKKQASL-HKMKR--ERKAAKTLGIIVSVFLLCWMPFFSWYIVSSLCGD-ACAVPEWLVTFLFWIGYFNSTLNPIIYAYFNRDFRKAFRKTL 515          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|939236302|ref|XP_014255138.1| (PREDICTED: octopamine receptor beta-3R-like [Cimex lectularius])

HSP 1 Score: 283.878 bits (725), Expect = 1.230e-86
Identity = 189/472 (40.04%), Postives = 255/472 (54.03%), Query Frame = 0
Query:   61 YESDTGGSPDD--ESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESL-PLNVSSSTKKETKFVEGNFSMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTF 529
            Y+ +T  S  +  E +     ++K  I+ LII++A+  N LV+ISV R+ +LR I NY++VSLA+ADLLVA  AMTFNA VE+TG W FG ++CD+WNSLDV+FST S LHLCCISVDRY+AIV+PL+Y   MT +  + M+   W  P LISF PIFLGWYTT +H ++RK NP+ CIF VN+ YA ISS+++FW P  +M+ MY RIYKEA+RQ++++ R                                 +S NI L+ IH          +R G P  T   R+ P   D  L P  +SS                         SRN S    ASN  L V  ++         INS+ +T           R   S +     E + A  LG+      +      + Y+   +CGD  C CP +VV++LFWIGYFNS LNP+IY   NRDF++AF + L+  F
Sbjct:   14 YDINTTSSTHERVEGISVAPFLVKGFIMGLIIVMAVLGNALVIISVVRHRKLRIITNYYVVSLALADLLVALCAMTFNASVELTGHWVFGPVMCDVWNSLDVYFSTASILHLCCISVDRYYAIVRPLQYPITMTHRTVSFMLANVWVLPALISFTPIFLGWYTTADHQQFRKTNPNVCIFVVNKYYAIISSSVSFWIPGVVMVTMYFRIYKEAVRQRKALSR---------------------------------TSSNIILNSIHQ---------HRRGHPHYTP--RLLPPAADGDLSPATLSSDPD----------------------SRNSSA---ASNTPLPVKKSQ---------INSNGTTV----------RTATSWRT----EHKAARTLGIIMGVFMICWLPFFLWYVITTLCGDA-CYCPDMVVTVLFWIGYFNSALNPLIYAYFNRDFREAFKNTLQCAF 392          
BLAST of EMLSAG00000005242 vs. nr
Match: gi|943959280|ref|XP_014362283.1| (PREDICTED: uncharacterized protein LOC106713896, partial [Papilio machaon])

HSP 1 Score: 298.13 bits (762), Expect = 1.238e-86
Identity = 184/477 (38.57%), Postives = 257/477 (53.88%), Query Frame = 0
Query:   65 TGGSPDDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTK---KETKFVEGNFSMTL-----SRCASPTPSRNCSLTPPASNNLLSVIN--------AKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
             G +P      TL LVLK  + + II+ A+  N LV+ISV R+ +LR + NY++VSLAVAD+LVA  AMTFNA  E+T  W FG ++CD++NSLDV+FS+ S LHLCCISVDRY+AIV+PL+Y   MT +    M+   W  P  ISF+PIF+GWYTT++H ++RK +PD C+FK N  YA ISS+++FW P  +M+ MY RI++EA+RQ+E++ R                                 +S NI L+ +H           R    A+  S+ + P      +  N S+ T+   +ET+F  G   M L     S+ ASP  S N S    +S       N        A   R S A +  S D   ++  L  +   +  + K     E + A  LG+      +      + Y+T  +CG E C  P +VV +LFWIGYFNS LNP+IY   NRDF+DAF + L
Sbjct:  504 AGAAPSPHWHHTLLLVLKGLVFVTIILGALLGNALVIISVHRHRKLRVLTNYYVVSLAVADMLVALCAMTFNASAELTDAWLFGPLVCDIFNSLDVYFSSASILHLCCISVDRYYAIVRPLEYPVTMTHRTVCFMLANVWLWPAFISFVPIFMGWYTTEQHRQYRKHHPDVCMFKANMVYAIISSSVSFWIPSVVMISMYCRIFREAIRQREALTR---------------------------------TSSNILLNSVHL----------RHTSHAAHHSHYLHPDRRPSDISPNYSTFTEVGPEETEF-GGEVVMALGDICPSKEASPRKSVNVSCDTASSGYCSGGSNKRSSSGQTATGWRPSCASAAASRDLAKAATELNCQGASLRAAGKSWRA-EHKAARTLGIIVGAFLLCWLPFFLWYVTTNVCG-EPCETPDVVVGVLFWIGYFNSALNPLIYAYFNRDFRDAFKNTL 934          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold28_size608977-processed-gene-2.6 (protein:Tk05745 transcript:snap_masked-scaffold28_size608977-processed-gene-2.6-mRNA-1 annotation:"octopamine receptor beta-1r-like")

HSP 1 Score: 409.068 bits (1050), Expect = 4.582e-138
Identity = 231/385 (60.00%), Postives = 269/385 (69.87%), Query Frame = 0
Query:   74 LDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFK-------------------------------SGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMT-LSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTT 426
            +D L +V KS ILILII+LAIF+NLLVVISVFRYH+LRHINNYFLVSLAVADL VACFAMTFNA VEITG WNFGY ICDLWNSLDVHFSTVSTLHLCCISVDRY+AIVKPLKYTS+MTVKVA++MIG+AW APTLISFLPIFLGWYTT +H EWRK NP ECIF+VN+PYA +SSALTFW PV +ML MYHRIYKEALRQK++IRRSSVPSQQHLI+DSD++R RF ELQANGFK                               +     G       +     N   P +L VP +T    I+    + + PL      + ET+F  G+ ++T  S  A    S + SLTPP+    L +     RRVSMA+S  S+D+ T
Sbjct:  109 MDALHVV-KSVILILIIVLAIFSNLLVVISVFRYHKLRHINNYFLVSLAVADLFVACFAMTFNASVEITGRWNFGYRICDLWNSLDVHFSTVSTLHLCCISVDRYYAIVKPLKYTSHMTVKVASIMIGIAWIAPTLISFLPIFLGWYTTSQHQEWRKTNPHECIFRVNKPYALLSSALTFWVPVVVMLFMYHRIYKEALRQKDAIRRSSVPSQQHLIVDSDQIRNRFQELQANGFKARNGIANMLSATANKLAVPYSGSSRLSVSSQAAGAEGGPSQPGTTNGAGQANTLAPPKL-VPPTTV---ITSEDAESAQPLR---ENECETQF--GSDTVTRRSPVARGASSGSNSLTPPSLAAPLLINPNGRRRVSMANSTASEDTRT 483          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold301_size216225-snap-gene-0.19 (protein:Tk06226 transcript:maker-scaffold301_size216225-snap-gene-0.19-mRNA-1 annotation:"tyramine octopamine receptor-like")

HSP 1 Score: 140.969 bits (354), Expect = 2.753e-35
Identity = 126/471 (26.75%), Postives = 203/471 (43.10%), Query Frame = 0
Query:   88 LIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQ-NPD-ECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEA-LRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHE-IHSNNNYNRYPPNRLGV-----PASTSSYRISPSTEDESLPLNVSSSTK-KETKFVEGNF---SMTLSRCASPTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSD------------------DSTTSSKV--LCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDIL 525
            +II+  I  N+LV++SVF +  L+   N+F+VSLA ADL V+   +  N    + G W FG I+C +W + DV   T S L+LC I++DRY+A+  P+K+    +V+     + V W     I F P+F GW       +W     PD  C     + Y   S+  +F+ P+ I++ +Y +IY+   LR +   + + V S  H   +    + R  +L+      G  +   +TL E +   N +  Y    +G      PA       S      ++  ++ +  K K +K  + +F       S+  S  P    S      + L S    K  +      +                      ST  + V    N K +I L++      E + A  + V      V      + Y+    C     P P+ VV ++ W+GY NSTLNP+IY + N DF+ AFS I+
Sbjct:   46 IIILGTIVGNILVIMSVFTHTPLKITPNFFIVSLAAADLTVSMCVLPLNVAYMVVGRWIFGSILCKMWLTSDVLCCTASILNLCAIALDRYYALHDPIKHAQRRSVRNVLAKVLVVWVMSMGICFPPLF-GWN------DWPDAFTPDTPCRLTEEKGYVIYSAMGSFYIPLGIIMFVYLKIYQNTRLRLRSRAKAAHVTSLHHPPSEHCPTQKRSLQLEHKQPVGGARARLKVTLQEQVELVNGHPIYSEVAIGASAIVDPAQGQQGSTSGPKRVATVRTHILAKVKQKHSKMYQKSFKNRGSLRSKTGSVRPEEETSTLDEPDHLLASADCLKHSKCDQGTQVTKSSFQRAPSTAVEAPGPDLPSSTPDNTVYRFINEKAKISLAK------ERKAARTMTVIVTTFIVCWLPFFLMYVITPFCSICAPPSPK-VVQVITWLGYVNSTLNPIIYTIFNLDFRIAFSRIM 502          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold114_size351134-snap-gene-1.13 (protein:Tk09545 transcript:maker-scaffold114_size351134-snap-gene-1.13-mRNA-1 annotation:"octopamine receptor beta-1r")

HSP 1 Score: 129.413 bits (324), Expect = 6.358e-35
Identity = 65/175 (37.14%), Postives = 107/175 (61.14%), Query Frame = 0
Query:   94 IFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIV-KPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRI 267
            I  N  +++ +  +  L+  ++ F+ SLA  DLL+A   MT   + E+  +W FG+ +C  ++++DV   TVS LHL CIS+DRY+AIV +PL+Y   +T     +MI + W    L  F+P+F   YT  E+LE  K NPD C  +VN  ++ ++ A++FW P +IM+ +Y+++
Sbjct:    9 ILGNGFIIVCIASHRVLQRPSHIFIASLASTDLLLALTVMTPRLISELLDKWIFGFRLCQTYHAMDVTLCTVSILHLSCISLDRYYAIVNQPLRYYQRITPNRVVLMIVLCWILSILTGFVPVFTEIYTLPEYLELSKANPDICDLRVNAYFSVLAGAVSFWVPGSIMVFVYYQV 183          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold120_size336265-processed-gene-2.7 (protein:Tk08790 transcript:snap_masked-scaffold120_size336265-processed-gene-2.7-mRNA-1 annotation:"dopamine receptor")

HSP 1 Score: 133.265 bits (334), Expect = 4.182e-33
Identity = 75/189 (39.68%), Postives = 107/189 (56.61%), Query Frame = 0
Query:   94 IFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGE-WNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEH--LEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIR 279
            +  N+LVV++V R   L    NYF+ SLAVAD LV    M F+A  E  G+ W FG  +CD W+SLDV  ST S L+LC IS+DRY+AI  P+ Y   M+   A+++I + W   + ISF P    W  T      +W      +C F  +  Y   SS ++F+ P+A+M+  Y RIY+ AL+   S++
Sbjct:   90 VVGNILVVLAVLRERSLHTATNYFITSLAVADCLVGLVVMPFSAAYEAMGQQWIFGPDLCDAWHSLDVLASTASILNLCVISLDRYWAITDPMSYPFRMSNTRASLLILLVWVCSSAISF-PAIAWWRATATGPPPQW------QCPFTEDTGYLVFSSIVSFYGPLAVMVFTYFRIYRAALKHTRSLQ 271          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1621_size33243-snap-gene-0.9 (protein:Tk12270 transcript:maker-scaffold1621_size33243-snap-gene-0.9-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_48160")

HSP 1 Score: 116.316 bits (290), Expect = 4.239e-29
Identity = 70/194 (36.08%), Postives = 111/194 (57.22%), Query Frame = 0
Query:   88 LIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPD-ECIFKV---NQPYAFISSALTFWAPVAIMLCMYHRIYKEAL-RQKE 276
            L+  + I  NL+V+IS     +L+ I+NYFL SLAVAD+++   +M    +  I  EW FG  ICD W S+D   S  S L+L  IS DRYF++ +PL Y    T + AA+MI  AW A ++I + P    W     ++E  +  PD +C  +    N+  + ++  + F+ PV++M+ +Y R++ E + RQ+E
Sbjct:   83 LLSFVTIAGNLMVMISFKMDKQLQTISNYFLFSLAVADIIIGLISMPLFTVFLIQQEWTFGVTICDTWLSVDYLASNASVLNLLVISFDRYFSVTRPLTYRVRRTTRKAALMIFSAW-AVSVIVWPPWIFAW----PYIEGIRTVPDNDCYIQFIYSNEYMSIVTVMIAFFVPVSVMIGLYVRVWWETVKRQRE 271          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold575_size133042-snap-gene-0.31 (protein:Tk10163 transcript:maker-scaffold575_size133042-snap-gene-0.31-mRNA-1 annotation:"octopamine receptor")

HSP 1 Score: 116.316 bits (290), Expect = 1.473e-27
Identity = 75/245 (30.61%), Postives = 116/245 (47.35%), Query Frame = 0
Query:   70 DDESLDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEW-----------------------RKQNPD----------ECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRS 281
            D E    L  ++  GI+ L++I   F N++V+ +V   H+LR   N F+VSLA ADL++    + F+A+ E+   W FG I C +W ++DV   T S LHL  IS+DRY A+  P+ Y + MT   A ++I  AW    +I F P+ +GW        W                          NPD          +C       Y   S+  +F+AP+ +M+    RIY+ A +  ++IR+ 
Sbjct:   65 DLEDPRVLGSLVPLGIICLVVI---FGNIMVIAAVKMTHKLRGATNLFIVSLAWADLMLGMVVLPFSAMYEVFDIWIFGRIWCSIWLAMDVWVCTASILHLVVISLDRYIAVTHPITYPNIMTSNRAKLLIVGAWVLSFVICFPPL-VGWNDESSPAMWVPAEFTVANLVAQGGTNSSSSFHLNNNPDVLAILSRCMPQCKLIQEPGYVIYSAVGSFYAPMLVMMFFNWRIYRTAKKTTKAIRQG 305          

HSP 2 Score: 57.7658 bits (138), Expect = 5.364e-9
Identity = 28/57 (49.12%), Postives = 35/57 (61.40%), Query Frame = 0
Query:  474 YLTVAICGDEQCPCPRIVVSILFWIGYFNSTLNPVIYVMTNRDFKDAFSDILRKTFC 530
            YL  A C  E C  P +  SI+FW+GY NS +NP IY M +R+F+ AF  IL K  C
Sbjct:  470 YLITAFC--EDC-FPELAFSIIFWMGYCNSAINPFIYAMFSREFRGAFKKILCKFLC 523          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold109_size355148-snap-gene-1.25 (protein:Tk11033 transcript:maker-scaffold109_size355148-snap-gene-1.25-mRNA-1 annotation:"muscarinic acetylcholine receptor m1")

HSP 1 Score: 106.301 bits (264), Expect = 3.155e-24
Identity = 112/465 (24.09%), Postives = 186/465 (40.00%), Query Frame = 0
Query:   74 LDTLFLVLKSGILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEW--NFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEH-LEWRKQNPDECIFKVNQPYAFISSALT--FWAPVAIMLCMYHRIYKEALRQKESIRRSSVPSQQHLIIDSDRVRTRFNELQANGFKSGTDSSGNITLHEIHSNNNYNRYPPNRLGVPASTSSYRISPSTEDESLPLNVSSSTKKETKFVEGNFSMTLSRCAS---PTPSRNCSLTPPASNNLLSVINAKARRVSMAHSINSDDSTTSSKVLCNRKNRIELSEKMTSIFEGEIASPLGVWTIGQGVLERQVQIKYLTVAICGDEQCPCPRIVVSILFWIGYF----NSTLNPVIYVMTNRDFKDAFSDILR 526
              TL  +  +  L   I++  F NLLV++S     ++R   N+F+ SLAV D+L+   +M F  +  + G W    G I+CDLW S+D     VS   +  I+VDR+ ++    +Y ++ T     VMI   W    L+ F+ IF GW    EH + +R   P EC+ +  +   F +S +   +W P+ I+  +Y  I++ A       +      Q+ L +                  +    + ++   +  + N  ++ PP    +   +SS    P         NV S     T  V G+ +  + R ++     PS   +      N   S I+   + + M             K     +NR   + +  SI  G     +  WT             Y  +AI    +   P  V   L+   YF    NS +NP  Y  +N+ FK+AF  I+R
Sbjct:  203 FGTLLTIFIAVSLAFCIVITTFGNLLVLVSFVVDRQIRQPTNFFIASLAVTDVLIGTVSMPFYTVYVLVGYWPAELGPILCDLWLSVDYTVCLVSQFTVLLITVDRFCSVKIAARYRAWRTGGKVMVMIVTTWIIAALLFFVSIF-GW----EHFIGYRDLRPGECMVQFLKDPIFNTSLIIGYYWIPLTILCVLYSFIFEAAWTLSRKSQEKEKERQKLLALAKKPASGATGASNTAVGIAAVAMTASLATSKPSNGNGQSKEPPKESDINEGSSSSPSVP---------NVISMKSAATFKVNGDAANEIERASTVNEDDPSSAATGKDTMYNAEESSISGSKKDI-MRKIGKRIRFRKRKKDKFRTENRARKALRTISIILGAF---VACWT------------PYHILAIIASFR---PEAVNVHLYMFSYFLCYANSPINPFCYAASNQQFKNAFKRIMR 634          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold235_size242898-processed-gene-1.7 (protein:Tk06561 transcript:snap_masked-scaffold235_size242898-processed-gene-1.7-mRNA-1 annotation:"alpha-2c adrenergic receptor")

HSP 1 Score: 97.0561 bits (240), Expect = 1.392e-22
Identity = 51/144 (35.42%), Postives = 84/144 (58.33%), Query Frame = 0
Query:   85 ILILIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEW 228
            I+  +++L +  N+LVVI++   + L  I N+F+ SLAV+D+L+    M F+   E+ G W FG + C++  ++DV   T S +++C IS+DRY++I + + Y +  T    A+MI   W    LI  +P  LGW    E L+W
Sbjct:   80 IMTAMMVLIVVGNMLVVIAIATENNLTSIQNWFIASLAVSDMLIGLLVMPFSLSYELMGYWMFGGLWCEIHAAMDVFLCTASIMNICLISLDRYWSITRAIDYLNARTPNKVALMIVTVWLLSGLIC-IPPLLGW-KKDEDLDW 221          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold633_size121756-snap-gene-0.27 (protein:Tk02266 transcript:maker-scaffold633_size121756-snap-gene-0.27-mRNA-1 annotation:"tachykinin-like peptides receptor 86c")

HSP 1 Score: 94.3597 bits (233), Expect = 1.495e-20
Identity = 75/225 (33.33%), Postives = 110/225 (48.89%), Query Frame = 0
Query:   89 IIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAWTAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIF----------KVNQPYAFISSALTFWAPVAIMLCMYHRIYKEALRQKESIRRSSVPS---QQHLIIDSDRVRTRF 300
            +I+ AIF NL+V   V  + R++++ NYFLV+L++ADL+++C    FN +      W FG I C + N +      VS   L  IS+DRY AIV+PLK    M+   A V + V W+A +L+S LP  L + TT      R QN   C+           K +  Y  +   LT+  P+  M   Y RI    L  K  I R +  S   Q+  ++   +V   F
Sbjct:  168 MIVSAIFGNLVVFWIVLAHKRMQNVTNYFLVNLSLADLMMSCLNTIFNFIFMKNRTWIFGSIYCTINNFIAYMSVAVSVFTLMAISIDRYIAIVRPLK--PRMSKTCARVFLLVIWSAGSLVS-LPSLL-YSTTWTFAYGRGQNLTVCLLLWPDGPPTVSKQDYMYNILYFILTYCVPIIAMGICYGRI-GGVLWGKSGIVRENATSDLAQERKLLSKRKVVKMF 387          
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold268_size230776-snap-gene-0.4 (protein:Tk11092 transcript:maker-scaffold268_size230776-snap-gene-0.4-mRNA-1 annotation:"tyramine receptor")

HSP 1 Score: 93.9745 bits (232), Expect = 1.503e-20
Identity = 59/184 (32.07%), Postives = 89/184 (48.37%), Query Frame = 0
Query:   88 LIIILAIFNNLLVVISVFRYHRLRHINNYFLVSLAVADLLVACFAMTFNALVEITGEWNFGYIICDLWNSLDVHFSTVSTLHLCCISVDRYFAIVKPLKYTSYMTVKVAAVMIGVAW---TAPTLISFLPIFLGWYTTKEHLEWRKQNPDECIFKVNQPYAFISSALTFWAPVAIMLCMYHRIY 268
             +I   I +N  V+ +V  ++ L+ I NYFLVSL+ AD+L+A   M       + G W++G  +C  W+      S  S  HLC I++DRY AI +PL+Y +  T K A  +I + W    A     +  I   W  T E           C    N  Y   S  +TF+ P+ IM+ +Y R++
Sbjct:  103 FVITFTISSNAFVIYAVTHHNPLKIIPNYFLVSLSCADILMASVVMPVALQYNLEGVWHYGLFLCKAWSFSSYFSSASSIFHLCAIAIDRYRAITRPLEYGTKRTTKQALSVIALVWFLSFAVVCPPYFGILASWPDTFEIT-------SPCTAAQNPIYVVCSGLITFYIPMIIMITIYTRLF 279          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005242 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-6.200e-7746.92symbol:Octbeta2R "Octopamine beta2 receptor" speci... [more]
-2.067e-7251.71symbol:Octbeta1R "Octopamine beta1 receptor" speci... [more]
-9.317e-6656.93symbol:Octbeta3R "Octopamine beta3 receptor" speci... [more]
-7.048e-4327.97symbol:Htr1a "5-hydroxytryptamine (serotonin) rece... [more]
-1.225e-4243.75symbol:HTR4 "Uncharacterized protein" species:9031... [more]
-5.610e-4228.38symbol:octr-1 "Protein OCTR-1, isoform a" species:... [more]
-1.767e-4140.95symbol:Htr4 "5 hydroxytryptamine (serotonin) recep... [more]
-2.014e-4141.48symbol:HTR4 "Uncharacterized protein" species:9615... [more]
-2.111e-4128.38symbol:octr-1 "Protein OCTR-1, isoform b" species:... [more]
-2.349e-4142.13symbol:si:dkey-247m21.3 "si:dkey-247m21.3" species... [more]

Pages

back to top
BLAST of EMLSAG00000005242 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592900196|gb|GAXK01058179.1|4.508e-8542.40TSA: Calanus finmarchicus comp287066_c0_seq1 trans... [more]
gi|592900195|gb|GAXK01058180.1|9.941e-8141.07TSA: Calanus finmarchicus comp287066_c0_seq2 trans... [more]
gi|592834516|gb|GAXK01123028.1|5.171e-7868.78TSA: Calanus finmarchicus comp2170137_c0_seq1 tran... [more]
gi|592956604|gb|GAXK01001952.1|4.491e-2352.13TSA: Calanus finmarchicus comp1920325_c0_seq2 tran... [more]
gi|592924274|gb|GAXK01034141.1|9.329e-2336.98TSA: Calanus finmarchicus comp1641236_c0_seq2 tran... [more]
gi|592924275|gb|GAXK01034140.1|1.253e-2236.98TSA: Calanus finmarchicus comp1641236_c0_seq1 tran... [more]
gi|592754415|gb|GAXK01199998.1|1.308e-2240.94TSA: Calanus finmarchicus comp3798148_c0_seq1 tran... [more]
gi|592833629|gb|GAXK01123915.1|2.738e-2227.80TSA: Calanus finmarchicus comp666680_c0_seq1 trans... [more]
gi|592799822|gb|GAXK01154746.1|1.117e-2139.55TSA: Calanus finmarchicus comp1768349_c0_seq1 tran... [more]
gi|592956605|gb|GAXK01001951.1|1.340e-2171.93TSA: Calanus finmarchicus comp1920325_c0_seq1 tran... [more]

Pages

back to top
BLAST of EMLSAG00000005242 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 22
Match NameE-valueIdentityDescription
EMLSAP000000052420.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s279:10364... [more]
EMLSAP000000030214.907e-3538.69pep:novel supercontig:LSalAtl2s:LSalAtl2s171:19662... [more]
EMLSAP000000114723.923e-3233.64pep:novel supercontig:LSalAtl2s:LSalAtl2s791:25681... [more]
EMLSAP000000079745.827e-3135.58pep:novel supercontig:LSalAtl2s:LSalAtl2s471:10570... [more]
EMLSAP000000094335.034e-2732.46pep:novel supercontig:LSalAtl2s:LSalAtl2s601:31744... [more]
EMLSAP000000017706.685e-2633.87pep:novel supercontig:LSalAtl2s:LSalAtl2s12:909316... [more]
EMLSAP000000048081.315e-2126.47pep:novel supercontig:LSalAtl2s:LSalAtl2s253:92104... [more]
EMLSAP000000036871.364e-2130.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1:1117397... [more]
EMLSAP000000119648.049e-2128.63pep:novel supercontig:LSalAtl2s:LSalAtl2s84:136858... [more]
EMLSAP000000077983.034e-1932.47pep:novel supercontig:LSalAtl2s:LSalAtl2s457:44439... [more]

Pages

back to top
BLAST of EMLSAG00000005242 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|77416550|sp|Q4LBB9.2|OCTB2_DROME2.817e-7846.92RecName: Full=Octopamine receptor beta-2R; Short=D... [more]
gi|75026733|sp|Q9VCZ3.1|OCTB1_DROME1.032e-7351.71RecName: Full=Octopamine receptor beta-1R; Short=D... [more]
gi|347595820|sp|Q4LBB6.4|OCTB3_DROME2.050e-6656.93RecName: Full=Octopamine receptor beta-3R; Short=D... [more]
gi|1169213|sp|P42289.1|DRD1_XENLA1.095e-4343.87RecName: Full=D(1A) dopamine receptor; AltName: Fu... [more]
gi|341940152|sp|Q64264.2|5HT1A_MOUSE1.570e-4327.97RecName: Full=5-hydroxytryptamine receptor 1A; Sho... [more]
gi|6224984|sp|O70528.1|5HT4R_CAVPO6.639e-4341.48RecName: Full=5-hydroxytryptamine receptor 4; Shor... [more]
gi|341940619|sp|P97288.3|5HT4R_MOUSE4.338e-4240.95RecName: Full=5-hydroxytryptamine receptor 4; Shor... [more]
gi|1706280|sp|P53452.1|DRD1L_TAKRU1.282e-4143.60RecName: Full=D(1)-like dopamine receptor[more]
gi|112812|sp|P19327.1|5HT1A_RAT1.295e-4128.14RecName: Full=5-hydroxytryptamine receptor 1A; Sho... [more]
gi|118251|sp|P25115.1|DRD5_RAT1.479e-4140.00RecName: Full=D(1B) dopamine receptor; AltName: Fu... [more]

Pages

back to top
BLAST of EMLSAG00000005242 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|EFA10770.2|2.848e-9735.83Octopamine receptor beta-3R-like Protein [Triboliu... [more]
XP_397139.29.774e-8556.39PREDICTED: octopamine receptor beta-1R [Apis melli... [more]
EEB10259.11.777e-8046.84class A rhodopsin-like G-protein coupled receptor ... [more]
EGK96733.12.049e-7949.44AGAP002886-PB [Anopheles gambiae str. PEST][more]
ALI30563.11.365e-7846.92octopamine beta2 receptor, isoform G [Drosophila m... [more]
AFH06396.11.365e-7846.92octopamine beta2 receptor, isoform E [Drosophila m... [more]
AFH06395.11.365e-7846.92octopamine beta2 receptor, isoform D [Drosophila m... [more]
AFH06394.11.365e-7846.92octopamine beta2 receptor, isoform C [Drosophila m... [more]
AAF54835.21.365e-7846.92octopamine beta2 receptor, isoform A [Drosophila m... [more]
EAA08033.52.278e-7857.59AGAP002888-PA [Anopheles gambiae str. PEST][more]

Pages

back to top
BLAST of EMLSAG00000005242 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|1004396063|gb|EFA10770.2|1.393e-9435.83Octopamine receptor beta-3R-like Protein [Triboliu... [more]
gi|909553094|ref|XP_013147964.1|1.482e-9138.99PREDICTED: octopamine receptor beta-3R-like [Papil... [more]
gi|910324442|ref|XP_013165300.1|3.549e-9138.57PREDICTED: octopamine receptor beta-3R-like, parti... [more]
gi|913318262|ref|XP_013190150.1|1.778e-9038.23PREDICTED: octopamine receptor beta-3R-like [Amyel... [more]
gi|930671454|gb|KPJ12181.1|1.790e-9038.57Octopamine receptor beta-3R [Papilio machaon][more]
gi|1009361458|gb|KYM86546.1|4.051e-8937.53Octopamine receptor beta-3R [Atta colombica][more]
gi|298106408|gb|ADI56273.1|2.468e-8838.94beta-like octopamine receptor R2 [Amphibalanus imp... [more]
gi|1059521033|gb|AOG14368.1|3.079e-8740.22octopamine receptor beta-1R [Cancer borealis][more]
gi|939236302|ref|XP_014255138.1|1.230e-8640.04PREDICTED: octopamine receptor beta-3R-like [Cimex... [more]
gi|943959280|ref|XP_014362283.1|1.238e-8638.57PREDICTED: uncharacterized protein LOC106713896, p... [more]

Pages

back to top
BLAST of EMLSAG00000005242 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
snap_masked-scaffold28_size608977-processed-gene-2.64.582e-13860.00protein:Tk05745 transcript:snap_masked-scaffold28_... [more]
maker-scaffold301_size216225-snap-gene-0.192.753e-3526.75protein:Tk06226 transcript:maker-scaffold301_size2... [more]
maker-scaffold114_size351134-snap-gene-1.136.358e-3537.14protein:Tk09545 transcript:maker-scaffold114_size3... [more]
snap_masked-scaffold120_size336265-processed-gene-2.74.182e-3339.68protein:Tk08790 transcript:snap_masked-scaffold120... [more]
maker-scaffold1621_size33243-snap-gene-0.94.239e-2936.08protein:Tk12270 transcript:maker-scaffold1621_size... [more]
maker-scaffold575_size133042-snap-gene-0.311.473e-2730.61protein:Tk10163 transcript:maker-scaffold575_size1... [more]
maker-scaffold109_size355148-snap-gene-1.253.155e-2424.09protein:Tk11033 transcript:maker-scaffold109_size3... [more]
snap_masked-scaffold235_size242898-processed-gene-1.71.392e-2235.42protein:Tk06561 transcript:snap_masked-scaffold235... [more]
maker-scaffold633_size121756-snap-gene-0.271.495e-2033.33protein:Tk02266 transcript:maker-scaffold633_size1... [more]
maker-scaffold268_size230776-snap-gene-0.41.503e-2032.07protein:Tk11092 transcript:maker-scaffold268_size2... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s279supercontigLSalAtl2s279:103641..347799 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionsnap_masked-LSalAtl2s279-processed-gene-3.3
Biotypeprotein_coding
EvidenceIEA
NoteOctopamine receptor beta-2R
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005242 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005242EMLSAT00000005242-701089Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s279:103641..347799+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005242-688008 ID=EMLSAG00000005242-688008|Name=EMLSAG00000005242|organism=Lepeophtheirus salmonis|type=gene|length=244159bp|location=Sequence derived from alignment at LSalAtl2s279:103641..347799+ (Lepeophtheirus salmonis)
CAGGGAGGAGCGCTTTTGATTGCTTCAATTACAATTGTCAAAAAACTCTT AATTTTACAGACATAATAGTGAAACGTGTGTCGTTTATTTTATAGATCGT TATGAATTAGTTTTTGAGGAAGAATAGTGATGGAAAATAAATGAGAATAA GGTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTCAATTATTGAAACGATATATATWAAAAAAAT ATTAAAGACACATTTTTATATTTAAATAGACTGTCCATCTCAAAATACTG CAAATAAATGCCTTTTGCAAGATTCAATCAGATGCGTATGGGATCAAAGC CCCTTTATATCCATATTTTGCCTACATGATTACGTTTTAAGTGACTCAAA GCCCTGCCAATAAACATATATTCCCTACGTACACCATTTATTAAGATAGG ACAAAAAATTGTAATGAGTTGTGCTATTTTTTTAAATCAAATTATACTCC TAAGGTCTCTGCAAAAACAATTATTATTGAGTGATTATTATGTTTGTAAA TGATTTTATTGAGTGTTGATAGTTAACATTTAGTTACGTATACTATTCAT TACGTGGTTAGAAAACGGCATAAAAAATCAATATCAATTACTATGGTAGA ATTTTTTTTTGTTAAATTAATCTTAAGAAACAAGATGAAATTTGTGAGTA AAAAAGTATTTTTTTTCGATAAAAACTTTAACGAAACATGGATCATTTAA AAAAAATTATGCGTAACAAAAATGTGTTTATTAATGTTGAAGAAGTGCAC TGGGATATATGTATAGAACAACAGCTGATATTACATTATTATCAATGCGT ATATCTTAAATTGAAAAAAAGATTATTGGAAAAGCAAAATAACGACTTTA CCTTTAGAAATTAATAAAATTCACCAAACCTTTATTAAAAATTGCAAAAT TTAAAAAACTATTTCCAGGAAATACATTTTTACAATCTCAAATACTATAT TTGTAGCAATTTCATAAAATATGGGTCACAGAAAATCCCAGTACACAAAC AAAGATTAAGAATGTTTGATAGTGATATTTAAAAGTAATTTTTATTTGTG ATGTTGAATATGGAAATCTAAGTGTTAGTATACATTGTCCTTGAGTATTA GTTGGAGTTGTACGTAGTTGAAGAATAGTCAAATATAGTCATATTTTCGG TTTGCATTTGTGATGTAACTTTGTAGAACATTTACAAAGTATTATCTAAC TAAATATGTTAAAACACTATGATCAATCTTATAATTTGCTTTAAAACTTC CAAAGAGATACCCAAATGCTATGATGCTCAACAAACTGCACAAAAACAAG TAATTGTGCTGTTAATCATTCATAAAATATAAGTATACTTGTTATATATA TGATTTTGTTTTTTATATAACTTGGTTCGAAAATTGATATGTTTCATATC AATTGAGTAGAGAAACTTATTTTTTGGGTTGTTTTATTGTTAAAAATAAG TTTACACCGTGTACAAACATATTTAATGAAATATATTATTTGAAATAATT TATGATTGATTGTTCATACACTTTTACGACCATTCTTCATATCAGTATAT GAAGAATTTATATACTTAAACTGTCAGGTATTCTAAGGAGTCTTTATAAT TACCTAAGTCAAAAAAAATAACTACAAGACTATAATTAAACAAATAATGT AGAAGATTGTATCTTATATTTTAAATTATGAAACACATTCAAAAAATGTG NATTTAGGGGTGGTACGATACGGAGTTTMTTAYAATMAWAKATGAAATAT TTTGATTCTATAAAATTTGGGTTATTTTTATAAAATAATAGATTTAGATA GTTATATAAGATTTTAATCCATAAGCTTCCTATAATATAAGGAATTATTT ATTTAAGCAAAAATAAATAATGACTAACAAATTTATAAAATACATCACCG TTAACAAAAAATCCAGTAGTTTGGTGAAAGGATAATTTTATTAAATTTGC CAATGTTTCCAAGTTAGTTTCACGATATCTCGCTACTATATGTGCATCAG TATCAAGCAAAATACGTTTTTCGAAGGCTTGCGATATTGTGACTGCTAAT TGGCTTTGTTTATTAACAGAAAATTTAAAGAAGCTCATTTTTTACAAAAA AAATAAAAAAATAAAAAAAATAAAAGTTGCTGAATAATAGTGTTAAATAA CCTATGTATATTTGAAATCAGCTCTTTTTTTTTAAAGAAAAGTTAAGTTT ATTTGGTCAAAAAATAAAAGATCTAAATAACACTTGAAAAACTACATTTA TCTTATTAAAAAAACAATTTTACAAAATACTGTACCGAATGGTGTATCGT TCTATCCCTAGTAATTGTATATTAGGACTCTGTTCCATTTCAATTTTTAC AGGTTCAGTCTTAATAAAGGTTGTCTTCACCGTTTGGGTTCATTATTAAT GTAGAATATACAGTCTAAGACCATTGTGAAAAATTATTTATTTTCATAAA TGGGACCATTTTTTTACCCCGCTATATCAATTAAAAATTTTTGATTTGAC TGTATGAATCAAATTTTTCCTAGGTCTCAGTAAATAAACCAATTTTTTTT CTCATCTTAGTTTTGCAAACTGCATTAAATAGAATTAATAGTACACTGAT TCATAATATTTTATATCATGAATCCTTTTTAAAATAGGTAGGTAAAAGGT AATGTAATATTTGGACTTGGTTTAGTATCGACTTTTACTGGTTCAGTCTT GGTGAATTTATGTTGACCGTTGGGGTCCATTATTTCTTTAGAAAATTTAA TCTCAGACCGTGGTTTAAAATTATTTTTTTTCAAAAAAGGGACAAACTTT TTGATTTCATTTTATAGATCACACTTTTTCCCAAGTCTCACCATATTAAC CAACTTTCTTCTCTTCCCAGTTTTACGAGTTGCTTTAAATGTTGAACAAT TTAACCTTCATAACCATGCCCTACTCAATTAAACGAGTTATTTTTACGAA AAAAAGATTTATAAATTGAAGGTAATATTCCATTACCTATATTTACAATT TTCAAACACACATGACGTCATTTATAATACTAATGGTCTAGTCCAAATCT TAAATGAGATTGATCAAAATTGATTTCTCTTGTGGCATCGATCTAAGCCA AAGTTTTCTCTAAGACCAATCTAAAAATATTTTTTCTATAAAACCGATCC ACGTCAAATTTATGTTAAGTACCTAAATATATCTACCCACCAAAAATTAA AACGGTCAGAGACCTGTGTCCAGGACGTACAAGCTAAAACTTATCACCAA TAAACATATAAGCAATTTGATTTATTTATTTATTTGTGTATTGATAAATG ATGACTTTTGACTAAGTTTTTGCAAAAATATAACTGTMCCTTTGCAAACC ATTCTTTAGAATTGTATAGTATAAATGAAAATTTTATATATCAATGGATA TGTACTATGAATAAGATTCAAATATAGAATGATCACTCAATTTGAGTTGT ATTTTGTTTAGATAAAATATTAATGTCCAAAAAGGTATTTTCTATAGACT AATGTAACATATATATAACATTATATATTATATAAAATTAAATATATAGA TGATACAGGCTATTGAAAATATTTATCAACTTTCTAAATTGATTCTCAAT ATTGAGTAAAAATATACAGACTTAATATTCAATATTATTTCGTTTAAATT TTAATATTTTAACATATTTTTGTATATCAACAAATGAAAAAAAGGCTTAT TCTATCTATATGTACATAAATAATTATACATTTTTACTAGAAATAAGTAA TTGAATGCTTGTTAGTAGATATATAATTCATATCAGATAAATATGTTTAG GGTCTTCTTGGCTCAAAAACCATCTTTTTTAAAAAATACAAAGAAATGAT CCTGAACACTTCATTACAGTTTATATGGTTATAAAAGATGTTTACAAATA ACGGGACGTCAAAATAGCGTCCTCATACTTGTTGGTAGTGGTATCTCTAT TATCCTACCATGTTAATCAGTTGTATCTTTTTGCTCCCCTATTTTTTTCA GTTGTCAACCTGTAGTGTTCATAAAATGCTGTTATTATTATCATTCCTGT GGACTGAAATTCCATTTCTACTATATAAAATCTATCATGAGTCTATATAA AAACCTGATAGAATATTATGTGTGTATGCGCATAACAGAAAAAGAGTAGC CCTAGGGGCTTGTTGCAGAGTTTTAATTGTAAGTGCTGATTGGACTCGGC GTAGAATTGAGGACTGACATTGGAAGAAAGATTGACTTTGTCGCAATTTA TTTCCTACTCCAATTATCCCTCGCAAGAGCTGCTTAGAGCTGATATTATG AAACTTCATGACATCTAAACATCCTTTCTCTAAAACAATAATCAAATTGT ACGGGTTACCATGTTTTTTTTTGTGTTTCTTTAACATTTTAAAAATGTTT CCAATTAGCATCTGTAGTCATCTCTCTCTAAATAATTGTTTACCAGTTTT GTCTTCAACTTACTTTTCAGACGGCATTGTTGTCAGCTGTTTTTTATATA ACTTATTTTCTCCAAATCTGTGTTTTACATGTTGATTTATTGAATTAGAA TTACTTCTTCTTGTTAAGCTTTGAACAATTTGCAACAATTAATACATAGA ACTTCTGTAGTTGGTAAATTGACAAAGTTTACATCTTTTTTTCTGTTTTT TTTTTTTGGTTGAAAGGTTGCTAAAATCAATTAAAATAACGATGCAATCA ATATTTACTAATATAACAATAAAATTACTAAGCATTCAGCTACCAGTAAC TTATAGTTTTTATACTAAATTAAATTAAAAAGAGAAACCAGCATCATTTT GACGTCCTAAATTATTGTAAAATAAAACTAAGACATCAAAGCCATAAATC TTAACGATTATCCTAATTAAAGTAAAAAAAATGTAACTTTATGAGTGGAC AAACACAAAATCATTCTAGATATTGCATAATATTTTGTTACCAGTTTGTA GTATTATACTCTACGAGCATACATAACCTAAGTTTATATAAAAGAGTCTT ATACCTACATACAACTACACAGATTTAAAAAAAAGATGTAAACATTAGTT TGAAATGGAAGACTTGAAAATGTTATAACACATGTTTAGTAGTTATACAG AATTATTTCTTCATTTTTAAATGTTAATTTTTTTTAAACTTCAAAAGTGG AAGAAAAATACTTCCTTGGGTATTGAAAAATTCTTGAAGATATTCTTTAT ATTAATGTGGAATTCAAGTGCAAAATTTTGCAGTTCTTCGTTGAATTAGT TTTTTTTTTTAGGACAAGAAACAAATTTTTGAGTTTGATTGATTTCGAGT TGTTTTATATACCATCTATAGTAATACGTAATTATCCAACCCAAAGAGTT CTTAAAAACCTCCTATAAAATAATGTCATTTTTTTTTTTTTTTCAAAAAA GGGAAATAATTTAGGAAMAAATCTRAMAAGCCAGTCAGCCCTTTTTTGGG GGGATTCATTATATTGTCTATTTGAAATAGTTATTATCATATTATAATGA ATAAAAGAATAATATCAAATGTCAGAGATCTCTTAATTGTTTTATTTTAA CTGTTCTTCTTTTTTACTGTAGTATAAATTTTTCAATTACAATTTATACA AATAATCTTAAAAATATTTACAATTTATACAGATAATCTTAAAAATATTT ACAATTTTCAAAAACAGGAATACATATATACCATAACAAAAATTTTAACT CCTTAGATTCTTAAGTAAAATATGAAGAAAAAAAACAGGTACAACTTTGA TTTTACAAAGCAAGCGCGTGTGTGTAAAATATATAACATATAATTAATCA GACAATCAAAGAAGACAAGCTAAGTGTATTAGAGAAGGGTCATCATATTA ATGTAATTTACCAATGGTTTTACAATTAAAGGAGTGGAATTACTGCTGCT CTGTTTATGTTGATAAATTGATAGTAGGATATCTGTTATTAATTATACAA TCCAACTTCATATTTTCATCCACTGCCGGATCCATCATCAACTTATTGCA TTGGATGTCTCGAGTTGAATCTCGAAACATACTTCCGTGGACCACACGGA ATGGGACTAAGTTTAAACCTTGCACCATAGAAGATACCCTGTACTTTTGA TATGAGGCCCTCACTATTCTCTGACTCCACGTATTTAGGGATGTAGCGAT GAGCCAATTATTCTTTTAAGGAATATTACACAAGATATCTCGTTTTTTAT CTATATTCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNCTTATAAGAGTATTTTGTTGGGGGGGGGGGGGRKGKWYT WTGRKGAGATMAAWAAAAWKKGANTAGWAAATGKAGTATAAAATATAGTC AATTTCCAGCWGCATCAAATTGGAACTACTCCGATCTTTCTCGACAACAA AGAAACATTCATACTATAGTTTTTAGTATAATAGAAAAATTCTGAATACA TATTTACTTTTTTATTATTTTTWMAAAWTATTTGGACTTTTTTTAATGTG ATATCCTCGGCAGAGCAACACCGGGGAATCTTTCCTAGTAGAACCCATAT AATACCAGAAAATTTATATACGTATTATACAACCGGGGTTTTTTAGGATC AAAACTAGTATTTGTAGCTTTTTTATAGCAATTTTGAATGAATTAACCTT CATTTGTTGAGAATATAGGAACTTGTCATAATCTTCTTATTGTAACACTA GTTTTTATGTTGTATAAATATGTATATAAGTTTTTTTATGGTCTAATTGA CCCATTGGTATTATAGGCTATTTTTGATCATTAAAAGAATTTTAAATACA ATTTAACAATAAGGAAATGGAAAATCTGTCTTAAATATAATATCAAGAAG CAAAAAAAAAAAAATCTCTAAGTCATAGTTGCCTGGGTTGAATATCGAAA TTAGACAAACAATGAAATTTAAAAATGAGTCAAATAGACCTAGATTATAT TTTATTAATTAAACTTTAGTATCCAAAAGTATGGTAATTACCACCACTGA GGCACTCTGGAAACCATTAAATTTCTCCTGGTTCAGACGTCTACTTAAAA ACATTTTTTGGCGTCACAATAAAAGTTAGACTCACGCAACATAAGGGTGT CAAATATAGTGAAAGGACATTCATAGGGCCAACCGAAATTATTCATGTCG TCAAATAAATAGAGGCCACATGGTCGTACATGGGTTGAGCTTGCTATTCT ATCATGCTTTCAGTCCTCCCTCTTCTGGATACAAACGAACTGATAAATTA TTATAGACGTTCCGACGAAATCTATAAATCGACCGGATTTACCTCAGTGG GATAGTTATGGAGCAGGTTTTCGCCACTAGAGTTTCTAACTCTCAGGATT TAAAAAATAAAACCAGATTCTCGAAAATTGTTATATTTTAATTTTTTTTA AAACACCTCCAGCTTCAATTTCAGTATTTATACTAGCCAACAACGCCAGC TGGCTTTCTCCACTTGATCCCTTGTCAAGTTTCAATCTGGCGAATTTGGA GGCTAAAAGTCTGCCAAGATGAAGTAATCGAAATTGTCTTGGAGCCATTT GATACTTTTTTTGGGTGTGACAGGTMCCTGAGMCCTSCTGCCACATTTAA TTCCTTCCCTTGGTAGTCATCTCGATTCAGAGCTTCACTTTTGTCTCTAG TACATCCAGGTTGGCATAAGCTGCTTGTTGAACCTGAGGTGTTGGGTGAA CACATGAGGAGGAAAGACGTAGGGATTTCATAGCTAACCTCCCTAAACAC CACAATTTGGGCTTGGAACTTCCTCTGAATGACGACGGGCAAATATTTGC CACTAAAAGCCAATCACTTGTTGTTTTGTTTGTTCACCAACAGGTAATAG CAATAGTTTTTTTTTGTCTTTGAAAAACCCAAGCATGCCTGAATGAAGTA GGTGATTGAAGTAGTTTTCGGAGTGCTTTAAACACGTTTCCTTTTTTTTT GTTTTTTTAATCGGGCCCTTTCTCATCTTGTATAAGTAGTAACGAAGGTT TTCGTGAATTCAGAGGCGGATCAGCGACTCTGACTGGTTACCTTCCTCGT ATCTTCATTAAAGATTTGCTGGATTCTTGTCACAAATTTAGGGGTCGGAC ACTTTATCTTTGACATTTCATCTCATCCCATATTTATTGCACCCTCAAAA TAATCTATAGAGGCCTAAAATTCTCTCCTAACCTTACAAAAAAAACGTCT CACTAAGTCTCAGAGTTCAAGCAATTGGTATGTTGTCACTCCCGACGAAA ATTACAAGAAGGCTCCGTCCCATTTCCAAATATTTAAGAAAACAAGTTTG TCATTGATTCCATTTTTTCCCAACTATATATTTATGCCATGAATAATCAT ATATAATGAGGATCTGAATTGACACATAAAACATTAAAAAAAAGTAAATC AAATTCATAAAAAAAATATTTTTTTATAATTTGGTAAATTAGTATCAATA TGTATCAAAAAAAATAAATGCATCCTTAATAATTTGGAAAGATTTTTCTA AAATTAGTATAAATATTAATATCAAATATACATCCCTTGCAACATAGGCA AATTTTGCTACGCCATTACTTTCTGAGTTTTTAACAATTTATGAGGTTTG AAATAATTTTTTAATGCGTTCATAGATCCAACCCAACGATAAATAAGAAC AATGGACATAAAAGGGGAGTTGTAGATCTCTTTATGTATCCAACATGTCA CTATTTGAGACAAAGTTTTGCCTTGGATTAAGATTGTTTGTTTCTGATTA CTTTCACTTCGAAAATTATGAAATTATATTTGCAACACAAACTTTCTACC TTTGTAGCCTACAAAGATTAACATTTCATATACTGTCAATAAATCTTGAT AGTTATTTTAATCAAATCCTCCATTTTTTGTGTCTATACTCTACGTCAAA TTGTCATTTTGATCATTACTCTCAAAAATAACAAATTTATTGGACTTTTC AAAAGAAGATCCATGTATTAAAATTTGTTATGTACTTACAAGGCATTTTC TCTGATTCAGAACAAAATTCAATGTATCTTAAACCAATATTTCACACTTT TGTATTATAATTACATATTTCAATGCAAAAATAACACCGAATCATTTATA TTTAAAAAAAATCATTTGGAAAGGGACATCAGTCTTTTTATTTTCTTCTA CTATTGACATTGCGCGTTAGAAAACTATAAAAGTATTGTTTTTTTTATGA ACCTTTCAGATCCTAAAATTGGAAATGAGCAGCGTTATTTAGAAATATAA TCTCTATTTATGATCTGGACTATTATTTTTTATTCAATAGTGGAATTATT TTTCCCAATGAAAAGAGCGGCAAACGTAGAGTTCTTTCCAACTCTGTGAG ACTTATGAATGAATTTTTTGTCCAACTCTGAAGAACATACAGATACAATA TTTGATGAATATTTAAATTAGTTGATTGACCTAAAACTTGATAAGTTTTA TATCTAAAATATAGGATGAAAAAAGATTTACTGCCTAATTTGAAATATTT TCGTGTTGTTTATTTGTTAATTATCCCAATAAGGACTTTAGCAAATTGTA CATTATAGTTATTCATGCTTTTAAGAGTTGCCCAGCACTCCAGATTTTCA AAGATTTTATAACACTGATCATAGCAGGAATTACACAAGAAAATCAAATA CCATTCATTTTATTTAGTGTCTCATTAAAAATTCAAAGTCCTGCTACAAA AACAGTAGCTATGGATTTTGTCGTATCAAGCTGTAAAAGATTGATTGCAG AGAAGTTAGTAGTTGTGGAGACTATCAAAGTAAAAGTAATCAGAGTTTTT GTGATTACACCCAAAGCCCAATATTCAGCCTTCCCTGTTTATATTCCAAG GGGGTATACGTCTTCATGGAACTCTGCAGGGATATAATACACATTTACAC CTCATTTTCGGATAAAAACTTAAAATTTTTGCAATGAATAATACATCATT ATAAAAAAATTATAACAATTCCAGATTTATAGAATAATTATTGTAGTTAA TTTATCCTTTTATTTAAAATGTTATGGAACGACTATTTATTCTTTTGCTA TGTGTTTGGCTTTTTTTTTGTATGTATATAAATTTATTATCAATTTTTTT AGAGGGAACCTTTTGCTGAGAATGAATCAATAAATAAAATCCTATACTGA AAGCTATTTCAAGACGTGTGTCTTTGGTTCAAATAATTAATTTTAAAATA AAATTTATATGGATATATCATTTTTTTGTATGTTCCTTCTCTAAATACAT AAAGTCAGTGTAAAATAAATCAAAATTACACCTGGTAGGCTAAAAAAATT GAAATTTAGCTGACTAGTGTTATGAATTCATTGGTGTAAAATAATTGATG TTAGGGTGACTATATGTACCAAGGAAGTACAGGTATAAGGATTTGTATGG AACTAAGGAGGGTTGAAGATATAATAAGTCGACTGTCTTTCTATATATTT TTTAGCTTATTTCTAAAAGACGCAAATAAGAAATATATTCTTAATTAAAT TACTATCTGTTTTCCTTTCTGAAGCTCCACGTCGGTTCCCTACATGAACA ATACATGTAAACGAGTGATGCCTTTGATAATTTATTATCTGGAGTTATAT GTTCGTTTTTTTTGAAAAAAAAAATCTTTTAATTATATAACTAGAATCAC TCTCATTTATTCCAAGTATTTTTTTACAAATGAGCAATTTACAAAAATGA TCAAGTAAATCTGGACTATCTTTAACTGCATCCAGATCTAGTTGAGGTTT GAAATGTTATTTGCAAGTTCTTATAATACAAAAGAACAAATTCATCAAAT GTGGTTGACTGTTTCGCCCATAGTTTGCTCAATACTAGGACTATAGGATT TGCAACCCTTAACCACGTCTACGGGGAAGACTTTTTTCCAGTTTTTGATG ATAGAATTCTTCTCGAAGAAGCAATACATGATGTAGTTAGATGACCAGAT GTTTGAGTGTCACAATAATATTTTCTCTTCCTGAAATTAGTTTTGGTCTT ACGGTACTTTTGAGAGGGCCCAGACTTGTTGAAACAGGAACTAAAAACCA TTGGCCTCAGCTCTCTTACAAGGTATTACCTGGAAAGACAAGGAATTTAT AGTAACTTTTGGCACACACCCTCTCCTTTGGGTCAAAGAAGATGGGGGAA TGACACTACCATTTATTCTAACGAACCTAAAGGGTCAAGATACAGCCCCA AAACATAATTTTAAAGAGGTGGGGGACATTAGTTATCTATATGGCCAACC ATTTTTCGTTTTAGAGGATATGGGATCTGTCCACTGTCAATTGTTTCTCA TCCAAATATAAGATAATTCAGTTACTATGAGATTTCAAATTATTCAGCAA TTTTCTTCTTTGGGCAGTTAGGTGGCAACACATTCAATATTTTCTAGCAC ATAATAGAGGTTAGATGACCACTAAAAAAGTATGTATGTTGTTATGTTTA GACGATTGTCATGATGGCGAAACACGATCATTCATCAATAGGTTATAGAA ATCCAAATTGTTGGAATTAATTCAGATATGGTATTTAGCACCAACTTTTT TACCGGTTATGGAAGATTAAAAATTTTACGATCGTTTTAAATCATAAATT TATATGGTAATTAAGAATATTGACATGTAAGAGTTGAAATCAGATACAAT TTATGTAATAACAACGGATTCAAATGGTACTCCATAGCATAATACAGTAT TGAGAGTATAAACATTTCTCATTTTCTTTGAAAAAATGTATCACAGAAAA AAAAAGTATGCCAGATAGGGTACATCCTTTTTTTTAACTGCATATATACA TAAAAGGTCTAGTAATGCCAAATCAAAAATTGATTGTTAAATTAATATAT TTCCAATGGAAACGCCGTAGCTTATGGACTATACAGTCGGGGAAAATTCT TCTCCTGACTTCCATCTGCGTAGATTTGCGCCAAAGTGAGTCCTAGTGGA ATATATATACTTTATATATATGGACTTCATACAAGATTCCTAGGTTAATT TGAGTAATTGTAATGCTACAATGTTTACTTATACTTCATAAGTGTAACTC CATCTAACCAATTAAAGGAACATACAAAAAAAATAATATTTCCAACTTTG AAACCGATTTATATTTTGGTTATTTAGTAAAATAGTTAACACATGATATT TATATATATGAAGGCGATATTTAAGTAATATCATAAAAAAGTTATCCTAC AAAATGACCATGTTTTAAAAATTTATTTGGTTTTGAACGAATGTGAAAGA AAAAAAGTACGATTGTTCTTGAAACTTACACTTTTTTTCAACTTTTTTTT CGACCAATTAAGGGCAGTTTTTTTTATGTTTCCATAAATTGAATAGTCAT TCAATGTTGAATATTAGCAATTGTGTATTGAATGTCTTAAAGAATTAAAA AATATTTTATTAATTAATATTCTGATGAGATAAAATAAATAGACCTAGTA AAAACAAATTATTTGTCATTCCCATTTTGACATCTTAATACACTGCATCA TTTTTCTTGTATGATAATCTGGAAAAATCTATTTTAAAATGTGATTAATT AGGGTTCTAAAATAGCCTACACCGATTATACAAATGTCATATGAAAAAAC TATATTGTTCCCATAATGGCAGCAAAAGAATAAAATACCAAAAGAAAGGT TCAGTTTAACAAATATAAAAAATCAAAAAAAAACGTATCCCTTTACAATT TTCTAACAAAAGTATAAAAAAATTTCTAAAAAAATAACAAATTAATTTTT TTCTAATTCCTTAATTCGATTTTTAAACAAAAGTTTCACATATATATGTT TTTTTAAATGAAACTCCTTTTTAAGTACAATTTTTTTTAGGAAAAGTTAA TTTTTGTCTATAACATACTTATTTCTTAGATTAATAGTGATTTTAATTGT TTTATAACTGTAAATGTTAAATAGATTGTAATATAAAAATAATAAAGTAA TGTTCTTATTTTATATTGTTGTGTATTTATAAATAATTTATCGGCCCTAA AAACTTGACGTCTCAATGAGCCCCTTCCAAAAGCTTAAGGACTTAAAAGG CATAAATCAAATAATCCTTGCCTAATGACGTTATTATCCATTTGTCTCAG ATATTTGAAGTTATTAACATCCAAAGCTAATTATAAATAATTTAGCTACG TCTTAAAAAAAAAATATCAAACCGTTGCCGTAGATGAATGATACTTCAAG TTTTACTAAACAAATCCAATTGTTAAACTGGCCTAATTTGGCACGTTTAT TTAATATTTGTGATTGAAACAAATATATATTAAGACGAACCCGTATATCA AATGTATTATTTAAGGAGAATGTGTCAAACTGCAAGTTGTTTAACATTTA CAATATCCCTATCAGTATGTGTGTGTATTAATTACTATGATATTGTATCA GTACAACCTTTAAATAGGTATTTAGAATATTCAATAGCACAAACGAGTAA TGGTGTATTGCATTTTATTCTTTTGAAACTATATTTTATCGCCAGTATTT TTCAGCATATTTCTATAAAATTATACAGTTTTTTTTTAATTCATAATTTA TCCTGACAATGCCAATGACAATTATTTGTTTATTTAGTCATTTTCAATCG ATTCTTAGTTAATTTAATGTACTGTTTTTCTTAAAATTTGTTCTTTTGAA TACTTCAATTCTTCTTCTTTTCAAATTGAAGACAGATACAAAAAATTAAT GTTGTAACTATTATTTTACATTTAACATGCAAACTCATCAAAACTTATGA GTGCTAATTGGATTTCTTAAATTTGCAATAAATTATGAATATTTCATTGT CATTTTTATCAGATATATAAATTTAATATTGTTACTATTAAAATAACAAA TTATATCTTTTTGAAATACTAAACTCCAGTTGCTAAGATTATATTCAAAT TAAAGTATATTTTTCAACACGTTATATATTAGTATAATTATTTTAATCAT TTTGATTGATGTTTACAGCTACAGATGGAATAGTTTCCAAAAAAATTCAG AATTTAGTTGATTTTATTTGATGTAATCTTTTAACTGCTTTTTTTTTTTT AATGTTCCTTTAATTAGTTTGATGAAGTTGCACTGATTAAGTATATATAC ACATTATAGAAATACATTTACGCCATCTAACCTAGGAATTTTGTTTGAAA TCCGTATACATAAAATATAGGAGAAAGTGACAATCCTTGTTACGAAGGAG ACATGTTTACTGCCAATAACTTTAAAATGTAAAGTTATCTAACCACCCTG TTCTTATGGAATTGAATGACTTCCGTTATTTATCAAAGCAACATAAAATC CGGCTTACCTAATGCCTACAGTTATAAGCCTACAGTTGAAATTTTTGACA CAAAAAAGTAACATTTCATGTATGTATTTGTTGATATATATTTCTATTGT CATAGTCTGGCATGTTGTTCAATTAGTCAACATGTTTGTCATATAATATA TCATTAGTTTCAATATTCAGTTCACATCATTTATTCTAATTCCAACATTA TGGAGGAATCTTGTTACACCCAATTTTTATTATAAATACTATATATATTT TTTTTTTAGCAATTTCATGTTACACATTAATTATTTATCACATTAAATAG TAAAGAAAATGTTTGTTTAATTTTATTATTAACTATGCTTTGTTTCTGTA AATGTTATATTTGTTTATCTTATATATGTAATTATAAGTATATACTTTAT GCTCACAAACTATAATAAAAAGTAAAATAAATGCTTGAATATAAAATATG GCAGTTTTTACATGTTTCCTTTTGTTGTGTCATGTTTATTCCCACCCTGT ATCATGTCTCCTCCTACCCTGCATTATGTCTTCTCCTATCCTGTATCCTG TCTCTTCCTGGTGTATCAAGTATCGTAATTTTGGTCAGTTTGGAAAACAC CAATAAATGCCTATAAATTATTGCACTATATCAAAAATGCTTTGGAATGA TTTGTCTTTGGTAACTACCAATATCATGTTGCCCGGGCGAAGAATTATCT TTTAAATTGTGAAACTTATGACAGTTTTTTTTTTTTGTTTTTTTTGTTAA CATGTATCCTCACTCTTCCCAATTTCTTTCTCTAGGAATTACCTGGGCGC AAGCCTACGCTCAATGAGTTCAAGGGAACAATTTCTCGTGAGCGTATTGT CTATGGGCTTTAGCGATTCCATTGTTTATTTTTGTAATTAAATACGTTAT TTTTCGGTATTTTTTTACCCCAAATCACTGCGTTATAAAAATAATGCTCT GTAACGGATGATTAAAATTGCAATTTTTATATTTATTCAGAATTGATTTA TTTGTAAATAATACCTTATGCATTTTGTCCTTTATTCCAAGGGGGTATTA GACGTACCTAGTAATTTCCATTTTCCATTTTTATTAAAGATAATGTTCTT TCTTTTTGTTCAACAATAATCACTTATCTTAAATAAACAGGGCTAATGCA ATTCAAGAGGCGTAAGAGATTGAAATGACTGTAAGAAAATAGAATGGCAT GATAAGTATCAAGCCAACTCAATATATGTTTTTTTTATTATTTTAACTGG AAAAATTTTATGTGCAAAAAAAAAGATACACCTGAAAACAGGAAAGTTTA ATATCAAAATAAACAGCACAATACTTAACGCTATGTTTGTCATCAATCGT CTACTCCTATATCTCAAATCATTTAGCGAATTAAAAAAATATAAATTCAG TTTCATAAAAATAATATTATTCATCTGTAAATGTATTTCATTGAAATGAT TTAGTATAGAAATGGACGTATTATACCCTTAAATCAAACAAAATATTATG TCATTAAAATTACAATACAGAAAATTGTAATGAATGAATTAAAGTAAATA AAATAAAGTTTAATCAAATCATTTTTCAAAAAATATAAGTCTGATAATAT GAAATAATAAGATGTTCAGGATAGTCTATTTAAGTTTGAACAGATATTTT GTAGGTCATATTTTTCTTGGAATTAAGTACCACTTCAGTTAAAAACTTAA TTAATTTAGTCCATCAATTGATGTATGGCATTCCAACAGCTAATGATTCA AGTATCAACAGTTTAATCATGGCAATCGCCTATAATATTCTTCAAAATAT GATTTCTGTTTACAGTTAAGGGCAGGAAGAGATCTAAATGTCTCTAACAA CTCATGGATACTTCAAAATCAAGTGTGCACATCATTAAATATCACTTTAA CCCTCAGACCCATGCTTAAAGTCCTTATCCATCCCAACTTAAGATTGAAG TCTCCAAATATCTTTTCTTTTTTAAAATTTTTTTTCCKAATCAATGGATT AGTTTACAAATAATTTGTAAAATCGAAATNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAATAGAGGCAGTATATTAG ATGTAGGGTAAAGAAAACCTTAGTTAATTAACAAAGGGTTAATTAATGCT TTCAGTAATAACTGCAAAGAATAACTTAAGATTAAAAAAAAAAAAACTGA CATTAGGGAATGAAGCATTAGGGTAACTAAGGACTAACATGACATAAATA TGTAATTTGAAGTCAATAAAGCGCCGGCTAAGAAGGGTAGGCGATTATGA AATCTTTGAAGACACAGTGTGTCACACTTGCAAATGTGACACAGTGTGTC ACATTTCAGACACTTCAAGAAGATCGTTAAGACCAAAGGCAGCTATTCTA TGGACTAAATCCTTCCACAATTTGCATTGTAATAAAAGTTTTTTCCTGTA GGGTTTCATTTTTGCCAAAAAATTTTAGACTTCCCTTTGATATAACTGCT TCTAATTGGAAGAAACTGGTGATTTAATTTGTAAATCAAATACATGCGAG CTCTAATACATCTACATATTGTTACATAATTCAAGTCGTTAATTTTTTTT CTATGGAGTAATTTAAACTATTTCAATGCGTGTTTATCAATTTGATGATG TCCATTAAATATTTTTATTGGACGTTTAATGAGTACGTATATATGTATTG AAGTCAATTGGTCTATACTAAAGTTTTATAGACTTTGAGTTCTCATGTTT TATATTTGAAAATTGCTTATAATCAAATTTGTACATCTAATTAGTCCATT TAAGTTTTTATGTACATAAAACAACTTTTAAATCAAATATTACTTTTTAA AACATGATATCCATAATCACGACATTCAATTATTTACTTACAATTTAAAA AAAATCAATTGGGTAAGATATTTATGTTTAAAAATCTTCCAGACAAAATG AATTACCAGAGAACTACGTCATAAAATACAAATATAATAAAAAACCTGTT TTCTATGTTTGAAAAAATGCCCTTTTACGAAACTTATTCGTATATAATAC ATATAAAATTGAAGAAAACAATACTTTATGGATATATGAATTACTTATAT TTCACTCTCCTCTAATATTTAGTCAGTATAAATTACAACATAGTTTCAAT TACCGTGAAAAACATGAAAATTAATATTTTTTGAGCTTTATATTTGACTT TATGGATCATATGCAAATTTGGCTCGTCAGCAAAAAAATCATTTTMAATA ACTATATTATAATTCAAATTTTGGTTACATTTGTATTCTTAAAAAATGAA TTATTACAGTCAATTTTTAACAACAAACAATTCTGATAATTAATATATTG TACACTTATCATTTATTTGAAAATTGTTCGACATAGATCTGTGTTTTTAC TCACCACATATATAAATAATCAACATAAAATAATCGTTGAGTACAAAATC CAAATTTCACTTTCAAGCCCATTTAATTTCGTGTTTCCATGCGTGAATTC AATACTTTTTCCTCACAGGAACAGATAGACCAAGAGCTCAATACAACATA GAGTAGTTAAGCATGAATAAAAAAAACAGGTATGTAAAAAGTATAGGAAA TCCTTTTACCTTTATGTACGTATAAATGATTTTTCTCCTAAATCTTTTCT TTGAAGCCCAAGGGGATTTTTTCCCTTCTCTATTTTATAAAATCTAGTGT ACGTTTTTGAATCAAAGGAAAGATATTTGTTTGGCTCAATTGTCCTCAAG CACAGTTATTGTTGCTATTTGCTGACAAGTCTTATATATATATATATTTA TCAAATAAAACATACCCAATGTACTTTATAAATAAATTTATTAAAAAATC CAATTCAATAATTGAAATCCTTACGAAATGTATTACATGTAGTGGTATTT CTATATTGTAAGAATCCGTTTTTTTCACTTTTACATGAATTTTTAATACA AACATTTATTTTAAACTGGACACGAATATATAAATTACTGTAATCAATAT AAAGTTTTGTAATAAAACAAAGAACAAAACAAATAATTTAATTCAGTCTA GTTTGTAAAAGCTATGATTTAAAATATTATTATAAAGTATACAAGTTTAG AGTATTCTACCTGTATTTAATTCAACGTTTTTTATATTAAGACCATATTA TCGAGTGGTAAAATGGTCGTATTTTTTTCATATCTGACATATCTAAGGTG TCAGAAATGAGAACAAGCTTAAAATTATCTAAAAACTTTTTGATAATTTT TACATTGTGTGATATATATTTCTAAGATATTAATTTATGAAAACAAAAAT TACAGTCATACAAATTTCAAATTATTTATGTACCATATATGACATTGGGA CGCCTCCAAGCTACATAAAGAAGGTAATTCAGGTCTTCTTCTATCAATAT TGGTGTGACTCATATAAAAAAGATCAAATTATGAAACATACACATACTAT GCTTAAAAGCCGAAGTCGAAATATATCAAGATTGGAAGAGAAAAATTGAG ACTCATTGTACAAACCTACCATGGACATGGACCTTTTCTAAAACAACAAA GCAAGGGGAAGGGTATAAGCTCAACGTGCAATGTCTCTATGGAGGAATTA CAAAGTGCAGATCATCTCATTAATAGATGCCCCGCTCTATCTTACGAGAG ACATTAAGTCATGAATGAGGAAAACGGAGACATTCATATATTAAAAGTTC GTAAATAAATAAAAAATATTGAACAAAATTTTAGTGTAAGCTAGGTTTAA AATCTGCTGCAGTAGCACAAATACTCCTTTCTGTTATCATGTTAGTTACC TTTTATTTGAAAAAATTTATTTTATGTATAAATGGCAAGCAGTAATAAAT ATTTAACTAACTATTGACATGCATATTTTAAAAAAAATCAAAAAGTTTAT AATTTAAATATTCTATCTTGAAATATTGTTTGAACAAAATGCATTAATGT CAATCAAGATACCTTGAACATTTATTGTTAAGATATGTATTTTTTTATAA TTAATGATCATTTAACTGGGGAGGAAGAGTTGCACTGATTAAGTACTAGT AAACATTATAGTATAAACGTTACTTTATATGACTTTATTTGACTTATTTT ATCCTTAAATAAGACTTAGAATGATTTTTATTTTGTTAATAGTTGTCTAC TCATATATCAACAACAACTAAAAAACTATATTCGATACAATTATTGCAAG AATGACAGGACTTATAATCAGTAATTACAAATTCGTGACTAATTTTTCGG CTAAAATATTTCAATCAAATCAATATTCACTCTTTATGAAAGTACTAGGC AAGTAATTTACGTTGAGGTCCCTTGTTTTTGTTTTTAAAGTTTTGTAATG AAACAGTATATATAATTTAGTGTCATTATTTAAAATATTATTCTAAAAAC CCCTTTAAAATATGCAAAGGAATCATAACAAACGCTCAAATTATTTTTAT AAACTGATTTTAAGTACCATTTTAAATTTTCAAAACCTAAAAGCCCATGT GGGCTTGCACTTCTACTAAACCTGACTCTTGATTCAATTTTTTTTTAATT TAAAAAAAGAAAAAAAAACTAAAACTATATAGAAAACAACAATAGGATTT AATTTTTTCTGAAAAGAACCTTACAGTATCAACTCTTTATTTTATAAATA TACACTCCAATTAGTTTGATTTATGTTGTAGCATAATTCATTAATAGCCA TTTGTGAAACTTTTACAAAAAATAAATTAAATATCTATATACAGTCAAAT CAATCAAACTTACTTTTCAGGGCATTAAAATACATTTTCATGAAGTAGTA AATAATATTTAACAAATATAGGTTGGCATGTTGGTATATAAAGTTCTTTT TATGAATGGAAACACACTTAAAAGATGTATATCTTAATGTATGTAGGATT AAATATGTATCTTCAGAGTTTAGGGGATTTCAATATTTGAATATAGCATA AATATGTAGATAAGATTAGAAGAAACAGTCTACCAACCTGCTATTTCATG GATTATGATCCATTTTTTACAAACTTGGTATAGATACATATATACACGTT CAAAAAAACAAACAATATATATATAAATGATGTTGTACATAAATTTTTTT TTAAATCCTTTAAGATTGACATGGATCTAAATATTTTTTTTGCAAAAATA TGTACATATTATGATTGAAATTAAAATATCTTTATATGACAAATACATTA AACAACACACATTTTATTCATATTTTAAAACTAGAATGATCCTAACTTAT TCATACTCTAAATGACCAAAGTGTTAGAAATGACTCCTAACCATTAAATA ATTTTCCGTACTTAATTGCATAGATTTTTTTATACTTATATTTTTATATC ATAAAATGATCAGTTACACATACAATTGAGAACTAATATTTACTTAAACA GCGTCTTAKCCAGCCTCTTTATTCCCCGTACTTCACAATCCATTTCTCAT TAGGGAATTCATAAATTTTAATTACAAACATATAAATTAAAGCAAAATTA TGGCTGAAAGGTCTCTGTTATTTATTTTTTATGTCTAATGATGGTGTACT ACAGTAACTTGGAGTGTGACTTTCTTTAATTCTTGTTCCTCTTTTGGAAC TAAAAGCATGTTGTGGAATTTTAGCTCTTTTAATATCTTATCTTTAAATA GTATAATATTATTTTTTTATTCAATTAATCTTAATAATATAAATTTATAG TGTCGTCAAAAAAATTATAATGTAGTTAAAAAGTTATAACTTTTTATGTT TTACAATAAAGTCTATAGAACATTCATTATTCCAAGCCAATTTCAGTTAC AAAGTAGGTACTCATCAATTTTGATAAGATTACATGTGCTATATAAAATA ACTATTTACATTTACAGCAGAAGCAACTTTCTTTTAAAATAAAAAAGAGA AAAAATAAAATAACGACTTAAAAGTGAATAAGTTAATCAAATTCATTTAA TATTTATGATAAATTACAAAAAGGTATGAATAATTCCTATAAAAGACATT ATCTTAACAAAAACAAAAAGTTGTATTTATAAAAACAGAGATGGGCGTTT TGAGAACGAACTAAATCGATAATATGTGTTTAACTAGAATTGTTAACATT TTTATGAAAGGAATCTCAAATAACTAAAGAAGGGTTATCCCTTAAAAGAT ACTAAAAATGTTCGTTTGAGCCACTTTCAAATATATTTGTTAATCCTACT TCTCTAATTAGTACCAGGTCACCATTTTTTTACAGCTTTATTTGTACTTC CAGATATTATATAAAACTCTTTCTTTTTTACCTTCCCAATTACTATTATG GTCTACATATGTGACATATAAATAAAAAAACCAAACAAATACCGTTTGGT CCATTAAAGTCTAAAGACTTTTACTTTTAGACTTCAACATGATATAATTA ATTAATTAACAATAAAATTGCAACAAAAGTAATACTGTAAGTAGATGCAT GTCTGAGCTCTTTCAATAATGAATGTAGCTGCTGTTAAGGAGAACCATGG CTTCCAGGCACGAGAAGAAAGCCTAGCACCCGCTGTGGATGTAGTTTTCC GTGCAGGTCTTCTCCTCGACGTGTATTCAAAATATGTAGTCCAGGAGATT GGTATCTGGTATCAGGGCTGACAGAGGGAAAAAATTGTTAAAAAAGACTT CAAAAGAACTCCAAAAATTCATTCAAGACTAATCCAAAAAAGTCTTGAAA TTGAAGAGATAGATATCTTTTATTACTGGTTTTTAAAAGTGCTTTTTTCA AAAGCCTTTTTCCACCCACTTCTTTGATAGCTCGCTGAACAGTCTGGCGT ACAACTCCGAGATCTCTTTCATTGGTCCTGATGAATTTGAAAGGACTGCC TCAGCTATTTTCTGTAACTCTTTCGGGTCTATTAAAAAAAGAAAAAAGAT ATTTAAATAAGTTATTACATTTGTGTGCTTATAATATTTTGGGCTAAGCT CTCCCTTCCCATTCCCCATCAAAATCAAATGGTGGAACAATGCTACATGC AATGGAATATTTTAATTGAATTAAAAATGATACTATATCCATTGAAAAAA ATGTTTGTGGCCGTTATTATGTTCCCTTTTAAATAAGCCCCTAAATTTAA TTACACTAAATCAGACAATTCCRCCCGCCACAGAGAATATGTATGCTAGA TTAATTTACCATAATGCCTGGACGCATTGATGAAGTTATAGTTTTAAAAT AGTTTATACTAATTTTTAAAGTATTTTTGATGTGCGAGTAGCTCTAATAT ACTTATTAAGTTCGTAGTTCAAGGTAGTACTGTGTTAAAAGGATTTATGC GTGTATTTAAGAGTGCATTAATTTTATCATTAAGTTCCAAACATGTTTTG ATAAATATTCATTGTTTTATTAATCCTATATAACTACATATTGTATTTGA TACCTAGTATGAAAGAGGTAGGCAGGCCGAGAACACTTACAACTCTTTAT GTCCTTGTCTCAATTACTCATAGCTGGATTTGACTGAAGGACGTCAAAAA TTTAATAAGGCATGCATACATGTATACAATTACTGCTCTTTATTTATATA AGGTCAAACGTTTTATAAATCGAATTTTAAGATCATTTGGAACATTTGAC AGGTTGTCAAATATTGCATTTTCAGAAGCAATGGCAGCTGTTGAAAAAAA TGAATTAATTATAATTTAGAAAATTAGACATACTATACAATTGAGTATAT AAACATCTACAGACCTCGTTTAAATATCACTGACTGATATTTATTATAAT TTAATTCTTATGACCTGTGAAGAGTAAACATATAAATTAATACAAAGAAA CAATACAAAATTTAATTGTAACACTTGTCAGTCTTTGTGTTTAGTGTTGA AATACCTCAAGTTTCTTCTCGATGAGTCAGTTCTAAATTTTGATGAAATT ATATCTATGGACAGCAAAATAACCCATATTTTATATCAGAAGGAAATGAA AAGTTGAAGAAGGAAACCTCTTTTCAATTATTTACGAATGTAAGAAAGTA TGTCACGTGGTAAACTGGACTTTAGAGCTCGTGGAGACTTCGTTTCAAAC ATTGATCTCCAAGACTGATTGGGTAGTTATTTGCCTTCCCATAAATATAA ATAATGTTTCACAAATGGCAACGTTTCTATTACTCTGCACATTCATATAA GTATAGGATCTGTTCAGTCTTTGACAAAATGGTTAAGAAAAAACTTAATA TTTTGGAAAAGCTTAGGGAAAAGGGAACCTTTGCGTTGTTTATAGATATA CTCAATGGTAAATCCGCTGTATAGTCCCCTCTACAGCTCTGCGTGAGAAA TTTAGGTCAGTTTTATATTTTACTGAGTGGTCCATTAAAATCTGAACACT TTTAATGTTAAAGATCAACAAGATGTAGTTTATGTATTAAATATATAATT TCAACAAAATTAATACAAAAATGGATTGGTGTATTAGTTCTCTTAATCAA TATACAACCGCCCTTGCCGACAATGAGTGCTCCAGGCGGCGGCGATGAAA GGCCTGGCACCTGCTGCAAATGTAGGTATCTATTATGGCGTCCCAGTTCT GGCTGACAGTGGTTTTGAGGGCCTCAGTTTTCGGATGAAGGACACTGCAC GCCTTCCCCTCGATATGCAATCAAAAGATGTAGTCAAATGTCTTTGTATC AAGACCGAAGGAGGCCAAAAGTGTCAAAAAGAGTTCAAAAAACTCAAACA GACTAATTCAAAAGAGTCTTGCAAAGGAGAACATGTTGTCTTTCATTGGG GGTGTCGAAAGTGGACTCTACACCCTCACAAGGCACTTTCCACCTACTTT TTTTATCCCTCTTTGGACAATCTGGTGTGAAGCCACGATATTTCTTGCAT GGACCCTCATGGACTTGAAGGGATTAGCCTTGGGTTTTTTATTCAACTCT TCCAGATCCAATTTAACCTTTTTAAAAAAAGCTTTCTTCCTCTCTAATGC TTCGTACTTGTGAAGGTGTAGAGTGTGGTCCTGCATTATGATCAACTGAT TAGAGTCCTAGAATTCAAATTCGTTGATCATGTTCAAGTATCATTTTCTT AATTTGTAATTAAGCTAAACAGCTCAAGTTTTTTTTTGTAACTAATTAGT TATGCTTTAAACATGATTTAATTTCAATCACTCAACCTTCATAAACCATT GATTTTGTAAGTGTACATATTTCATAGAACCACTCGGTATATACAACTAA TCAGTTCTCAATTATATTAAATTCATTGAAATTATATATACATACCTATA TATATTCAAAAGTGTGTTTTAAGCACCTGTTGAAAAGTATGCAACTTTAT AATTGTTAAAATAAATAATTAGTGATTAAAAATAAAGAAAATATAATAAT AATAATTTTAATTATTCAATATACAGAAAACATTTTTTAAAACTAACAAA AATATTATAAAAATATTGCTTTTCAAAAAATTTACTTGCACTTTTAAAAA CCAATTTAGTCAATATTTTTATACACAAAAAATTCATTTTTTTATGAAAT GTAATGGAAATTTTGTAGATCATTAAATAATTGAGAAAAAACGAATATTA AAAATTTTCCCAGTCTTTTTTATTATTAAAAATCTCCAGAAAGTTTATTT TATATCTTATTATATCTATAAGTTTTTTCAAAGATTAAGAAAATAATATA TTTAAAAAAATAAAAAAAGTATACATGGTAATATATCATTTTAATTTACA AATGGTATTTACATTTAGTTTCTATACAATAATTAATAATTCATAGACCC TACATGTATAATATAAACAATTATATTTACAAAACAAATAAATATTGACT GCAATATAACTATATTTGTTAAATTAAAGTTTTTTTATTACTTTTTCATA TTAAATGAATGCTAAATGGATTATACCAAATATTTAGCACAGGAACGTTC AATACAAAAATGTTCAAACATTTTTTTAACATAAGCTTTTTTGGTTTGAA ACTGTATTTCTAATAATTATTTTTGTTATGTCAAATCCAAATTTTGAAAC AGTTATAAAAAGAAATAGAACGGCGATCATACAAGAATAAACAAATCAAT TTCTTATTTCTTTGATTTGCTTATTTAGGCATTTCCCCTAATTTTTTGTA AATAACGTGTTATACATGAAATAAAAAAAATACTTGTTCTATATGTATAA TAATTAAAAGTGTAGAAAAAGAAGTTTCTAAGTGACATTTTTGGGAAAAT AAATTTTTTGAAGTTTTTTGTATGTATTCTTTAAGCTCCAAATAGTTTTA TTTCAAAATTGAAATAGCAAAGGGTGCAGTGGACAGATTTTCATATACAC ACCAAGCATTTTTGTTGTGAAAGATGTTCCTATGGTACTTCATAGTCATT TATCTCAAAACTGGTACTATGTAACATTGGTAGAATTTTTTTTTAAAGAA ACTTTTCCATAAAAAAATAATTATTTTAATGGAAAACAGTAAAATCATCT TTCAAAGATTGAAAATTCATTTAGAATAGTATTCTTTTTATTAATTTGTG TTCTTTTACATTTTTCAGGTAAGACGGCTGTATTTGTTTATAAAATTGTA AAATTAATAACTTCAAAAGCCTCTACAGCTTCTGAACATTTATCAATATG CTTTGACTCATATTGTCTCAACTTATGTTGTCCCTCTCCACAGTTCGATA ATAGTAAGTTAAATAATCAGTCTACATACATATTTTATGGCCAGGTAAAG TATTGATTTGTTTATCATTTCCTAAATAAATCGCTATATGAAAAGGTACA ACTTTAAAAAGTACATGCCCGTTGTAGAGTATTGCAAAAATAAATGTATA GTTTTTCCAAGTTTTTCTTTGTTTTCATCACGTTCATTACAATTAAATCA ATAATTAAATGGCAAATGAATAAAATTTAATGTGATATAAATTTCACACA TAAAAGGCAAAGTAATTTATTTAACAACCGGTTATGTTGAAAATATAATT AGGGATTACAAAAAAAAAAATATTTTAACTATGAATAAATGTGGCATGTT TAATTTTCATAAGCAATGATTTTAATTAAATATTCATAGAAAAAAATATT ACTTTGACTGTGTGTCATCTTTAAACAACCTTTGACCGTCTTCATTAAAT CTTTGCAACATTCCAAGAAGAACATTTACATGATTATCAAAGCCCTGGGA ATTTTTTTTTTTGTCTAACAACTCAACATGTTTTCATAGTAGTCGACAGC TAATTATTTGTTCATCAACTTTGTTCAAAGAAAAATTGTAAAAAATAACT CTTAATCTCTCAAACTTTGCATAATAAAGATTAATAAATAATAACGGTTA ATATTAAGGAATAAATGTTGATATTAAGAGTCTTTGACTCTGAACGTAAT ATTAATGTATTTGTATCGGTTATGAAATTAACATTAGCTAATGAAATGTT GAAGATCAAAAGAGTCTTCAATCTAAGAATATATCTAGATGGAATTTTCT GTTGAAAATAATAAGACTTGTCCACACCGTTGAAAACAATAAATGATCTT TTTTATAAAGAATCTTATGGCTAACTTCCAATAATGAGAATCACATGAGA ATGACTCATAAAAGACAGGGACAATGAGACAGAACAATAAATAAATATAT TTTTTAGACTACTGAGTTTTCCATTTAAATTCAAATACTTCTAAAACATA ATCCAAATACTTGTACTTCAAACTTAAATAAAGTACTTTTACTGGACGGA TGTACATTTAAATGATAGACTTGCCTCCATTGGATTATTTTTTTAAATCA GGTTTATTTTATACATTTGTTAAATCCAACTATATAGATATTTTAATTGA ATTAATATATTTGTATTTAACTCTACTTTTGGAAATAAAGCTTCTTTCTT AGATTAAGCATTTCGACCACCATTTTTGAACAGGGGGACCACATGCCATT TCTTGCAAGCGAGTGCATTTCATACTACCTGCAAAAATTAGTTAATAACA ATAATACAACAAAAATGTACAACTTAATGTATGTATCATTAGCCTAAATT GTGTTGTATGGCAAGTCTGGCACGTAGTATCTTAAGAATGTGATAATACA TTAACACTGTTTGTTTTTAACGGGGATTTCTTCATGCTTCGCCTTAACAT CAACCAGCATTACCTCCAAGCTGAGTTAGTCAATGGTAAAATTGATCAAA CAATAAATTTTAGCCTTCCTGGTTTGATTCTCAATTTATATTTATTATAG ATAAAAGTCTGTCTCCTATGAGATGAAGGTTGTGAAAAATAAATATCCTA CTTAAACCACGTATGAGCACTTTAATTATATAATAATGATTGCAACAACC GGCCTGGATACCAGATAGATCATAATTCAAGAGAAGTTACAGTCATTAGA GTTGTAATATGTATATTTTTTAACTGTCAAACGTCAATCATTTTGATGAT TTACTGTCCAATTAAAATTATGCCCTAAGTTTCATTAGTATGGCCTGAGA GATTTTTTTTATTTTGTTCTACAATTTTATTTATTAGAATCCCTGATCTA CAGAGTCATAAAATACTATCAAAAAGTCACTTGAAGCTGAAACTTAGTCA ATGATAATGCTTTAGGTATAATAAATTATCTACTTCAATCATTTTGTAAT TAAAACATGGTCATTTATTGATCTACAGCTGGAAGTTATTTAAAACATTT GTGACCTCTCAACAAAAGAGTATAGGGGAATGATTTCAACTCAATTGAGT TTGGTTCCCATTTGTATTTTTGACAAATAATTGTCAATTTCTAGAACAAA ATATTATYATAAACTCTTTCAAACCGCCAGCAATGGCACTTGGAGTAATC AAAAAATTGATTGTGATAATAAAAGAGTAACCAATTAGTAGTCTTTATTT GAAAAGCCATATCGGGTTAAATATAAGTCTCTGAAATCCAATAAAGGCAT AAACAATAGTAGAAATTCTTAAGTATCGTAATTCATCTATAAGGATTGGG ATCTTTCAAGGAAAAAGAGTGCAAAAAACATATGGTTAAATAAATATAGC ACCTTGTTTATTTTTGGAGAATAAAATGAATTACTATTATTAAAAGGAAA ACCTTTTATATTTAAAACTACATTAAAGCAGAGAATTAATTACAATTCTT TTTAAATGTATATATATTTATTTATAATGCATTTTTAAAATATGCTTATT CTTATTTCAAAGATAAAAGTTAACACCACGACGACAAAGAAAAAAAAAAT GCAGGAACACACACAGCAACCGTGATTTACGTTCCTAATGACACAAATCC CTTCTTTACTCTTTTCTTTTTTTGGGTATTATTTTATATTGACAAACTAA AAATAAAATTATGGAATAATTTTTGTACGTACAGTGCTATATGCAATATT TTTATTTTGCATTCTATATTCTTAAATATTCATTTTTGTGCACATTTGAG CAGAAGTCAATAATATATGATATGTGATAGGTTTTTCTAAGTAATAAATC AATTATTTGTCGATTTTTTATTTACGTATATTCAATTTATTCCTGCAAAA CAATAGTTGAGCATATGGTGATTAAAATAATCGACTAGTTATTCAGTGAG ATATCATTGTTTGGAGTCAACCAGTTACTGGGGAACAAGTTAACATACTG TAGACTTGAGACACAGGTAAATAAAAATATGGATATAAACATTTTTTTTA TGTAATCTATTGTGAGTAGAAACAAAGGATAATCCATTTTAAAGGTTAAA ATTGTTTGGTATGAGCATCATGAATCAAATAATTCATTGTACATTTTCGT TTTTGATTAAATTTATTTTAATACCGAGTGGTTCCTTGAAATCTGAACAT TTATTAATTCACTAATTATTGAAGGTTAATAGATTTGGGGGGGGGGGGGG AATTAATTCATATTCCGATATATTAAGCATAACCGAATAGTTATAAAATA AACAATTCTGAGCTCTCTAACTTACATGCAAGTCAAGAAAATGCCACTTG AACTTGATCGTCGAGTTCCTATTTGCAGAATCCAAGAAAGTTGGGAGTCT CCAGAACCACCATCTACGCTTTCGTGTTTTCACATCAGATTGTTCAGAGA TCTATCAAAATAGTGTGTCAAATGAGCGTTATGACGGTGGAYAAGCCACT TTTGACACCATTGATAAAATAAAACCATCTCTTCTGACTGAATCTTTTGA GTCTTGTTAACATTTTGGCCCATKCAGCCATGATGCCAACTCCTTCGACA CAACCTTTTGGGTGCATGACGGAGGGGGCGGTCTCAAGTCTCTATCATTC AAATACTGAGCCCCAAAAAGATACTGTCCGTCAGTTCTTGAACCCTACAA TATAGGACTATTTCGGAAGATGGTGCCAGTCCTTCTGCACCGACTGGAAG CTATCATTACTGCTACAGGTAGCTACAATAATAATTCAGAAAGCTCAGAC ACACATATATTTGTGGTATTAGTTTTGTTAAAATTATATTTATAAAATTA TTTCTTGTTGAAATTTAATACGCAAATTGTTCTGATTTTAATGACCACTC GGTAATATTAATTGACTTTTTTCTATTATTAATTATGTATAGTCGCTACT ATCTCTCACAGTGATGAAATATCAATATTAAAATTGTTTTTTATATGTGG CTTAAGTACTATCGACAAAAGTATTAATTTAACTAGTTCCTATAACCCCG TCTTCTCTTACATATCTGATGTTATATCGTAATTACGACCTCTTTCAATA ATAAATTCAATAAAAAATAGGTAGACCAACAGCTTTTTTTCCAATCTTCT TCACACACTCCTTATAAACAATAGCTTCTCAATCGGATCGTCTCTGGCGG GGYTAATGGTTATCAGATTGGGTCAATATGTTGCTCACCCAATCGATATA GTTTCTTCAGTCATGCCCTCTTTAGTATTCATCGATGGAGCCGTCGGTGC GACTATGTTTGTGTGGAGGATGATACTGGCCATTGACTTCTTTCGGAGTC ATATTGTATTGTCTAGTGGGTTCAAATTAGGGCTGTAGTGTGCCCCATCG ACTTAGATCAGAGGTCCAACTTTTTGCTGTTGTCACAAAGAAACTTCTGT TTGGTGCTTTTTGTATGGCTAGGAGGCCCATCTTGCTTGATGCAATAAAC TTTGTCTAGACCAAACTATGATATAGTTCTTGAACAGACAGACTCTTTTT GAGCTGAGTTTTACCCTGAGAGTAGTGACTTGCAATGTAGAAAAACAAAC ACAAACTTAACAATTTATGAAGCAATTCCAATCTTTGAAATAAGTTCAAA TAATTTTGAGTTAAAACAGTTAACAGGAGCGTCGTAATTTCCATGCAACA CCCTGAATCTTACTTATGTTTGCATGAATATACTAAATGACCTATTGAGT AACTTTGTATCGAACTTCTTTTTTCTTCAAAAATTAAATTTGTTAAGATG AAAGAACATACTTCCATTTATAAAGTACATTTAAATGTCCTTAAAAAATG AAATGTATTCATCATCCATGAAAAAAACTTCTCAAGTAATCTTATTTCAG TATCAAAGAACAACAAATGTACATTGATATGGTGTTTATATCAGCAAAGT TAAAAAAGCTTTCAGAAATTATTTATTTTCAAWAATAATRCCTTTATATT TAAATAGAAGAAACAACTGTTTTATTTCCTATCGTTTGCAAAGCTGAANN NNNNNTATATAACTTAAAATCTATCATGTCCCCCGTTATTATCCTTACAG AACGTCGTACATTCTAAAACGCCCTCTATATTCTATAGTTATAACAAATA TTTAATATAATTACATATATTAGTTTGCCAATTGATTACGTTCACTAAAA TCTCTTGTATTATTATGTACAATAATTGCTGTTTGACATTATTTTTTGAT TTAAGCTTAATTAAAGTAATTATCGTGCTGTAAGTAAGCATTGGATGTAT ATAGCTACAACATAGTAAATATAGTTTAATGATGACATCGCATATGTTGA CGTCATTATGCAATTGTGATTTAGCATGTTATTTCGTACGTGTCAAAGGC GTCCTTAATTTTTAGACAAAACCAGACAGGATGACAAAATCAAGGAATTG ATAACCCTAATGAAAAAATAAAAAATAGCATACTTTTTGTAAATGGATCT ATTATGTAAAATAAAACTATTTGAATGAGATAAGCAATTATTAGTTTACA TATTTGTAGAGGTACTATAGTTTTTACGTCCCGTCCAGTTGTGTCTCTAA ACGACAAATCCAATTTTAACAAAAAAAACTGTTAGTGAAACAAATTTACA CAAATAAAGTCATTCATTAAAAATATTAACATATGATGTCAACAAAAATT GATTTCATCCAGCTTAAAGTAGGAGAGGATTAATTGGAAATTGGCACTAA TTTTTTTTCTTAAAGTGCTTAAAAGATGCTCTTGTATCCGAAAAATATGG CAACAATTGATTTTGATTTTAATATGCCCCCCCCCCCCCTCCCTCAAAAT TAAATGTATAAAAATGGAATGTTTATTAGAAAAGTAAATATTTTAATGGA GCCTAGATTAAGAGTAACGAAAAACTATTCTTATTCATGAAAGATACATT CTAGGATCTGTCAACACGACTTAAATTGGGGACTGATGGTTTTGTTATAT CTAAGCTGATTTAAATTAAGTAACGTAGATGAATTTGGCCTAAAGTTTCA TTGTACGAATTCAAGTACTATATTGAAGTAGAACCTTTCGATATAAATAG AGGACAATGTATGATTAAAACGTTGTTCAAAAAAAAGATAAAAGGAGGGA ATAGGAACAAGCGTTTTGTAGGTATTATTCTAATATATTTTTCAAGAGCA TTCTATTGCCTTTGTCATCCTCATATTTCAAGATAGGCATAAAAACTAAT AGTAGCTGTTCCTACACTTTTCTTGATTCTCATTATCAACTAACTGTAAC GCCGAAGTAAGACTATCAGTTTTTGCTCAGTCTTTGGTGAACAAGATTTT ATCTGCCTGTCCGGATCTTCTGAGTCTTGATATAATCCAAGACTTATAGT TGCCAACAATTTTTGTTTTTTCCTTGGAAGCAAACCTTCCATGTCCAAAC ATATAACAATTTCCACATTGCTGTATCTGCCCAGTGAATTTTCATGGTTC AATCTCTTAACTTAAAGGAATTAAAGATGGGACGTTCCTTGGCTTTTCCG TTACATTGACTATGAAATTCAAACTTTTAGAATTCCAATGCTGAAATTTT GACTCATTAAAAATTGATATTTTTTCAAATATGACTTTTCAATATGGAAC GAATTTCCAATGCGAAAAGAGTTGCCCTCACAAAAAGGTTCAAGCAAAGN NTCATAACACTGCCTCACACATTTTTCCATTGCTGTACATGAGCTTTATG TCGAAGATGTCCATCTCTAGTAAGGATGAGTTTGCGGCAATCCAAGACAA CTTTGAACTGATTGTTATTTTTGCCTCTAAGATCAATCTCAACCGGTAAT ATAATATCCTTCAAAATTATCTCCATACGATTTTTTTCTCGACTTATAAT GTGAGGACAATTATCTTTGTCCCAATTAATTCTGTGCACTTTACTTGAGT TGATTTTCAAAACCTCTGTTGCAATTAACGCCCGAAAGCATGGGCGCATT TGGTTTTTACTTCACATACATGTTTTATCCATTCCCTGAGTAAATAGACA GGAGTTTTCCCTTTTTTATAGTTATTATCTCTACCATCTGATATATATTC AAAAGACAATCGTAAGTCCTTATTTAAATTTAAGTTGACAGCTCCACTGT ATGTCATTAAATGTTGATTACTTTCATTATTTATATTATTTTCCTTTAGG TTTGTGTTTAATTGTCTTCAATTTATTTGCCGTAACATTATTGCCAAAAG GGTTATAAAGTCATCAAAGGATAATTCTGTCAGGATTCTCGCTTTATAAT TACTAAATATACTAACATATACATATAACATCGACAACGATGAAGATGGA GATAATAAAAAAAAGGTGACAATATATAAATATTATCTGTTCACCTATAA AGAGTAGAAACGCAGATAATTAATACTCGAGGTGATAAAAGGGAATCAAA TAGAATAGGATGATCAAAACAAAAAAAATCACTTTCCATGATCCTTATTG ATTTTAAAACGGACTTTCGAAGCGAAGACGATGATCCGTCCAAATACTGT AGCTTTAGTTAAATAGGATGGGTCTTTGTATATGGGATGTACTGTTCGAC AAGAAATTAGTTCCACTTTCAAAAAATAATCACGAAGGAGCAGCAAAAAA CACGTTTGCAGTAATCAAATTCAGAAACAATTTTTTCTTAATTTTGTAAT TTAACCTGGAAACATTGTTCAATATTACTAAATTTTACTTAATTATTCTT TTAATATTCATGTTGATGTAAAATTAAAACAAGAAATAATTTTATCCGTA CAACACCTTTAAAATTAAATAATTATTCTATAAAAAAAACACGCCACAAA TACAACACTGTTTGTCATAAATAGGCTAATTCTATCATCTTATGGAATTA TAAATGAATACTTGTATTTCCATCTATCAAGTTTTAGCACTGAAATATTA TTAATATGCTCCAATCAAGGTCACAAAGACTTAAATATCATGGGAACATA TAATTATAATGTCTTGAGAATTTAAGGGCTGTCGGCACGGCGATGTTATT TGTTATAAATTTACACATTCTACAAAAAATATACATTTTGGAAACGGCTT CTTGAGGTGTGCAATCTGACGTCATTTATGGGCTATAACAGTATAAACGG AAATTTTTCGAGATGATGATAACTCGTAGTAAATATTTTCTAAAAGTTTA TAATATAATTTGTTTTTGGAATAAAATATGTTTGGAAAAAAAATCTATTA TATTTCCAATAGATAGCTTTAAAAATTGTATTTTGCGATGTATAAGTACT ATCAGTTCGTTGATTGTTAGACTCAGTAAATTTGAGCCGTCGTCAAAGAT AAACAACATCAAAAAGAGAAAATAAGTCATATGTTACAGTTTTTCTTCGA AAAAGGTAAAAACTGCAAGCTAGGCGGCTTAAAATGTGAATTATGGTTTT GATACTTTAACAGCCGATTCCAAGCAATTTTGTTCTATTGATTCTGTTCC GGTAATTTTTATGTTAAAGATGCAAGGCCAATTGTCGAAAGTGTGGATAA AATAATTGAAATTGTCCAGTCTGACCGTTATGTAAACACTATTTTGATTG ACAAGGAGATAATATTATTGGACAAAAATCTATTAAATATAAGGAATTCA TTTTTACTACATTCAATATGAATTTTTTTAATAAGCAAATAAATTGTTAT TATATTTGTTATATTATATTTAATGATATCTATATATAATATAAAAAAAC AGCTCAAGATACATTTATGTTGATAATAGTTAATATTGATACCAGAAATA TTCGTATATATATTTAAATCCTTTTTTTGATCAAAGATTATTTTTTCTAA ACTAAAGGACTACATATATATTTTTAAACTCCTATGAAGCTCTACGTAGT AAGATTATTTCGCTATGAGTATAAATAACATTTTATTTCCAGCCGCCATT TTTCTTTTTCAGTTATTATATAAGATTCTAAATAGATACAACAACATTTT TTTACCCACATGGATGAAGCAGTTTTCTTCCACGTGTGGACGCGATACTT TTTGAATGTCGCATGAAAACATTCCTTGTCTTGTTAAAAATGTTGCCAAG TGGACCATACCTTAAAGGACAAAAGGTACGAAGGAAAATATGGTCTCCTA ATGTATATGTACTATTTTTATCTTCAAAGTTTGTTTTATCCAAAATGATG TCCAAACAAGCATTTTTGAAGATAATTAAAGCATGTAACATTGAGTTCTC TTCAAAATATACTGAGTACAATCTTTCATTTTAAGCACTAATTAAAAAAT TGAATACTTTTTGTAATAACACCAAGATTAAAAGAACAAAAACATTATAT CTTTATTATAGTTTTACACATTGTGAGACTGAAAACATAATATCAAATCT GTACACCATTAATTTACATCTGTTTATTAAACGGCAAATTGATAACATGG GCACTAGATAACTCTCTTAATATTATTTTTCTTTAAACCAGTTTGCTTTA GGATATTTGGTCTTCAAATCATTTTGACTCTAGAATAAATCTCAATATAT AAATAAATGAGATTTATAGGTTGTTTATGTTATTTTTTGCTTAAAGTTTA TGTTTTTTTGGCATTTTTAATAAATATATGTAATGCGAATTAGTAGAAAA CACATTAAAATATTATTTTCTCTAAAAAAATAATGGAATCATAGCCAAAA ATATCATTTTATGCACCAACATAATCTCAACCTGTAATGAATTAGAACCA ATACAAAATAGGTAATATAATTAGTTGATAAGTAAAACAAAAATAAATAA ACACCACAAAGTTTCGAATAAAATAATTTCTAATCACTTCTTCGTAGCTA ATTATCATTATATATGATGAATTATTCATACTAGAAAATACCCATGGATT GACAAACATACATAATATGCAGCAAAATGATAATTTAATACTTATTCTAA CAAAAAACAAACATTAAATGGATTTTATAGTAATATTCATTACATATTTT GGTTACAAAAACTTAAAAGAAACATCAATTTCGACCAAAAATAAAAAATA ACAACGTATAAATCTGATTTATTTAATATCAAGGCAAATTGCTTTAAGGT AAAATTACCAGGATCCGATTAAAAGACACTAATGATAAATCATTTTCCTT TCATTTATGTTTGATTATGAAATGTTCAAGTTTATGGGCACNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTGTTACATTATACTCAAA AAAAACAAAAAAAAAAACAAAGGAGGGAACAACATACTCATAATCAGTTG TAAGCTGTTTCTCAATTATTCTGTCACCCATCACCATGAGATAGCCTTCT GTGTCCATATGGTCATTCCAAAAATTTTGAAACCACTTATAAACCATTCT AATCGACAGTGTAGAGCCACCATAATGTGTATTAAGCTTTTTGTCAAACA ACCTTTGTATAGATCCATTAATAGTGTTTCATCTAATTTTCTGAAGCAGT TATCATTATTTTTTCGTTGATGTGGATACTTTATAGATAGATTAACTATC TCCACATCAACGAAAGAATAATGATAACTGCTTCAGAAAAAAATTAGATA AAACACATGACAGGTTGCCAAGAAAAGAAAACACACAACCTAAGAATGCT TTGGATTTACATGTTTAAAAATAGCAAGGAGTTAATAGTCTCAAAACGAA ACAATATTTTTATATACCAAGTAAAATGTAAAAAAATATATATAGGCATA TTTTTGATGATAACATTATATGCATATGTTCTACATACATAGATATACAA AAAGTTTTTATATCTACAAGTCTGTAATTCATCTTACATTTGCACAAATG ACTCAATCAATCCTTTACATAGTTACATATATATACATACAATGTGGGGA GGGGGAGAAGCAAGATATTGATTGTTTTTTCGTAATGCACTTATTATGTA TTGTATATTTATTACCATATAAATTCAATGCCTGGAGTTTGTTTGACATA GATGTGTTAAAATTTAACACACTATACCTACACATACAAGTATATTTGCT ATTGTTTGAATTTATTTAAAGATTATGTTTGTAATGGATTTATTGTATTT ACAAACAACTTTTCTGTTCTGTTTTTTAAATTGAATTTTAGTTAGTTTAA TAGAAAATTAGGATAAATTAAAATTTTAAAGAATTAATAATTAGTGTAAG GAGTGGGAACATAAGCTTTACAATAGTATTGAATTGCTATTTTATCGCAG TTATTGTTAATTACAATGTTTTTATTTCTCAACCAAACGATAGCCGAAAC AAAAGTAAACATGTTTTTTTACATTCTATATCTCAAAGTATAATAATGTC GGAGGAACAACAAAAAATCAACGCGTCTGAAATCTCGTTTGGACCAGAGT AAGTGCCGAGAAGGCTGCAAAGACAATTTGCATCTCCATCGAGACTACCT GCAGCATCAGGAAGTCAATTACTGCCAACAATAATGAAAAATTCTGGAGC AAAAAAACACTGCCTTTTGGCATGTTTCCATTTGTCTCTTCTATTGCCCT TCCCTCAACTCCCTGAAATTTGCAGTTTGGGGTGTCTTTCAAAAGAATAT CTGCCGTTCCCCTCATCCAAATTTTGATGCCATCATAAAAATGTTGTACG CTATGTGTACGGCCTTCATCCTCCAGAGATCTCAATCTGTTCACCCGCGT GGCGATGCTATTATTAGTTATGAAAAAAGGCATACTGAATAAAAACTAAA TATGTTARMTAAWAARWTCYTATATGCAATGGTTTGGTTTGATTTTTCTA TTATGTTTTTCTGAATTAACTCATACTATTGACAATTTTGGGTCCCCACT CTGACAATGATAATTTTTGATAAATAAATAGTTATACTTTTGATCATATT TGATATTTTAATTTCCAATTCTAGAAACCCAGTTAAAACACTTGCTTTGG ATAAAAAAATATACTTGATTTGAAATGTATNCTATATATATTTATAAAGA ATGCAATAATAAATCCAGCATTTTTTGAAACTATCTTCTTTGTACTGATT GTAACAATGTCGTAAATTTATTCTCATTGAGTAAAATTTTAGTTATTTTT TAATTTTTTCAAATGATAGCAAAGTAATTAATAGTTTAAATGAAGTCAAT TATATGAAAACAATAGAAAACTGAATGTATTATTACATAATTAATCATCG TCAAACTTTTATCCCACAAAAATAGTTTTTTTTAAAACATATCTCATAGA AAAATTGTTGCAAAATATATTTTGACAATAAATTCCATTAAAATAAACAG TTTTTATGTCTATGTAACATTTTGTGTTGTACCTCTTCCCAGTTTTCGCG CATATTTTGGTATATTTTTTTGAATTATGTAATTTGTAAGATGGAAAATG GTATACAATAAATGTCAATTTATTTATTAGTATAGAGTTGTATATCAAAT TTGAGGTTTTATTATTTGAACAGCTTTTAATGTTGAATGTTAGGGAAATG AGAATAATTTGATTGCTGAAAAGACATTAAACAGTCATTTGTAAGTTTTA TATTAGTATACGTTGCTTTTTAACCATTTTCATGCAATAATTACTCAGTA AAGTTAGAAACAATTCCTAGATAAAGTTTATATGAATATATATTACTCAA ATATGAGAATTACATTTAAAAATGAATATTTGTAAAAATCCCTGGGGCAC CGATAGGAGCCGGCTAATTAATTCACCTATCGCCATTATCAGTAGCATTT AGATTTAAGTAAAATATTTTATTTGTATACATATTTGTTAATTAATTATT TGATTCAATCTTTAAAAAATATTAAATTCAAATACGTTCATATGTATTTA CGTAAACAAAACTTCAGGAAAAAATATCATAAATACTTAAATAATTTCTA TTATTTATAAAAAATTATAGAAGCAATATGGATATTGCCCAATATTCCAT CTGAAATAATCAAATTTTGCCTTTCTCTTACACATTTGATCTTTGCAACG TCTTAAATGAGGGGTATAACCATAAAAAAAAGACCATTGTCTCCATTCAA GCATTTGCTATATGCTTCTCTAAATAATAAATAGAAACCAAATAAATATG ATTGATGAATTATGAACAAAATAGATATACATTTGTTCTAGGTTTCATGG ATTCAATAGTCTTTGTTTAATCACTTGGCTTATAGTTTTGGTCTAAACTA ACAACATTTTGTCTCTTATTTTTTAGTTAAATGTTGTAAATATATTTTTT TGAGGTTGAGTGTCATATTGTTGTAACTCAAAAATTACAAATATAGGGGG TTATTGTAGTGAAAATGATAAAAAAAATAATATATACTAATATAATACCA ATACTCTCAAGTAATTTATCCCATTTCATAAAAATCTTCAATGAAATTAG TAAAATAATCTAGTAGAAAACAAATGAATAAAAAATATGAAAATTATACG ACTAAAACAAGTAGAATGGAGACAAAAACGCAACATTTTTGCATGGATAG GGTCGCCGTCTGTCAGCGCTTTCTACTATCCTACTTTTACAGCTCGAGAG AGCTAAATCAATACCGTGATTTTTTGTAGGAACACTCGAATTTGAAGTGA GCCGAATAAAAGAATACCAGTCACGAATTTATCATTTATTCCTGCTATGT TCAGTAATATAAATTTTTTCAATTTATGTAATAAAGGGCAGGTCACAAAA GCATGAATAACTGTGTTAAACAATTTTCCCCAGTCCTTGAAGGAGCATTG AAGACTATACATCCTGAAGATATTTGAAAATGCAAAGTAAATCATTTTCC ATCCTTAACTTTAGAAATTGAAACAACGATTCTGTTCTTCCATGATATGG GCAGGTCCAATATTTTTAAGAACTTGTCCTAGATTTTTTTTGCTTCCTCC TTCTAATTTAATGCAAAATATCCTCTCAAATGCCAGGGATTGGTAGGCAT CATGTGATTTTTTGCAGCTCTTTTTTGTGGATTAAAAAAATTCCCACATT TGAGCATGTATTCATTGCTCAAATCGTGAAAGAAGATAATACCCCTCGAT AAGCCTAACTATTCCAACTATTTTGGTTCTATGAGGTTTTTAAAATGAAA CTTCTTTTTACAGTTCTGTTGCCCCACATCAATGGTTGAGGTGGATGAAA ATGACGGTGCTCCTTTCCAAATAATCCTTGGAAATAATCTTGGACTAAAG ATGGAGATAATTCTACCAAGTCATCATTTATCATTTATAAAATCAGTTCC CAGCATAACTCATGTGTGTACCGGGTGTGAGGAAAAAGTAGKCCGCCACT CAGTCTTTGGATGTCTTGAAAGGTCAATTAGCAGCTTTTGATAGACTTTG GGCAGTATTTTTGTGAGCATAGATAATTTTTAGTTTGAGGGAAATAAATC CTATGAAATAACTTATTAAGGCATCAATGATAAGCCACATAAAATTGTAT AGTTTATACACGAATATTTTACCTAAAATATTTGCAAGAATCATCTATTT GATTTTATTGTCCTGTGTTGATTAAATTTACCAAACCTTTATTAAGTATG ATGTGTTATCACTTGAAATAAAACATTAAAATCAATAACCTTCAATTAAT TTTGAGACACAAGATCCTGAAAAGTGCCTGTTTAAATGGCTGTTAGAAAT ATTTTCAATATTGTGATCTCAAATTTAAACAGATTTTTCTAGTTTTTTTA AATACCTTGATCCTAATTCAGGATGGATATTGAACACAGCATAAGTAGTG ATTAAGTGTTCGTTTTCACTCGAAATTAGTAAACTTTCATGAAATTTTGT TCTTATATTTTCATATGAATAAATAGAATAATTATTTATGTACAATGTGT AGGAACGTAACTTTAGTTTTCAAAAAAGCAATAAAATAACAAAGTTTTTT TTTTGGTTTTAAACTTTAAACATTTATTCTTAAAGTTTTTTAAATCATAT TAGATATGTGACTTCTCCCATTATTCATTCACTAAGAAAACTGAACTAAA AAAAAGTTGTTTTTTTTCTCTCGGTAAGTAACTTTTAATAAACCTTTTAC AGCCTCATCTAAGAACATAAGTGGTTATATTTTTTTTCAACTTTGTTCAT GTATACACAAGGGTGTTCACAGGAGATACCCAAAAAAATGACTTTTTGCA ATTAGCTAAAAACGTAAAATTTGAATTTTTTTCCAAAAACTTAATATTGG AAATGTTTTAAAACCAATCAATTTTAATTTTTTTTTCTAAAAATTAAATA TTTGAAGTATAATTGGTCAAATTTTTTTTCAAAAACATTTTTTAATGTTT ATTTTATTTTTTGTGAAAAGCTATAAATATTTGAAATTTTTTGTCGAAGA TATGAATTTGAAAAAGATAATTTTATTTAGAATTCCACAAACCAAGCCCC CAAAAAAAATTTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNGTCAACGTAATCGACCWGCAAAATCAACAATTGAACG TTGGTGAAAAAAATTGAATCCATATACACACTACATAATGTTCCTGTGCC AGTGAGACAAAGAAATGCACAAAGTTTAAAAAATATTGCTGCAGCAAGTA CATCAATTCAAGATGTCCCAAATTTGTCTCTTACGCGCCGTTCTCAATCG TTGGGCATCTCTGTGACATCGTTGTGGTGAATTTTGCGAAATGATCTTGG CCTACATCCGTATAAGATCAAGTTGACACAAGAACTGAAGCCGCTTGACC ACTTCAAACATCGGGAATTCGTAAAATGGGCTGAAGGAAAATTCGAAAAT CATCCTGATTTTCAAGGTAAAATCACATTTTCAGCGATGAGACACATTTT TGGCTCAATGACTTTGTTAACAAGTAAAATATGCGCTATTGGCCCGGAAA AAACCCACATATGATTCATGAGGCGCCATTACATCCCCAAAAATTATTGT TTGGTGTGGATTGCATGCTGGCGGKGTCATTGGGCCGTACTTTTTCGTCA ACGATGACAATCGCCACGTTACTGTGAATGGAAATCGTTACCACGCCATA ATAACCGATTTTTTGGCCTGAATTGGAAGATATTGACGTGGACGATATGT GGTTTCAATACACAATTCACTTTACACACAGCAAATGTTACAATCGATTT ATTGAAGATAAGATTTATTTATTTGGTGAGCGTCTTATCTCCAGAAAAGG ACCAGTCAATTGGCTGCCTCGCTCGTGCGATTTAACGCCTCTAGACTATT TTATTTGGAGTCAAGGGAAAGGTTTGGGCTACACCAATAATCCGTCTACG TTAGAAAAGCTCAGAACAAATATTCAACGTGAAATTGCTACAGTTTAAGC CAACTTATGCGGAAAAGTAGTCAAAAATTAGGTTTAAATATTGGACTTCG TAAAACGTGCACGTAGTGGACATTCAAACGAAATCGAATTTGATTCATAA ATTAACTTAAATTTATTTTAACGGCAAATAAATAAATCGTCGATATCTCT CAAACCGTTTTCATTTTATTTAATATAAAATGTGAGCGCTGTTAATGAAA AACCCTATATATATTTAATTCTACGGATGCCCTTGATACATCTTGAATAT CACAAGTATTTTTAACTTTATATTAGGTACATATGATGTATTGAAGACTA CGTATCAAACTTTAAATGTTGAATTATGATTACTTTTATATATATATATA TCTTAAATTATATAATTTAAGTACGATTTTTATAAATAATAAATCAAAAC CTCTTAAATAGAGAAAACAATACTTATCTTCACCTAATTGACCATAAAAA AAAAGCAACGTCTAATAAAATGCAATTATCATTATTTTAAATGACCACTT TGTTTGCAAATATTGTATTTTTGCTAAAAACATATATATGTAGGTATGCA TTAAATCCGTTGCTCATCTTTTTCAACTTTTTGTGCATTTTTTCTCTCAA TAATCAGCGTGAAAAAATTGATCTATGTATTATGTTACGCTATTATTTTA ATAGATAAATTGTACCATATATTAATTGATGAACCAATGAGCAATTTAGC CAATTATCAATTAATTGGCCAAATTTACAAATTTTATATTAAATACTAAA TAGCTTTTAACAAGCCCGGTAAACATCAAAAATAATTATAACAAATAAAT AAGAGTGGAGTTACAAATCGTGGATCGGTGCATCCATGAAGGAATCACAA ATATTAAAGTAGTACTATGATAAATTGAACTCCTCTCTCAACCTCCTTTA TTTTTCGGGATTGGAGAAGTGAAGGATACGCTTTCGAGATTCCATGTGAA TGTGATTCAAGTATATCCTTGTACTTTTACAAAATGTTATATTTGAAACT GAAACAATGGCATTCTTTATAAGTGCATTTGGATCGAAAAATGAGTGGCA TGGAGATAAAGATAATTTAAACTAACTTTCAATGATATACAATTAATCCT GAGGATTATAGACTCAAAAAGAAGATTTGTGGAATTCTTTGGACCCAAAC TATTTTATCTCCATCAAATCAATAAAATAGATATTTGAAATGATTAGACA GCTGAAAAATTGAATCATTCTAAGAGAGACAAATTTGATACTTAGATGTT GTTTTAATTTGATACTTGCTAAGGTCWTTCTTCAGCCATTAATGTTGTCT ACAAATTACAACCAAAATGAAGATAGGAGGAGTCGAAAGAAAATACTTAT AACTTGATCATCTATCTTGCGAGATTTTCAAATTCAGATTTCGAGTTCCA AGAAAGACGACTGGATAAAATTCATTCGATAAATACTACCAGACCTCATG AGGGAAAAAGCAGACTCCTTACTTGGGAGTAAGATACTAGGATTGGAACA ATGAAGAGATCAGTTTAAGATGACAAGAGAATTAAATATTTCCAATAATA CATAATAATAATATATTTGCATTTGTAGGAAAAACTCAAATGCGCACTAT TATCTTATTTTTATAACTTATTTGTTATTATTTATAAAGGCATGACGATA TGAAATTGATATTGAATGTAAACAATATTATGATAATGTTGCCTTCTGCA AATACACCCCCTATAAAAAGTGAGATCACTAAAAAAAGAAAATGAACAAA AATCCTTGGAGATGCAATTTTTTTATCTTTTTTTAAATTATACATGAAAT ATCTTTCTGTAATATGAGCTAAAATATTATTTGTTACTATGTAATAAGAA TAATTTATAAAAATCTAAAGAAAAGTGTTTTTTTTTGTCATTTTCATCCT CAAATTGAAAATACATCGAGTTTAGAAGAAGATACAGAATTATAAAAACC CTTTTTAATCATAAAAAACGCTTTAACATAAGTTTTATAAATCTTGCTTT TAATTTGGGGAGTGTTTCAATGGTAAAAAATGACTGAACCATAACAGTCA CGAATTAATTTATAATTTGAAAAATATTTCAGAATTCAAATTTCTGAGAG AAAAACAAAAAACTGTATGAGATTCTGCGCTCAAATATAAATTATTTTTT TGTGTTGAATTCATTTGTACAGAAAAAGTATTCCCCTTTATTATTTGATC TATCGTTATGAAAAATAAATACAAATGATTATTAAATAAATCTGCTTCTT TATTTACATTTTTTCAATTTATATAAATATATTGCTTTAAATTACTAGAA ATCCACATGAGAGACTTTGTTTTCATCCCTTTTCAGCTTATTATACCCAC AACTTGACTTCTAAGAATAATTAAAGCAATTTAAAAAAATAGTTTTGTGA TTTCTGAACATTCCAAACTATAATTATTTAAAAAAAGTATTAATTTTGAC TTTAAAATGTATTTTGTATTCCAATAACCATGACACACTGTATCGTTATG ATAGGGAATTATTCTATCATAAAATTACTCAAACTATGTTCCATTTTTTT TAAATTTATTTAGATAGGTTTTACTTTTAGAAATATATGAATAACGTATT TCAAATTTATCGATTATAAATCCCGATATTTTCCTTTAAATCAGCATTTT ATCCTTTATATTTTTAAGTATTCATTAACATTAAGCCTGATTATCATAAC TTTCATTATTTATTTTGATATTGCCTTTTTAATACTTATTCGTAGATTTA GCAACTTTTAATTCAGTTTTTCTAGTCGTTCCGAGAAGTAGTCAATCTAT AACAAATAGTATTTTATTGAATCGTCAAACTCATTGTCTTAAGATTATTA AAACAAAAATGCATTTAATTTTTTTAGATTTCTATTATTCATAAAAGTTT TTTTAACTGCTATTTACGAGAGTACAAAATGGTCCGAAAAGAAAAAAAAT TATAAATATTTTATATGACGTATCAATTTAAATCRTTCAACTTTTTATGA TGTAATTAAATACGTTTAAATTAGGTGTTTCTTTTTTAACCAGTTCCAAT AACTGCGGTACAAAAGGGATGTTCACTACCAAAGTGTTAAGTGTCCTATT GCTGTCCATAATAACTCAATAGATAATTTAGCGGCATGAAACTTGATTAA CTTTAGTTACTGTTTAGATATACATATTCACTTTACAATTACATATTTAC ACAAAACAAGTTTCATATGCTATATTTTGTTCTCCATCTTTATGAAAAAC AGGTGACGTTTTTGATTGATCATATACGGGAAAACATAGCTTCAATATTT TAAATCTCTGTATTTCTTTAACTTTTTTGTTCATCCTAAAATAAATTTTT ATTAAAAGATATTAAAGGGATTGTTTCTTTTGTTTTTTGTTTTACAAAAG GGTGCATAATTTAGTAAACATCATGCCTTATAAGTTGTGTATGATTAGTT AATAACGTACTTAGTTAATTGACAACTACGCAAAGGTCTTAAAAGTGTTA GTTTTTCATAAATAAATCCAGTTCCATATACCTGATAAAAAAGTGTACAA GGGTACATACTAACATACAGAAAAAATAATTTTTAGAATTCTATTGTCTT TTTTACGTTTTAGATGAAGTAGTCATTTGGGGGACAAAAAATTATTTTTA TTAAAATATGCAATTTTAAGGCTGCCGTAGTGTTGAAAGGCAAAAAATTG TTACCAAAACCATATCTAGGACCTAAGAGCCTTGAGAGTGTAACATGGAA ATTTTCTGTCTCATTAAAATTAATTTTTTGTGCTACTTAAGGTTTCAGGT GACGTTTCAAGCCATGTTCCAATACATGTGTTATTTTTCTTGACATTATT TTGATTTGATCACAATGGGACGAAAAGTAAGTGAACAGGAATAAAAAAGG GAAATGATTTTGGATCCTCTCAACGTGGATGCTAAACCAAAAACAATTTC AGACATTTTTGGTGTGACCGTGAAGATAGTCCAGAATATCAGGATGGCCA AGGAGAATGGGAAATAAATCAAAAGGGAAGCAGAAAGTGAAAAAAATGGT TTGAAGCGATATGAAATATTACTCAAGTCCCTTGAGGTCATGATCAAGGA AGATTCAAAAGCATCAATGTGCACTTGGCTGACGAGTTCAACGTTGACAA GATCACTATCAGGAGTGCAATTAATGATGATTTGGACCTTAACAGCTTCC TCAGGATTCAAAAAGATCTCATCACCAAAAAAAATGAAGGCATTATGGGG TGAGAGAAGGAAAAAAGTCCTTAATTACTCATCCGTCGACTGTGAAGATC TCACCAACAAGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNATCACCTGAGGATGTACAAGGTACCTTCAGGACAAA ACATCTGGACCAAATAATGTGCTTGGGAGTCGTGGCATCGGATGGGRAGA AAATGAATAMCTTCTTYTTYTCTTCTAGTTATGATCTCTCATTTCCCTCG ACTTCCGTGTGTAAAGCATCTGAGAAAGTAAGGTTGAGAAGGCATCCCAC AAATTAAGCCGGCATGAAGAAGCAATGGGCCTACATGTCTGTCAATTACA TTGCGGCAACCTCTGCAAAGTTTTCAACCTAGTGTGGAGTTTGTGAAGGA GGATGGAGGCGGCTATATTGAATAATTATTGCTAAGATTGATTKCTAAAA GTTTTTTCAATCACATTTTTCATTATACTTTTTTTTAATAAAAAGTTAAA AAGGTTTTTGCTTTGCTTCTGGAAAATTTCCCTGTTGCACTCTGTACATG AAAAATTTCAGCAAAATCCATTCCTCGGTTTGGTTGTGAAACCTGAACAC ACACACACACAGACATTTACATTTAATATACGGATTAATGTATGTAAATT AGTGTTTCGAAAAAGATCCTATTATTACTTATTAATGATTCAAAATAATA TTTATAAGTTAATAAACATTATATGTTGTTGATATGTTTGACATATATTA TACGAAATATACATTTAAAAAAGGAGTCGGAAAATTGGAAGAAGAAATGT GCATACACTGAATATCTATGTATATTTTTTTTCAAATTGGCAGTGGCTAT GTATGGCTGTTTGATCTTTTTGTTGTTTTTTTTTTCTATTTTATTGAGGC AAGTCAATCTTTAACGACTCATGTTGACACAACACTAAATATATCATAAT AGACAACATTAATAAATGATAAACCTTGTATTTACTGTCAAATATGATGA ACAGTTATACAAAAAGTATAGCTAGATATAACACACACATCAGTATATTA TGTATTTTGTTATAAAGGTGCTATACGATATTCATTATCATCCTTTCGTT AGTAAACTAATTCCATAAAAATATTTTAAACTACATTTCATCACGATAAC TTGATATATATGCTTCAAAAATGTCCAGTCTAGGTAAATATAACGATTTT ATTTTTGTAATAATGTCCTTTTTAGGAATTATTTTTACTGTATTATAATT AAGATTTTTTGAATTCAAAATTTTTCTTCGCTTCTTAGATCCTTCTATTG TTTTTCAATTTTCATCCAATTGAGGAGTATGCGTTGCTACTTAATAATAT ATGCTGCAATTCTATGTATTATACACAAATTCATCACTATTATTTAGTAT CTAATTATTTCACTAGAATATAAATCAAAAAATAAATAATAATATTTTTA TTATTTCTTATTGATACCCAACAATAACAATCTTATTAAGATTAATTAAA AAAGAATATTGGATTTTTCATTCATTTCTTGAACTCAAATACATACATAT ATAAGCATATATTGCGTATTTTAATTGACATTCACAAGTGTGAATGAGAT GATATAGCTAAAGAAAAAAAAATATTTCTTTTTTTTAGCTTATATAGCCT GTGTATTAAGTAATAGTACTTATTTATTTTTGGGTTTATTTCGTATTTTA AGAGCTCTTATGTACTTATATAGACAAAGCCACAACATTTTTTTTTTCTT CACAATAAGTTCTTTCAAGATGTCTTATTTTTTATATATCATTATTTCTA ATCTGTAAGTTACCTACATTTATAGTCTCCATTATTTTGTTATTTAATTA AAATCTTGTTAAAAATATTTTTTACTGCTATGTGCCAAAAGTATATTACT TGAAAATGTATTAGAAATAAGTATGATACTATTAAAAAATATGCTTATGC ATTTTGACCAAGTGCATCAAAAATCCTTATTATCACATGAATTATATTAA TAAAGTAAAAAATATATAACTGTATTTTATGCATCGGAAAAAATGTGCAA ATTAAATATTTTTAAGAAATACCTTTTCTTCTGTGTACCCAAAAATTCAA TGCTTGACAATTCTGTGGCACCTATTTTAAATTTTTTGGGTCGAAATTAT ACATTTTTTGGTCTATTATACCGTTTTAAATATTATAGTATGATTCAGAA ACAGTACTTTTTATATTTTTTAAGTACTCAGTACTTTAAGTATGAAAATA TTTTGCACTTTATTTTAATTACTATTTCTTTTGGTCTTAAATTGACATAA TGATTTACTTTTTCCTAGATTTATCATTTTTTTTTCATCACCTATCACTT CACTGATATTTTCTATTTGATGTTTGATACAAAGGAAAGAACAAAGTAAG GTCAAAAATTTAAACCCCAAAATGCAGTTTTTTCAAATTAAAATGTACAG CACCTTTATTTAACAAACAATAAGATTTTTTCTCAAATAGTTTTTCTCCT AAACTACTCATCCAATTTTAATTAAAACCAATACCAAATGAAAGCTGAAT GATAAAAAAAATGACTCTCTATAATTGTCTTTGGCGTCAATAAGGGCCTC AACTCAATTTTGGAAGTAGGACTTGATTGTGGTCACCTTATGTAGATCCC AGAATTCCTCCCAGATTTTTGAGATCAGCTAAGATTTTGTATTGCAGTAG GGGATCTTGGTTTGTTCTTTAACTGTGCCCTACATAAATAAATCCATGGG GTTAAAATCCGGTGAGCTTTGAGGCCAAACACTGTGTTGAAAAAATTTAA AAAAATGATTACAAAGTCAATATTTTCTTTGCATTGTAGGATACAATATC TTGCTGTAACCGCTACTTGTTGTATAAGAGGCAGCTTGTCGAATGAAAAC TTTGCACAAAATTCCCAAGTATATACTATATTAATCAAATTTCGTTTTGA GGGTTTGCCAACTTTGTAAAATAAGAAAACGATTAATAGATAAAAAATCC CTATTAAAATTAATAAAAACTAATATTGACTTTTGAAAGTTTTTACTTAG GTTGAAATTTATATTTATGTTTTATTAATGATAAAACAAATAGTTAATAG CAATATTGGCTCGATTGATTCTAAAAAAAATTTCCATGAAGATCAATACA TTTTTGCATATGTTGAAACCAGTTTTGAAAGCATTTTGTTTTCATTTTGA TTAAGGTAGGTCCAAAACATGGGCTTTTATTGCAACAGTGGCTTCTTCTG CTTTTGAAAACCGCTGACCACAAAATTTAGTTTAAATATATAAAAATAGA AAAAAAGTCTTAGGAGGCTACAACTGGGCTATACAGCGGATGGCCCAAAA AGCTCTTTCATCAAGACGAAGTGCGAACACATTTATTATCATACGCAAAA CTTTTGTAGGATTAGGCTCATCTTGAAAGACCCATTTAGTTGATTCTGTT TCAATTAAGGCTCTGTAAGTATTATAAACAATTTTGTATTCATCCCTAAT AGTTTTTTTCAGCATTTCTTGACACTAATAGCACCGAGCCTCATTTCATA ATTTGTCATATAATGTGAGAACCAACCTGAACAAATCTTCTTGATAGCTA AATTTTAATGCAAAATCCTGTAAATTTGGTCATATTCATCTCCAAAGATG CCTCGATCTCGTGTAAAGTCACATGACGATTTTGGTTTAAAATCACATGC AATAGTATTGATGTATTCTTGCAAAAAACAATTTGGGCGACCTTTACGAA AATCGTGGTAGAGCGAACTCCTGCCTCGCTTGTATTTTTAACCCATTTTT TTATTGGACTATAGGATGGKACATGACCCTTATATTAGGTCTTAAGTTTA TTTATGCACTGTTGCCTTGATAAACAATGTCAAAAATCCTGAAAAATGAT TGCACAAAATGTTCACAAGTAAATTTCATTTTTTTACTTAGAAATTTTTT AAATCATTAAAAAATATTTAAATAACAAATTGTTATTATAAAGATGATAC TTGTAAATACCTAGTATCAACAAGTTACAACAGTGGAGCTTACAAGGCAA TGTTTTTTTGAAGCCAGAAATATAAGTAGCGACCTATTTCTTTGTCAAAA TTAATTAAATAAGCAATTGAGTTGTATTTTAAGCTACACCCACATACCCT CAGGCAATTGTGTTGATAAAAAAAGTTACATATTTTTTTAAGCCATAAAT AATTAAATAGACTTAGGCTCTTATAATTAAATAAAAGTTTATGAGGGAAG CATTTGAACTCAAATTGATATACATTGAGTTAATAATAATAATATTAGAA TATAACATGAACCAAGGCCTCAATATTACTCTTTATCGTAGATTTTTATT ATTTTGGATATTCACAATATTTACACTCATTTTACACTGTGTGTTTGTTC TAAAATAACTTTTATAATTTTTTAGAGCATAAATATGATTCAAATACTAT GAACTATTGTTTTAATTAATAGTTTCAGTTTCTAATTAAATCTAATGAAA AATAAATAATCTTATACAAAACCTTGACTTTTATTAAATGACATTAGAGG AATCTTTGTCAAAAGACGTGACAACAATGGACTGTGCAATAGAAGTTGAA AGGGCATTTACAAAATTTTAGGTGAATCAGAATTAGAGATAAGAAAAAAC CTTTTGATTGATATACATGACTCCTCTTTCTCTTATACTAACATAATAAC CCGYTTATTAGATCTCCAACAAGGTCTACCGGTTTTCATTTTCCCCTTTC CTTATTTGTCGATTTTGATATTAACGTATATCTTCATTTTATACGTGGAT AAAATGTATTAAAAGTCATTCATTAATTAATGTATATTATTTATATTCAA AAAAAGGGAAAGGAAGGATTGTAATAGTAAATAAACTCAAATTCTCATTT GTTTGACATAAAAAAAACTATTAATTATTTTTATGTCATACCTTCTGCTT AAGTGTGTTTAAACCCATTACGAAAATATTATAAAATATTTTATTTCAAA TGTTAATTTGAGAAGAATAAAATGTAATTAAAGTAAATATTGCAAGCTTG TAGCATCAAATATATTGCACTGTCTCAGTTGGTTTTTGTTTTTGCTCTCA TACATATCTTAATTAATAATGTTACCATTTAAATCAAGTACAAATACTGC AATGTAAAATGAATAAACTTTTGCTCCTGTTTTATGTATAATACTGGGAA CACTTTTTTTTGTGTAAGTGTTCTAGAGCCCATCAAACTTTCCATTATAT TATTTTTTTTTTCCAATAAAGATGTTATATTTTTTCATTCATAAGGAGAA AATATATATGAATTAATATAAGTATGGAGTAGTTATATATGAGTGTATTC ATGGAAAAAGGGAGATTAACAATGAGGATTTGTCGAAGAGATATCTTTTC TATGATAAAGCCAAATTTGTCTCTAAGACGACGCTTAGTTACTCTGGGCA AGGCCGAGTACTACTAGTAGAAAATAAATAAACAATCAGTCGAAATTAAA TTAAATTCAAAGTGAATCCGCTGTTATAGAACTCATCGAAGGTAGTGTTA AAATTATAGATGTCCTCGACGAAGATATAAATGAACACACTTACAAAATA TAAATACAGTCTTATGATAATTGAACTGCCGTTGATTTTTCATATACTAA GGAATACTGACTCTATTCATTAAACATATTGTCGAGATTGTCAATGGTGA ATGTAATATTCTGGACTTGAGTCGTTTTTAACTTTCTCAAAGTAGATGCA ACAACGTATAATTAAAATTTTGTGACTCTTGACAATATATCAACCAATTT TTAGAAACTTGAAAAAAAAGGGATTCAAAAATATATATTGAACTACAAAT TTATTACCTTTAATTAAAGGTACAGGCAAAATTGCAATGGATTTTGATTC AACGTCGTAAGATGCTCAAAATATCAAGTTATAAAAATAATCATCTTTAG TTATGGATTGGTGTAAAACTATAATACATTTTTTTTACAAAGTTAAAAAA AGTATTATAAATAATTTCTAAAATGATTCATTATTATAATCAATAAAGTA ATTGTATACTCTACAAATAATTTATTGACTTTTGGTTGTAATCTTTGAAA AAGTAACACACCCACAAATATATTTTATTCTAAAAATAGAGAAATAAATT TCAATATTCTTATCGCATTTATCTAGTAAATTTATCAATCTCAATAAAAA TGCAATTCAATCAACTGAGTATCTTTTAAAGAATTTGTTATATATCAATA ATTTGGGACAAATTCTATTCATTCAAATCCATCTATGTGCAAAAATAAAC CTTATGTTTTTATTAGAAAGGATCAGACTCTTGAAAGGAACACAAAATTG AACGTCGTTCCATGCAATGTGTATTCAATGAACGGAACATATTTTTTTAT TTTTACATTGAAAGTTCAACGTTAAAAATGAGATTTTAGCGTTCTGTTAC AATAGGACTTACAAAAAGTTCAATAAATTATTATCTAATGGATCTGATTA AGCAAAGAAGAAAACTTCGGTGACTTATTTTTGAGGCAGTGGTACAGGGA ACTGAAGGGCAACTTTTCAAAGGATTATATAGAAATCCAGAAACTGGAAA AATTATCCTCGATTCATTTAAGTTGTCCTGACCCCTTTGAGTAGTTGGAC TTCGCCCAGGGTAAGACTTTATCCTTGAGGACGTCCTGTTACTTTTAGGC CCCTATTTTTTGCCCTTTCGGGAACCAATATAGAGTCATCCTCTTCCCGT CTGATGTCAAGATTCCCAGCATGATATTCGAACCTCATCAACCGCGCAAG TGAGATAGCAGTAGTTCCTGGTGTTTTTTGACTAGTAGACGGTCCCGTTT TTCTTGTCTTGTTGCTGTGCTGTGTGGAATAAATCAGCTATTCTTTGACT TTTGCCCTTTATCTTGACAATGAATGAACCGACTTTAGTATATTGTAGTT CATTTGAACACTAATATTCACCAATTTTTTTTTTTTTAAACTATTAAAAC CTAGTTCTCAAATGAGGTCTCCCTAAAATTGGATCTAGCGATTTGGTGTC GCACAGCGTATATGGTTCTACCTTATGATTTGAACTAGGAACGGAACGCA AGTCATTGTTCAACATTGTCCTGAACGAAAAAAAAAATGAATGGAACGTC AAAATTGCAGAAGGCTTTCAAGCTTAGAAAGGATAAATGTTTATAACCCA TAGTCACCCACTAACGTCCAATGGAATTGAACTATATTTTTAATTAGTTC GTTTCGATTATTGTAGGCGTGTATCCTATCACACAACTTTCCTTCCACGG TTCATTTTGAAATTAATTCCTTCAGACGAACATTCGTGAATTACTTTACG TTCATCCTTAGATTTTTTAAACAAAACAACGACCACCCTATCAACTTTTG TCAACATAGAATGGGCTTATAAAAAGATCTCAACTTTAAGGTACAAGAAA TGTTGTTACTTGATCATGTTTCCTTATTACAGAGTTATACAGTAATTAAT GGTACCCTCAGCCCTCTAGTGGGACAAAATATTCACGTTGCCAATTAAAA TTTGACAACATAGCTCAAACTTGAGGAATAAATTATTCTCTTGAAGTGAG TGTGTGTATGTTCCTACATCGGTCGCTCCCAGAGAAGGAAATATGTATTA TGTATGTGGTTTTTGAAGACGATTCCTATGTGAGATGGAGTAATTGTAAT TCTATAATGTTTACTTAAACTTAATCCGTACAACTCCATCTGCCCAATTA GATGAACATTAAAAGAAGAACAAAAAAAGGGCATAGTTTTATTCCTTGCT TTTAGCTTTGATCCTTCAATAAAATATATTTTTGAGACGAACAACTAAGT TGCAAAGAAAATTAAGACAAAAATGAAAGCTGTTTAAAATATTTTTTCTG TTCAGATGAACGTAGAGCAAAAACACTTTTCTTTTACTTTTCAATATATA TGCCTAATTATTATTTTGTTATAGTTTTTGGAATAATCCTGAAAAATATT TGAAAAATGAAGTTTTAGGAAGAAATATTTACAAAAGTTATTATTTTTCT TTTTTTAAATTACAAATATTATTTTTTCTTGTAAATTAGTAAATGCAAAA ACTCTTAAATTTGGGGAGGGCTAAGTACCATGCAAGCCACCCATGCAGAT GCACTTGCAACTTTATGCACAAAAAAAAAAAGATTTTAGCTTGCTTTTTT ATTGACTGGCTATTTATGTAATATAATTCCAAAGAAATCATAACAAGGAT TATTTTTTAATATTTAGATTCTACATTGTACATCTTATGAATAATAATAT ACTTCTGTCTTTCCATTAAATGAAGACAAAACAATATTTTTTGACATTTA TGCCCCTTAAGACACTGTTCTGAGCATAGTTTACTTTTTCCCCGAAGTGA TTATTACTAATTTCCTGAATATGAAACTTTTAGAAAAAATATATACCTTA CAGCATTATGAAATAAAAAATAATTTGCCTATCCTAATAAGTAATGTTAC TTGATTTCAATTAGTGTAAAAGTTATTACTTTTGTAGAGGCATTTACATC TTAATATTATAACATAAAACTTATACTTTATAATAAATAATATCTTGTCT AATTATAGTTTAACACAGATTACAAAATATTTTTTTCTGCCCATGCATCA GATCATAAGTAAAACCATTATTTTTGCCAAGTAGATTTTTTGTATAGGTT GTATTCATAAAACATGAATAATAATGGAATTGAAAAACATTCCAAAGACG CTCTGCTACATACAGCATAAAAAAGGTAGCCTATGTTTAATACACCAGTA CGACTTATAAAAGTAATCTAACAAAATTATTATATTATTTATTAAAATAA ATTTCCTATAAATTATATTAAGTTCATAATCAGTTATTTGATAAGAAACC ATATTAGGATCAAGGTCGCCAGATTTCATCTAGTATAATATAAAAACGAT TAATGTATTTTAAAAGTATTGATGCATATGTACGTGTTTATTACTCACAC TTTACCAGACTTTAAAGTTTCACTGATGGCTATAACTTTTTAGCTATTTT TGAAAAGATAAAAAGTACTGAAGTAAACATTCAAATAAAGGAAAAGTTGT TTCAAATCCTCAAAATTTTATTTTTATTTTATAAACACGATGCTAGATAA TATTCTGTATATTACATTAAATGTATATTCATGAATAAAGGAAGAGTGGT ATAACCTTTAAATAATCATTCAAATTTCAAACTTTGAGAAGTTCATTATT TATTTTTGTCACAAAATTCCAAAAATCTAAATTTGCGAAGAAAATTGAAA AAAACAATAACCTTATACTACTAATTTTGAAAAGAAAAGTAGAAAAAAGC ATTTACGTCATTGCAAAAAGAAACACAAAACCTTGAAAAACCTTTTTGTA TTTGCAAAACCAAAAAAGTTATGCAGAATAATAATGTCTTGAAAGTAAAC CTCAGCTTCAAGTGTGTTTTTCCATATATTACAAAAATTAGGGAATGAAA TTTTTAGTAAACTGAAAATAATATGAGGACTAAAAAAAGTATATGATATA CTTTTATGCCTAAAAAGTATCGTTTTATGGCATTTTTGCTTAAAAATGGA CGTTTGAATAGATAAATTAAACAGAAAATGACATATATTTCAATTAAACA TGAGTTTTTACGTGTCAAATTCAGATGCAAATGAATCTTTAAACAATTGT TTTACAAAATTTATTTTATCTGCGAATGTAATATTCCATTGGTAATCCAT TTTTTTGCAACTGAAAAAAAAAAATCAATGTTTCACAAATTTGCTTTTTT AACCATAACTTTTTCATTTGGAACAAATTTAGAATATTAATTTTATAAAG TTGTCTTTTGAGACGCCGGTCATTTTTTGTTTGATAATTAAACACCCTAT CAAGTCTCCTTGAGATCTTGAAAATATTTTTTGTTTTGGGTTAAAATAAG CCCCCCCTTTTTTTATTCCTCCAAGAAAATTGGGACTCTCGCCTAATCCT CACCAGGTTCAAAGGAGGCACCCTAACTAAGTTTCAGCTTCGTAGGTCTT ACAGTGGTTGACCCCTACAAACACCCCAAACTTTTTTTTATATATACAGA TAATTAAGATGTATGAAATTATATAAGCATACATTTTTATTTTATATAAA TAAATATATAGGTAATGATGAGGTAAGTTAATTCAAAGTTGTGCCAAATG CACCATAAAAGGTAAAGTGAGAATTGATGTCGGTGCGACATATATATATG TATTTGAAGTATTGGGTCAAAGGAGTTGGTAAATTATAAGAGATAATAAT AAAAAAAGATAAAAAATAAAAAACCTCACTGCTCATTAATGAATTATAGA TAATTTTACACTAAATATTGCCTTTTAAGTGTATTTTTAGCTTTTGATTG ATTAAGAACAATTTCATGTCAAGGCTAAACATAGAAAGTTACAACAAATA ATGATATATTGATTTTGTCTTGTAGATATTATTCTTTCTAGATATTTATT AATATAGGTTTGATAAGGACCTATATGGTGAAAAAGTTGCTGAATCTCTC TCAAATTCTTTATGACGAGTACAAACCATATTGGCCGATAATTTTTTTCA ATATCTCATAATAGTAGAAACAATTGATAGTAGGAATCCTTACTTTTTTT ATTATCTGGTAGTTCCTTCAAAAACATCAATAAAATCTCATTTGCTCTAA AAAATAAGTTTGGGTTTGATTATTACAAAATCAAAAGTGTCACATAAACG TTTCTCAATTAATGAGGTTAGCGATAAAAATCAAGCCGACTCGCTACAAA TATGAAAACTATCTATTTAAAATATGAAGTCGACTCAGTAATTTTTTGAA TTTGAAAAACGGCATAATCATTTAAGTCGATTAAAAAAATCATCAACTCA AGTAGAATCGAGCCCAGTGGAGAAAACGTGGCAAAAACAAATATCTTTTG AATTGAATTTTTAATTCCAGTAGCACTTGTATAAATTATCTTTTATCGAT AAAACCCTAATTATTCATGATACAAGTAAATTCTTTCCGCTTATAAACGA CTAAAAACCAAGGGCTAATCACTTTTCAGACAAAAACCTACAAATATGGT GGKTGAAATTGTACTTTATCAAGACTGAATAATCATATTTAAATGTAAAC ACTTATTGAAAATATTATTAAAGTTTTCCAAAGACTAAACAAATTTTTAT GTAAACTTTTTCTCATTTCATTCTCAAAAGATGGCTCAAAACTATAAAAA TGGTAATAGCGGACAAAAAATACTTTTAAAAAAATTTGTGGACTAGTATG ATTGTTCAAGTCGACAAATCTCTTTTTTTTATATATATTTCTCACTTTGT TGAGAAAAGTAAAATTATAATAAAAGGATTTATGTTACACAACATGTTTG TCATAACATTATTTAAAATTGTATTTGCAGTTATTTGTATACCCCTAATT ATAAATAATCTTTCTGCTGATTAACTTGATCATAAAATACACACATAAAT ACTATTATATTCATGATATCTGTCTAGACAAATATTTTTGCTCATTCTAT TTAGATAGAAAAAATGACACATTTTATCTGATTTAAAAAATTATATTGTT TCTGCTTATGTAAAAACACTTAAGAAGATATGAAACAAGTATTAATCAAT GGTAAACTTTTTTTACTGTAGAAAAATACATTTTCTTTCTTTAATTACAG TCAAGGTATATAAATGATTAATTATGAATTAAGATTTGCAAAGAGACGAT TCTAAAAAAAATCTCAATGCCGATTCTCAAAGGATTTTGTTAAAAATTTC CTATGCTGATTCTTAAATATTTGTAATATTAGTTAAGAATTAACATTTTG ATACAGATTTGTAATAATTACAATTAAAAATCGCCTTCCTTTTTTTAATA AAATAATATTATTTAAAATAAATAAAGGAAGGGAAATTTCTGCCAGCGAG CTTTTTCTGAGACAAATGTTCTAGGGCGAGCATCCCCACAACAAAATTCC AATTTTTGTTTTTGTCAAATATTGTTATTTTGGGGGAATAAGTTTTGTAA AAGGATCTAGTTTGAGAGCGTTCTTTACCGAACTTATTTTAAGATTTGAA TTAGTTTGGTCTATTAAAACTCATAACAACCCCTTTACAAAACATTTTCT CTTAAATTATCAATATTTGCATCACTGCATGTGTTTAAAACACTGTTGTT NCACGTTTTACTGGTGTTCAATTTGTTTCTTCTCATTTTTTGAGCATTTT TTATCAAAAATTAATTTATTACAATRTTTATAAAATAATAAGGCTCAAGT AATAAATTCACATGGTCTTTTTTTATGTCTTGACGGATGTAATCAATATA TTTTTTTTCATAACTTAGAAAAGTAATAAATAATTCAATACTAGTTAAAT AAGAATCATAATCCCAAATTTAATATTATTTCCCAAATGACAATTCTAAT TCAAGAAAAAACACCTTTTTCTCTGATTCCAATTAATTGTCCCATCACTA ATAGAGGTTTTAAAATTAATATCTTTGCTACATAATCTTTTACTAAGTTA GCACAAAAAATATGTTTGTTTTTTTAACAAATTAGCCTTAAAACATGGTT GAAGTTGCAAAATATATAAATTGCCAGTATGTTAAAAAACGAAACCAAAA AAAACATGGCAATCCTGATATCTTAAGTAATGTTTTTTTATTATATGTCA TCAAAATTTGATTATATTAGCTGCAATAACACTCTCTATTTGTAAGAAGA TAGACATAATCAATTCTGCTGTTAGTCCGTTATTAACTTACACTTACAAT TCCTGTAAAAGTTATCACTGCTAGTGTTATGTTGGTCCTTATTTAGGACC AAGGACTGTAGTCCAGTCCAGTCCCACTTGTCAGCCCTTAAAGGTGGTAA AATCGATCCCTCGTGACGTCAATGAGGATGTTTTTGTTCCTTAAATTATT CCCTTATTTAATAATAAATTATAACCCAATTAATAATATAATATGTTCGT ATTATATTGAGATATGTGCCATAATCTGAATACATATTTTATATATCATA TTTGGATTAATAAACCATCGATATTTGTATCAAAAATTCCTTAGACCGAC TATTAAATTCCGAGTTTGAGAACTGATGGTCTTTAAGACCGATAAGACCG AATAAATAAGGACTGAAACAACACTTATCAGGGATAACTTTTTTTTTAAA GAATATGTTGGATAAGAAGGAAATCTTGTATTTCATACTATCAAAAATAG CAAAAAATACTATAATTTTATCTATTGGTTAGTTTATTTTGCTTTTAGAT GAATAATCTAAAAATTCTGAGAACCTATACAAAGGTTTCGAACATTTGGT GAGTCATAAATTACTAATTCATGACCTAAATATATTTTAACATTTCCACA ATTTTAAAATGTTTCCCTACTGTTAAAATCTCTTCCTATTTGGTATTTAC CATTCACATTCGATAATTTCTCCACATACATGAAAGTCGTAAATAATTTC GTCATGGGAAATTTAACTGCAAAATAAATATATTTTACAAAAATATCCCA TAATTTACTATTGAGACGGAAAAAAACCTGATACAAATGGAATATGTTTA TTATAATTTATTTTTTAAATTGTATCTATGAAAATATTCCAATTTTACCA AAAAAATATTATGCTTATTATTAGAACTGTGTTATTTGTATATTCATGAG TATGTAAAGAATGAGGACTCTCTTACAAAACAATTATTTCTCAAATGAAA TACTTTAAAAAAAGTTATTATTTTATTCTAACTTAAAATAAACGTAAAAA AACATCCGTGTATTTGTCAATAGAAAAAAGTATTTTAATGGATAGATTTT CTCTAAATGAGTTTACTGTACATTGTACACAAGAAATAAATCCTTTGTTA AAGTTTAAAATACACTAAACCTTACTTTTTGTTTGTCTCAAATATTAAAT CTAGATTACTGCATCTGTTATGTGTATACACTAGGGTGATTCTTTTTTTA ATATCTTACAAATAAAACCCCTTTATATTACAGAATATTTTAATTTAAAT GTCATAAATGAGTTCATTTTTTAAAATATGTGAAAAAAATCCCCCTCTTT GTAGATTTTAAAATTCTATTTTTATTAGAACTCCTTGATCTATTAAATGA ATTTGTATTGTAACATAACAACTCTTTCTGATGATAAGAATGATTCATAT TAATGAATGCAATCATGATGTTATTTGTTGTATGACTGTCTCTATACTAA CAAAAAAAGTATTTTCGTAATCAAATCAAATAATAAGTGTAATCATCAAC ATTATTTATATACATTAATTAAAATGTTCTGATTTATTTACATAAATGTA CACATAACCTTATTAATTATTTTTTTCAAATCCTAAGGCTATGACAAACT ACTAATTATATATTATGTATATTTAATGAAAAAAAAACTTTGAAAAAGGT GAAAAACTTATAATTGTATAGCGGGTGGTGCATTGAAATCTGAATACTTA CTAATTCAATAAATAATAAAGGGTGATATATATGAAATTAATTCATATTT TGGTATATTAAAACATAAACAATTAATTACAACAAAATAAAACAAAACTG AGCCCTCTAGCTTACTTGTAAGTATAGAAATTGACTCATGTAATTCGACA AACTTCCGTTCACCCAATCCAATCAGTTGGGAGTATCCAGGACCACCATC TACACATCAGCAAGTACAAAACGTCGGAGAAGATGAAAGCCTCTGTCAAA AAGGACAAACTGGACCTGAAGAGTGTATTAAGAAAGACCAAAGAAATCAT CTCAAGTCAATAAAGCCCCATGCGAGAGATCTTGGGGTATCACATCAGGC TGTCCAGAGTGTTATCAAAAAAGTGGGCGGAAGGAGCCTTGTTAAGGTTG ATAGAAACTCATCTTCTCTGTTGCAAAACTCCTTTTAATTAGTGTTTTAG TTATTTTTAACTCCTTTTTGTCACTTTTGGCTCCCTACAACCCTGATACT CCACCTACATGGTACATCTTTGACAAATTATGAGTCAATGATTAAAGGGG TAAATAAAAATGAATATTTAACGTAGTATAAAATACCACTGGGAAATTTA TGAAATAATTACCAAAATAAAAATAAACATCCAAGCTCTTTAACCGCTCT GGTAATCGATCAACAAGTTCCAAAAGAACTGAACCACTTTTTCCAAATTT TCTTGGTGTTCTTCAGATTGATTTGCAGACTTGCACTGATATGTATCAAA TGAAAGTAAATAACATAATGGAGAATGGAGGCACCAGCCTTTTATGGGCT TATTCCTAATCCATTGCTTACATCCATATTTGCCAAAATATTCTATCATA CTCTCATTGAGATCAAGGATTTTGTCTTATTTTGTGCATTTTATCAGATT TTTTTTAGTTGATTGTTGTATGTAAAGTGAAGACAACGAAGTATTGTATC AAATCTGTCTCCGGAAAGAGCTATGTATATAAATGCATTCCTTACATCAC TTTCCTAATGTCAATACATTCTTCTATGTGGTAGATAATTGTATCAGAAA GTATGACAAATACTCTCTGAAATTCTTCTAGACTGGAATGAAAAGAAACA TTATTCTGCGTTGCATATCTTTCATATTCAGCAAGAATCAAATGTAAAAG GTAGTCGTCGAAAAATAAATAAATTTTTGTAATGATGTTTTCCCATGGAG ATCAACCTCAGGAGTAACTGATGCTTTACTTTATTTTAAAACTTTTGGAT TTGAAACTTTATAATTTCTTCCAACTATAACGTAATTGCTACTTTTGTGA TTTTTTTTATTTTTGGGTTGGATCTGAATACTTCACTTGACTGAACATAA TTGAGAATTAGAATATCCAGGGGCCCACTTAACATATTTACTTCTTCATG AGCTCTAAGTTGCAGACCTGATAAACTATCTATCAAACCATTATCTTACT CAATAGAATCACAATCAGACTCTTCATGAAGTTCTGATGGTGCAAATATA CCCTTTCAACTTATTCTTCATCTTCTTCAAAAGGGCCAAAACTTTTTCAA CAGTCAAGCTGCGTCTAAAAAAAATATATTTGTTATTTGAACAATAATAA TAGCATCCCTTCAGTCAGTTAAATAAAATAACTATGTGCAAGAATATGCT AAGTCTAAGTCATGGATGTAATTATTTAAAATCAAATTGTACTTCATAGC TTTCGAACCTACTCTATATAGTAGGCAGTACTTTAAACCTCAGAATTTAT GTTCTATTATACCCAAAGCAATGAAAATTGATATTATGTAAGTTCAACTA AAACTTTAAGAGTCTGGAGAATTTTGTAGCCCTATGTTAATTTAAATACC AGTTATTACTCACTTAAAAATTATATGTCCTTTTGTGTGCTGCTAACGGT CGTGTATTACCTATGGCTCCCMCTGATTCTTTAAAGCAATGATGTATTGT CCTCTGGTTTAAAACGAGCTAAGAACTTGTTGGTATTGCATCATGTGTAA TTTCATCAAAATTAATCTAAAATTATAGTTGCAGGAGTTTGCTCCTTCAA ACATAGCATATATAGTAGTTCAGGCGTTAATGGGACTAATAACTCCGTAT CCAATCTTCTGTTTTACATTTTACCATTCATTTTTCAGGTTGCCTCTACA AAAAGTATTGTGTTTGTCCATTTTCATATGCATATATAATAATTAACAAT TACTGAGGTCAAGGCATGAATACTGTTTTGTGACGTCAATATTTGTGAAT TTCGACCATCTTTGAGGTTTAAACAAGTCTTTCAGAATAAAACCTCTTTT TTCCTTTAGTTTAAGAAAAATGATTTCTGTTTGGGTGTTAAAGTGGTGTT GACAAATATTATGATTTAAATAATTACGGTTGATCTTACATATTTCTATT TAGGGTTTATATATCAGACCCTAATTATGTGCTAAAATATAATATTACTT GATTTTATATTTTTATATACATGGCTTAGCCTGCAAGGCGATAATTGCAA GAATCAAATATGTGTATTGAAAATTTCTTAAATTTCTTGTTCCAAATCGA TCTAAAACCAAAAAATAATCTAAAATTCAATGTGATTTTCAATATCTTTA TATTTAATTTAATTTAAATATGGCTGATTTTCTGTGCCATAAATTAATAT TTAATATAGATATTTAGTCCTATTTTATTGTTAAATACATTTGATAAAGT TTTATTAAGATTTTTAGGGAAATTTACATTTAATTAAATACTTATATTAA ATCTAAGTCTCTAAACTAACAAAATTTGAGTTATTTTGATAATGGCAATC ACAAATGTCTTTATTTTATCGTAATTTAGAGTTATACAAGTTTTTAAAAC ATAACTTGTTTTTTTTTCTCCATCAATTAAAAACGTTGATGTAGGCCTTT TATAAATAGTTGATATATTTTCGTCATAAAACAATAGATTTTTGATTATT CATAATAAACTTTATTGTTATCAAAATGGTAAATCTTGGAGTATTGATCA AACAATAAAATAAGGATGTGAAATATTTACATTACTTTCTTTTAATGTAT TTTTGTATATTTTGTACAAATATTGTAACTTTTATAAGCAACTTTATACA AGTTATATTAATGTATTAAGCAATATAATTAATGATGTAATTTATGACTT CTAAATAAAAGTGACTAATTATAAGTAAATAATTTTTTGTAACTATTGGT TTCGAGTTGGGAAAAAATTACAATCATTAGTGTTTATAAAAATGAGAACT ACATATTAATTTGTTTAATTTTAATAGATTTGCTTAAATTTATAGGCATT ACACCCCTTAAAACAGGTAAATATTTATAACTTCATCATTTTTTTAATGT TCATTTTCTTAGTCATATGGAGTTGTACTGATTAACTATAAGTATACAGT TTTGTATTACAATTACTCCATCTAACCTAGGAATGTTCTTTGAAGTCCAT ATACATAAAGTATATTTCCTTTTATAGGAACGACCGGGTCGCCCATTGAG TTCAAGAGAATAATTTATCTCAAGCACGTCTTCCATTGACCTTCGTCGTC CCACTAATTGTTTGCACTTATACAAATTTAATCTCTTATATCACACATGT CCTTAAATCTACCACTCTAATCTTTTTTTTCCTTAAGTAACAAAATTGAG TTGGAGATATCAAATAATTTTTTTAGTTTCTCCAATAGTTTAACGGAAAG AAAATTTTATTCACATGAAAAAAAAAAAAAAATACAACAAATTCTTTTTT TTCATATTACACCTTAATATTTCATGTACATAAATTGGTGAATTTTAAGT TTTCTATTAAAATTTCTTGGATAATTGAGTTATTTAAGAAAGGTATCTAA ATATNNNNNNNNNNNNNNNNNNNNNNNNGTCAACCATTGTTTTTGTTAGG GAATAAACAAAATGTAACAAAGAGATTTTATTTATAACTCAAAAGATTAA TTATATGCAACTATCATCCGTGTTTTGACAAACTACAGTCTAAAAAAAAG GGATTTTAAGACAATTTTTGGTCAAATTCATTATGAAAAGTTTCTAAGGA CTTAAAAATAAATTGAGTTGGAGATCTCAAATAATTTTTTTAGTTTCTCC AATAGTTTAATGGAAAGAAAATTTTATTCAAATGAAAAAAAAAAAAATAC AACAAATTCTTTTTTTTCATATTACACCTTAATATTTCATCTACATGAAT TGGTGAATTTTAAGTTTTCTATTCAAATTTCTTGGATAATTGAGTTATTT AAGAAAGGTATTTACACCTTTATTTCATTTGTAGTACTTGATTTGGTATA ATAATGATGATATAATTTGAAGATAAATTTTCACTACTTTATGTGTAATT TGTAAAATTTTCTACGAATTAATTTCTGAATAGAGATTAAATATAATTAA TTCGTCGAAAAATAAAAAAATATAATTATTTCGTCGGAGAATAAAAATAT AATCTTTACTTAATTTTAAGAAATATCATTTTAACTTGCTTTCCAGTTGA CAGGCCATTAAAACATGATACTTTCAGTAAGTGTATGTTATGTAAAGAAC ATTTTTATTGACGTCATAAATTGCATCCTAATTGAAGAATACGTCAGTTT GGGTGCTCAAAGTTAATATATTTATACAACAAAAATGTACAAATTCCTAT AAACCTTTCTAAAACTTTACCGTATGTAAATTATGTTTAAATATAATTTA AGTAGTATGTACTAAAATTGGCTAGACTTATATTATTGTTTTTTCATAAA TTAAAGATGTATAAATTTGAATAACAAATATTTTATTCTTTCCATTCTAA GCGTAATTGTATCTTCATTATGTAAGAAAGAACAATGATATAATAATATA TTTTGAATACATTATAGGGTCAGATTAAAAAAATAAAACTAAGCAATAGA TAACTAAAAAATCAATTGGGATTTTATTTGTGGGTCCTATTTTGATATCG AATAAATCTTTATTTCCCTTCAAATTTATAAAAAAGGGATTTTATTAATA CTGACGAGCTAATCAGATACTGAATTGTATTATTCTTTAAGTTTAATTTA TGTATAGGTATATTATTTTGTGTTGCCTACTTTTTAACGTAGAATTATAT CAGTCCATCAAATGAGAGATCATAAATAAATATAATCAATACTTATCATA CAAAAAATAAGAATATTGTTGAATATGACTAAAGATTTGTATGAAAAAAA TTGTAATAAAGATAATTTGGAAAGACGTAAAAATTACAAGAATCTGTAAG ACATCATAAATTAGCTTCTTTAGAGATGAATTATTTCAGTATTGGAAACC TGAATCCAAATTGTATCATTCTATTCATGTACATATATCTTAAACAGGTT TTTTTCAAGTAATTCAAAACAGATTGTAAAGGAACCTAAATAGATTTATT GACTTGATAAAGTATTTCGTCGTCAACACAAAACATGTATATTTAGTCGA CTAAAAGGGGAATAAATAAAAAGTTTTGAAAGTTTAATGTTTAGTTTAGT TAAACTTTATACAAAATTTACTTTTTCTGACGATTTAATTATCTATATTA AGTATACTATATTTTAAGGTGAGGTAATTTTCTTCTATATATATAAATTA TTTATTTAGTTATTAAAGCAATAAACGTAGATGAATGTGGGGAGGGTCGA TTATCCCTCAATTATGAAAAAACTATAAATATATATTTTACAAAAAAAAT CAAATATAATATCTGACACAACTTTTTTAAACATCAAGAAAGTTGAATAA AATTATCAGGAATTGCAAAGTACACTATTGAGCAAAACATATTGCATTAA AATACCTGCTATTGAAAAAAATAAGGCAAATTACTATCAAATTGCGTGGT TATAAAGATTGAAAGTTCCAGTATCGGATTGAAATTTATGTACTTCACAT CGACGAATTGGTTTAAAACTTTTGAATATACTAGATAAATAAATCCATTA ACGTCCATTATACCTCTTTTATGATACATATTTCCCCATTTGCAATTTAT TTTCTAACGAATTGTGTGATTAGACGAAGCAAGGTATTAAAAGAATTTAG ACTGGGGGAAAAAATTTAGAATTTATCTACGTCATTTKCTTTGACTTMAA AAWAATTCCCCCCCCCCCCCACTTTAACTCATGAAAATATAGAATTTCTA TGGAGATCCTTCAACACTTTTAGATTTCTGTGCACACTTGCAGAAAGTTG TTTTTTTCACAATGTGATAATTTATTTTCATTTCGTTCTTTAAAAAAAAC TCTTTAAGAAAAAAGTATGCTTGTTTTTATAAATCTCACCTAGGAACGTT TCTTCTTTAGAAAAAATTATCAAAAAAAGTTAATTAAAAAAATTAAAGCA GGTCACAAATATTTGGCCAAAACTTAAATGTCACCCTCATCCCCCCCCCC CAAAAAAAAACYCAYCCACACATATGATAACAATCCTCATTTAAAAAGGT GCAAATATCAAAAACTGCTAGCAAATTCGACTTTCTAACAAAATTACACT TTTTTGTCTGTTCTCGAACTAAAAAGGCTTTTTTGAAAAGAAATCTTTAT TTTAAATTAAGGTTCAGACTTTTTCATTTCAAATAAGATATTTTGAAACT TTGTAGAGTTATTATTTTTTGATATTATGAGCTTATGATTAAAAAAACCA TAAATTTCCTTATTAAAACAATAAAGATTATTAGAGTTTGTAACAGGATA AAGGCGTTAAAAATGAATTTTAGATTCTTTAAACCTTAGGCTTTGGAATA AATTCATACAATTGAATCTACCATACCAACTCACTTCAATTAGTGCAAAC TACCATGTACTTTTGGAGCTTTTCTTAAATAATTTGAAACAAATATATGT TTAATGTTTAAGACCATTATATTTAAATGTTTAAATTACTTTTACTCAGT TTAGCCCATTCTGATTTTGAAATATTTTTGATATTGATTATTATAATTTA TTAAATATGAATCATATGTATAACAGACTTCTGAGTATTTATTAAACTAA TTTATTACTCTATTAAATCGCCAAAAAAAATGAAACCATAAGGTGAGTTA AAAATAAAGCAATCCAGAACAAAAATCAAGAAAGGAAGAAATTTTATTTA ATATATTATTAAACAGATCTAATTGTAATATTTTACAATTTTATAAAAGT ACAACTTTCGCTCATTAATTTAAGCCATAAAAATATCTTTTTTCAAAGCA GTAATATAAGTATATTTTTGTGAAATATACGTAAAGGAGGCAGACGGAAA AAAAGGGAGTGGAGGCCAGKCTATTGTAAAATAAAAGGGAGAGAAGGCGC TTAACCAGGAGKCTTTATGGCAAATATTTCACCTATTCTTCTTCTTCTCG TCACTCACATAGACTCTTTGTCCTCACTCCTTACCTTATATAGTAGATAA ACATACATTTATAATGACAATATTACTGCAAGCGAGGCAGTCGTCAACAT AGCTAAAGATAAAAAACTATTTGTTAGTTGACCAGTCCTAGCAAAGTCTG GTTCTTAGACAAGAACCCCCTCAAAAATTTTCAGTACGTCTATCTGCTGG AATACGAGAGCCTCTAGGCAAGTTGGAATTCTTCTTTCACAAAACTTCAC TGCATACATAATTATGTTTTCAATTTTGCAATTTTCAAAGCCTCATGGTG ACTGAGAGATGTTGGAATAACCCATTCAGAGTCGTAACTTTAGCTATACC TACCANCTTTTCTCAAATATATTAATCTTAAATTGACTAAAGTATGATCA TTTCAAATTTTGTTTAATTGACTATCAATTCATACTACTTCAAACGCATT TGCTACGCCTCTAAATTATATATAAGAATAATTTGTTAATAGAAATTGAA GATAATTCTGGGAAATATAACCATGTATAAAATCTTGACTCAGTTTTTAG ACAACAAACTTTATAGCCTGTTTTAAAAACATGTCAATGCCCTTGTCAAA ATATTTATAATATTTTTTAGATTTTTTTGTCAGCAAAAAGATTAAGAGTA ATAATAGTTTGAAATATACCCAGATGTTAAAGTTTACATCAACAATTGCA TTAACTTTATTTATAAGAATATTTACTAACTTTATTTATAAGAATATTTA CTAACTTTATTTATAAGAATATTTACTAACTTGTATTTAAACCCTCTTGT GTAATGATTTATTTCTGTTATAAATTTAATTCTATATTTTAGTACTCAAG ACCTTTTGACAAATGAATAAACATGGGTTAAATAATGATAAAGTTGGAGG ATCATGCGTTTTTGTGTAACTGCAACCGTAATTTTTGAATTTTTAATGTC TAAAGCTGTTATCATTATTAATTTATTCTCAAAGAGAATGGAATAAATAA AAAGTATTCACATGTAACAAAAAATATTACTTGAAATATTTGCAGAGTTC TAAATCAAAGTTATGGTTGGATTCTGAGTAGAATTGAAGATCGACATTAA TGTAGCTCCAGCTAAATTTGCTAAATTTGGAGTGAGATTTGTGTTTTTCT CTCTCATATCATAGCTGCTGGAGGGTAATCTAATGAAATGCTAAACAAGC AAGGCTGCTCTCTTCTGAAACATTTTTCAAATTGACAGGGAGACCACATT AATTCTTTGCTCATTTTTTTAGCATACATGCAACTTATATTCTTTTAATT TGTGTAAATGAAAAACATTTCTTTTATATCTATGATTGTTAGAGATGTGC AAACTGTCGAAATTCACACAATAATAATTTCCTAATTTGCACGATATAAT TATTTTATTAATTATTCCTCATTACAACTATAAATCAACTAGCTCAACGA CCGCGTATGCTTGAATGGTTTCATGGTCTAAGTTAAAATCCTTCTCACCA CAAAAGATGTCATTTTTTGTCATTTATTATANGTACGAGTATAAGTATGT AGTAACATATTACAAAGTTATACATTTGTAAGTTTACACACCATAAAAAT ACTGAAACTACGAAGGGAAATTGCATTGGAGACATTTAAAAAATAATTAG TTTTGAATATATCTCTATTTTATTTTTTACCACTTTTTTAATTTATCTAA ATTCATAACATGAAATCTAAGACATAACATCTGCGACCTCAATTAAATAT GAATCCTAAGTGATATAATTAGTCATTTTCAACATTTTACAAATTAATGT ACTTAGAGAATAGTTGTAGTTGTATTAAGTAAACATTTATTATCTAATAA ATAATATGATGTATGTATATTTATTATGTGAGTTACTGGGTGGTCCATTG AATTAAAACAATTACTAATTCAATAATCAATGAAGATTGAGGGATTGGAA TTAATTCATATTTCAGTATTTTAAAGCATAAAGGATTAGTTAGAAAAAAA TATATATATATAGCTCTCCAGCTTACGTACAATTATAGAAAATGGCCAAT GAATGTGATCGATGATTTTCCATTCACGTACTCCAAGTAGCTAAGCGTCT CCGGGACCACGATCAACCCCATCAGCAAGTCTGTAACGTTTGAGAGGAAG AATTGTAAAAAGGCCAAACTGAACCCAGAAAAATTAAAGAAAAACTGCCC AGGTCAATCTCCTCAGTCCAGGACGGTCCATGCAGGAGATCTTGGGGTTT CAAACCAGACTATCAAGAGAGTTATCAAAAGACTTTATGGAAGGAACCTT GTGAGGTTGAAGAGGCCACTTTTGACACCAGTAATAAAATAAAGCCACTT TCTCCGTTGCAGGAATTTTTTAAACAAGTTTTTTCAGTTCTTTTGAACTC TTTTTTGACAATTTTGGCCCTTTATACTCTGGATTCCAGCTCTTTACAAC ATTTTGTGGATTCATGTCAGACGGCTACATCTGAAGAAGGTGCCAGGCCT TCCKCCGNCCTCTGGAAGCCATCATTGCCACTAATGAGGGCTACATTATT GATTAAGAGAGCGCACACTCACATCAGTTTTTAGTATTAATTTTGTTGAA ATTAAATTGATAATTAATATATTATTATCTTGTTAAAGTTTAAAATTCAA AGTGTGTAGATTTTAATGGACCACTCGGTAATATAGTGTTTTTTATTTAT TATGCTAGTAAATAGGACAAAACAGAGTTTGAAATATGCTCTTGGAATTG ATAGTTTTTGTAAATATTTTTTTGTAAATATAAGGTATGCTTCTTATACA TTTAATCGAGATATCTTGGGTGGTTTAACCTCTTACTTAGGGTGACCTTA GAAATAAAACTTTTACTTTTACTGGTCTCATCCATGGAACTTTAGATATT GAGTATTAAATTTCCTTTATTTTTAAATGTATCAGAGTAAAATAGAGCCC AAATATTATGTTTATAACATTTTCAATATTTATCTCGTATATGTTTTCAT TCCACATTTTAATCATAATAATTTTTTTTTTAAATAAAATCTTTGATTTT ATAGNTGTTAAAGAAAAAAATCGTTACTAATATAACATATTGTATAATTA GATTATTTACAAAGAATTACCAAAAAATTATATCTCAATACAAATTATAC ATTAAGAACTTTAAGTGCAATTAAGTACTTCCCATAAAGAAGGATTTTAC TCAAGTGGGGGACAAAATGAAAACTATAGACGTCAATAGATGTCAATATA TCTACATGGTTGATCTTATTTAGTGCTACAAACTGTATTATTTTCAAACT TCAAAAACATTTGTGCAAAATCACAAAGGAGGACAACAATACACCATTGA TTCTACTATGAATAAACAAAACATTCAGACAATGCCTCAACTTCAGTGAG ATTTGTCTTCAGAAGAAAACATCCAGTAGGAATCATGGGCGTTTTGGTCA GTATAGACGAAGTCTGCCCTCTCTTTTGGCGTAGTTTCAGGAGCGGTTCA ATGCAGATGCTTAGATCGAACTTTTGGATAAGAAAGTAGTACTTTGGGCT ATAAAAAGTCGGAGAAAAGATTTTTTTACTGAATACTGAGCTCTGTGTCA TTGCACCGCCAAGACACTGTCTTCCCTAAACGACAACGTTCCAGACTTTT GGGATCTCAATATGTGGTTGCCCTACTCTTGGCACACAAACCACTTTGAC TGTACAGTCTAGGCACGTCTGGAGAAGATTGTTTGCGCTKCTTCTCATCG GAGTGTCTAGTCACTCCTAAGCTTCCATAAAAAAAGATTGGACAAAGCTC GAGTCTGACTACATAGTCAAAGTATACAAGGGATTTAGGCCTCGTATTGA TGCATTTTTTAAAGCTGAGGAATGACATATTAAATCATAGTTGTGCTGAG TACTACTTTAAGAAGATCTTGTAAAATAAATTTCCTCACAAAACCTTTTG TTTAAATTTTACTCTAGAAAATAAAATAAAAAATGTACTATAAGATAAAA TCAACGTTGTAGACTTCAATGTTGTTAAATTTATTTTGGACTTTAATTTG TATTAAAAGGTGGCACCGTTTTATATATTTTTGCTCTTTATTGAAATATT GGTGGAGAAAAAATTCGTAATTTTTCCTAAAATTTTTATACAAATAAAAT TACAATGTAGGTATATATAGCTTTTGATATTCAATCAATTAGAATATATG TAACATAATTGTTATATTACCAAATAATTTATCTACCAAATTTTTTTTCT TTAGTTGATTTTTTTTCCCAGCAGTACTAAAAATTATTTGTGCCCTTCAT TTAAATTATGTTTAGAATATAAACCTTAGCAAATGATGGTTTATATCCAA TTTTAGTCAAAAGCTTGCTCAAAAGGCTCTGAATGTCATTTAAATAGTAT AATTTTTAGAATAGGAATATACTTGACCCTATTTATATGCTTTTGGAAAG AAAAGAGCGAATGTTTTTTTAAAAATACGAAATAAGAACCACCTTAACCT GGAGATAGGTTTGTTTTTATGGTAAACACGATCAAAATCTTAAGTATTTG TACTTATGCTATTATTTAATGTAGTGAATACAAAAGAAGTCATGTTTTTT TTCTACCTATTAAAGTTTTATGAAAATTTTTGGAACCGTTAGTCCTACAA GTTCAAATTTAATTGGTTACTGCAATACGATGGTTACTTGGTTATATGAT TTTTACTTGATATTATCTCAGTTGATTATCCCTTTTTTTCGACAAATCTA TTTAGTGGCGTACTGGAAGTGAGGTAAGAGTTTATGAATCCTCCTTTGAC ATATTGTAGGGGACGCAAAATAGAAAAAAAGTATAAAACTTTACAAACAC ACTAATTGTAGTAGATACTATTAATGTCTTTGAAGTCCATAAACATAGTG TATATATATTTTTTTTGTTAGAAGCGACAAASCATCCACTCTAACATATT GAGCTTATAAAATAATGTCCTTCTGTCGCGTTGTCTATGCAGCTAGATCC CTTCATTGAATTATCATAAAGTTAAACGAATAAAAATGAACTTAAACTAA CTTTATTTGTATTTATTTCAGGTAAGCAAGATTTGCAGCCCCAGATTCAT CTTACATTCTTCATTTCCATTCAGGGGATTTTGGGAATTGACTGTTATTT GATTGGTTAGTGTAAACAGATTCTGGCAGGGACAGCTACGAAGAAGTTCT TATTTTTTGTGCACGATCTAAACGAGAAATGATATAAATATTTCTAAAAA TTTTATGGTTACAATATAAGCATTTCTTTCAATATCATTAATCTTATAAA AGATAAATTATATCCTATCATAACCATGGTACAATATTTTCTTCTCATAT TTTATTTTTCAATATAAAAGTTTTAAGAACATTTGGATTAAATAAACGGA GAGTATTTAAATTTAATTTCTATTAAGGTACTAATCCATAGATCCAATCC AACAGCAGATTTTTTTGTGTTATTACTCAATTTTGTTAAAAAGATAGAAT ATTATTAGATGCACTTTTGGCTTTGCAGCTGAAATTATACACAACATTTC TGCTGTAGTAATAGTGTTAATTCTAGGAATTATTAGTAAATTTTGTAATT TTAATAAAAGTTTGGCAAATTTAATTTTAGTTTATTTCAAGTTTCTTTTT TGGAATTGGTGAGGTGTACAAATTGTCACTTCGTAAAATAAGCTGTTATT TCATTCATTTATAATTCGTTGAAGGTAATCAATAGTGTATTTAAATTTGT ATCCACAATGTGACTTTTGAAGGATTTTTTTTTAGTTCAGAGTAATTCAA AAACTTTAAATTCAAAAAAAAAAAAGAAGACAATTTTAAAATTTTTTAGT TTCATGGACATAAGATCCTTTTCACCTTATTAAAAGAAAAACTGTAAAAT ATATCATATTTTCTGTTCGACACTGCCAATATCGTACACACACTCATATA ATACTTAGTAAAAACAATCACAAAACTCTCTCTATTGTAGCTAGGCCATT TCGTGTCTATTATAATGGTAAAAGTATATTTCACAAAAGAAGTCACACTA CAAAATTGCATATGTAAAGTAGAAAATAGACGGATGACAATTGCAAAATT GTCTAAATTGCACAGAATTGGTTTGAATTACACCTACAAAAATTTAACAC AGACTGGTTTCATAGGTATGCAATTTTTAAGGCTCCTTTTTTGGTCAGAT AAATTTCTATAGAGTATGWAAAAGTAAACATTTTATTCATTCATTNCCCC GCCAGACCTAGGAATAATATATGAAGTCAATTTAATTAACGTTTATTTCT AACCTAAAAACAACCAAGTGTCAAATTTATAAAAGTAGTGTTTGAAAGAA TAATTTATCCTGAACCATTAAACTACAAACCTCCATCCAAAAAGTGTTAT CAAGTCCGACAATATCACAATCTGCACGGACAAAAGATCGTTTTGTATGT TTTTTAATAAAAGAATACATTATTAATATCGTTAATTTTTTTAACTTAAA AGCTGTTGAAAGATCTATTAAAATTGAAATTTTATTTTTACTCTTGTTTC CTCAAAATAAATATGATTTTTTCTCGCGAGAGGGGTAGGAGGAGTAAGTT CATCAAATTAATCTAAATTGAACATTTACTACATCTTCATAAGAACCTTA TTACCTACGAGTTAATGGGCCTATAAGCAACCAATAACATTTGATGGGGA TTTCCAAAATATTTAAAATTATTTAAGGAATTTATCATTATATATATTAA ATAATATAATCTTAAAAATGATCAGCAATAAAGAATTTGAAAGATGAGAT CAACCGTCCAATCTCCGCTCCTATCCCCATAAATTAAAATAATAAGGAGA TGATCTTATTATGGTAATATTTATTTTTATTGGAATATTAAACGGGATTT TGAAAATATAATTGACCTTATGAAGGAATGTAAATAATTCATTAATTGGC TTTATTATTTATAATTTAGTTATCTCTTTAGATGTTGCATGTGATTTTTG TGATGTTAAAAATTTGTTTTATTATAGAGTCGACCTGTTAAGACTTTTTT TTTAAGAAAACAAAATTAGCTACTTTTATATCAAATACCAATCATTTAAG TGAAGGCTCATCTTGAAATGTTAAACTAAAAATTCAAACTGAAACAGTAG ACTCTAAAAAATCTAAGGACTTAGTTTCTAAGTAATGAAAATCATTTTAA ATAGGGTTTGGAAGTCACTCTAATGATAATTGTCAGTACTTAACAGACAT TGGAAAGTTCAAAATTATTAGTAAATTATCCAAATATAAGATGTTACGTG CAATAGAAAAATCTCTCTGACAGAACTTTGGAGTGAAGTGTTATACTCAT TTAAATAATGTACAATTTAAAAAGTCCAACTGATACAAACTGTTGTATAT GTCTTAATCTCAACTTATAATGTGTTTTAGAGGCATAAACTGATACTTTT ATGAACGTACATGATTGTTTACATCTTTTAAGCGTACCAAGAATTTTTTT CCATTCAGTAAATTGAAACGGATGTCAAGAAGAACTGAAATGCGCACACA TGAACCCCCAAGTTTTTGTACAGACTAAAAAGTTGTGGCCTTTTTTGATG CAACACTTACTAAAAAATAAAAGAAACCTTTTCTCTACCACTTTCGTTTT GTTTCTAAGCTCTTCTTTATATATTCGTGATATATATATTTCTTTATTGT ATGACGAATTAGTCACATATGGGTGTAAAGGGTTATACGCAAAAAAATAA AAAAAAGTGTATTTCAAGTATGACATCAATCATTTACTAAAGAAATAAAA ACATAAAGTTTTTACATATGTTTTCTGTAATAAAAATAATAAAGTTAGAA TAAATATCAGCTGAGCTTTTTACTTAAATAATAAATTACATTATACTTTT TTCGGAAAAAAATAGATACATATTTTTGTAGGAGGAGCTTAAATTAGGAA AGATTCAAGTTTCATTTTATTTGGTGATGGGGAGTGGTGGGAATTGTGAC TCTGGACTAAGGGTTGACATAAATTTATTGTCATTTAATTTAAAGACTTA TTTATAAAAATGTTTTAAATGTAATTATTACCACTTGCTTTTATTATTTA AATGATATATTATATGTTCCAATTCGACTAATAATGTTTATGTAAAAACA TTATTGACGAATAATATTAATCGTAGCGCAATGGTCAAATGAAAAGATTG CTGACATCGTAAAATTATAATGGAATCACGTAGCTAATGGTCAACATACT CTGGAGAAATTATTCTCTTGAACTCAATGTGCGTAGGTTTGCAAACTTGC TATTAATTTGTTTGTTGTCCTTAAATTGAATTGACGTATAAATTACTCTT TATTCGTATCTTTTTTTTTTACTAAATAGTGTTGGGATTCAATTAAAATT TTCGAGTTTGATCATGTTTTTGTGTTCAAGTTTGATTCCATTTTTGACAA TTTTTTCATTCTATACAATGAGGTTTTTTRTRTTTAATATGNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATAACAGATATTACAAC ATTATTTATATTCTGTTGAAATTTGAGTCTTAAATAATAAATAATAAAGA ATCTCCTTTATGTCAAAGAACTTTTTTTTATTCTATTTAAGCACTTCACA CATAAAAAAATGAAAAAGTCATTTTTGATAATAAGTGCATTTCGTTATAT TTTCTCAATGCAAAGGATATAAATTCGACATTCATTTATTATTTAAAAAA CAATGTGAATATATTAACTAGATGTGTCCTCTACTAAAATTAATAAAAAC TATTTATTTTTTTTAATCAAAAGGGTAATTCAGTTCAGCTTTAAAGAGTA CATAACATATAACGAGAAAGGGTTATTTTTTTACATGTGTTTGCTTATGT ATAAACTATTAACTTTTTTTCTATATATTTAAAAAAAATATTAGTTTTCA TAACAATTTGAAAGAGAGGAGATCAGCTTTGTTGTCACAAGACCATTTAC AAACAGCGTATGAGAGAGGGGAAAATTGAACTCAAATCCCATACTGTATT TAGTAAGGACATTATCAGGAATTACTTTAATGTCGATCCTCAATCTTACA TACTTTTAGTCCAACTAGGACTTCCACTTTTAACTTCCTGATAAATTATC TGCGTTAAGGCCGAGTACCACCTTAAAGTTTTCTGTTATAATCTTGTATT TCTATTCACTTTGATAATATACATTTGTAATTCATCATTGAAGAGCTATC AATTATCTTAAAAAGACTTAAGTTATATTTTTTTAAATATTTGTAATAAA AAAAGAACTTCTTAACTTTTAAAACTTTCAACTCTGAAGTTTTTAATAAA AAGGTTCAAAATACCTTTTTATAGTTAACATTGAAAAAAGAAAAAAAGTA CTTAACCCTTCGCTTGTGAACTGGGATTTTATAAATTTGATTCAAATCTG TCAAAAATAACTAATATTGGCAGTGGATTAATTTCCTTTTAAAACATTTT TAAAAATGCAACTTAATGGTCTTGTAAAAATACAATAACTTCGAATATTT CGTAAATTTTGCAATTTTTAATCAAGGTTTGGTGAATTTGATTAATTTGT TGGGCAATTGTTCTTTTGTCCTTTCTTTATCCTAAGCTAATTTTTACTCT GCCTTATCATTCGGTTGGCATACAAAATGAAAGAATGGATAGAAAATTAA ATATGAAGATATATCTTAGAAAAAATCAAAGAGTTGATAGAAAATTAAAT AAATATCAAAATAAAAAGTAACAAAAATTGAACTATTTTATATTTTCCTA GATATTTAAATCCGAACTGGTGGAATCCTCATTATCACTTTCCTAATGGA CTTCATCTTCCTAAATTATAAAATTGTATGCATAGTGGGGAAATCAAAAA TAATGACAACATCAATCTTTGCTAAGATTATAATACCGAAAAAAGTGATC GAATAAACTCTCCCACCCATGAATTCGAAAATAACTAATTAAGTTCTAAC TTAATGAAAAATAAATATAGGTAAAATAAATAAATTTAATTGAATTTCAA TTTACAAAATTAATTTAAATGGACCATCTGGATATCACCATATATGTACT AAATATTCCCATTCTATAAAAAGAAATATGATTGTAAAATTGATTAGAAG TATGAGTCAAGAGTAAGAAATTGAAAATTGTTTAGAAATATAAAGTAAAT TATTAAAAACATCGATAGTTGATTCCATTGCACAAGAGTTTGGAGGTATC TGATAAACATAGGATCTATATTTCTATAAATTGTATGAAGATACATTCTT GATAGTTGTTGGTGTCTGTTGTGGTTGCCTTTATTTAGCTATAAAGTAAT CATTCCTCAATAAAATTATCTTCACTCTCGTAGGAAGAAATTTTTAGAAA CTTTCTTTAAACCTTTTCGAAATTACTGTTAGGCAAAGAACACTATTTAA GTTAATAATTCGTCACTACGTATATAAGAGTAATTAATGAATGAAATATA TTCATATTCTCTAGAAAGATCTTGATCCAAAACATATCACCTCTTCCCTT TTATCCGTAATTCAGTCCTTGGCCAGTAAAGAGACAAATTTCGAGGGTTG AACTTCTTTGACATTACTATCTAAATGAGGATAATAGCCTGACAAAACTC TTTCCGAAGAAACAGGAAAATTGAGGCAAAGAGACAAATAAGTGAATTCC TCTTTGCAAACGAACGTTTCTCATAAGTACATGGGATGGATTCCCAAATA TAAAGTCGTTTGATAGAATAATTAATTAAATCACTACTCATTATCTGATG AAACCAAGGAGTTTTTTTAGCCACGTAGGAATCACGTGTTGACATTTGCC TAACGGATACTATGATGAGTTGAAGTGGAGCACCGCTAGATACTTACCAT TATCCCTTGAGTTAGATTAAAAATCTAGAAAGAGGAACAAACAGTTCATT AATGATCAGATATTGAAAAAATCCATTGTATTGATATCTCACTCTATTTC TTCCAGAGACAGAGTCAGTCAGAGGCACAGATATGAATCCCTTAACCCCT TCTTCTCCTTTAAGTGAAGGATCATCTGCGAATCAAGCGATCTTTCCATT ATAAGAGATGAGATTTACCGCATGAGTTCTGAAGAGGCGATATCCCTTGA ATATGAAGTTGAAGAGATGATCTTAGGGGGTGTGGATTGGATATCCGAAT GGGAAAAGATGATTTCCTAAGAAACGGGAACAATAGATCGATGCGGATGT CTACATCGGAATGCTTCGTATGAAAGATCCATCCAAATCACTGTGACTGA ATTTGTCTTTTCACGTAGTTCCAACATTTTTCTTCTCTTCTCTCACCTCG CTTTCTCTCCTGAGTAATTCGTATTTTGTACAAAATGATGAAGAAGGTTT CATGAATGAATTAAATGCCAGAGATTGATAGCATCCTAGTCTAACTAGGC GAGGGACGTACAAAAGTTTTGCAATCAGGTAAAAGGCAGAGTTTATCCAA CAAAAATTGAAAAAGGGAAATAGGGCAATAGAGATTAGGCAAAGTAAACC TATGGTGTCATAGTTCTACTTTGCTCGATGCTCCACAAAATATTGACCTA AAATTTCATAGAATGTTTCGTAAGTAAAATAATTTTAATCTGTTTTATTA GGATAAAAGAAATAAATGGATGTTTATTAACACAGGATTCAACTAGATTT ATCTTATCAATTTAAAATTTACTATTTCATTTACTTTACTGTTTTTACCT TTTCACAAAGTTTTTCTAGCGATCAGAAAACTCTATAAGTAAGTAAAGTG ATTGACACTGGCCCGGTAAGACAAGAAATTACATTCAAAAGTTTAAAAAA GTACTCAATTATGTCACATAGTCTCCTCCGGCTCAGATAACTCTTCACTC GCTCAGGAAAAAAGGGAAAGCTAAGGAAAGCTCTAATGAGATCTCTGGAA CGCTGAATTGGGTTTTTTTCTGCTCTAGGTCCTTGACTTGATGCTGATTT ATGTCCTTGTCTCACGTGGATGTCCTGATGACACATATTTATCAAACTTA AAAGATTCATCCCGAATCTCACAATCCCACTGAAAGATGGTTGCACGACT AGGTAAGGAATTAGGGTAGACAATTATGGGGTTGGTGTGGATCTCCATCT TATGCAACGAATGGAAAGACACTTGCAAATGAGTTATAAATCCATTCTGT ATTTAATCACTGAATAGCAATGGAATGTTTTATCACCATAAATTTAATGA TAAACTCGATTCTAGTGAAATTTTGTAGAAATTATGCTCGTATTTGACCC TAAATGTCATAGCATGTTAGAGTCACTCCTTTGACGCCTGCTAGTAAAAA TTCAACGCCCGACCCATAACTAAAAAAATAAAACCTTCAAATAAACCTGT CTCAATCATTTCGGAGCTGGCAAATATAAAAATAAGCAAATATAGTTTTC ATATTATTTTAAAAGTCTTTTATAGTTTTATACAGAACTAGATCATGACC AATTTGTGCATTATGAATTTGCAAAATAATTAGTCATTATTTAAAATATT CATTAAATAATGTATAGAAAATATATTTATACTGTCTATACACAATTTAC ATAAATACAATGCATACAAATCTCATTGTTATGTAAAGCCGATTGCAAAT AATTTAATTTCACTTGTGTTTAATCCAGCATTAAACTGTTTGATTTATTC AATACTAAACATAAAATGAATAGTGCTGAATAAAATCGATCACTCAATAA AATTATCTTATGCAAGAGTTATTACTTGGGTTGTATGGATCCTTAATATG GGGACTAAAAGTTGTTTGGTCTCTGTTGTCGTTTTTGGAAAAGCCCCATG AATTTAAATGCAACTTCCATAAGGTATATGGCAAAATTACCTAAACCATT GAATTAAAAAAGATTTTGTGTACGAATTTTCCCGAACGAAACATTATCTG AATTCTCAAGCAGTACAAGTAGTAAGATAATCAGACTTTTATATATTTTT GTGATTTTATTCTTGGAATAAAATCTGACAATCGCCATTTCTGGCTTCCA TCATGGCCTCAGTCCTAAACATGAAGTCATTACATATCTTTTCCACGTAT TCTTCCTACATGTCAGCACACTCATTTTAATTGTTCTGCTTTAGTAGGCC ACAAAAAATTTAAGTTTAATATTTCCATTTTAAATCTGTTTTATCCTATT GGTAAAAGTAAAAGAAATATTTTGATATGTATCTCATGCCTCTAACTTCA ATGTTTAGGAAGTTCTGGGTAATTTATCTTTGGAATATTATTAAGTTTTT TTACTGTTTATGTAATAGCTGACAGCAAAAATTTGTGATCTAATATGATA CTGTAATAAAAAAACAAAATTTTCATCAAGAAAAATGAATGAAAGTTTTA AAAATTAAGGAATATAGTATTTTGAAAAAAATGTTACTTTTAAAAACCTG CTATGGAATTGTATAATTAGTTAATTAGCTACAGCTGATAAATGATAATA ATTGAAAAAAAAAAAAGTTAAACAATTACGACAAAGTACTTTTGTGTTGT CCAATAACAAAGATTTAAGGTAGTAATCTTTGGTTTAAATTTATGTAATT TGGGGAGACAGATTAATTGAAAAATTATACCGTTAACTAGATGAATGAAA AAATTAACGTCTTTTTTACCTTTTATTTCATCCATAACACCCCATTTATA ATTTTGAAGGCTATCTTGATGTGACTTATTTTCCAGCGAATGGTGCGATT AAAAGAAGGAACGTAGTGATTTTTTTATTGGGTGAAAGATTTTAGAAGTT ATCAAGGCCATAAGATTTGAAATCAAGTTTGTTTCCCTCCATTTAACCAA TACATTGATATGGGGGATCCTCCAAAGACTTCTGGACTTCAGTGCACGCC TACTGCAAGTATTTTTCACACCGTACGTTCGCATTATTTATCAAAATTAC CCTTCACATGTGAGATGACATAGGTATTCATGTGGATGGTGCCCGGATAC CATAATCAGGAGGGKTGCAATCTGATGAGAACGGAGGKCACATTGACCAT AACCTGTAACCTTGTCTAAACACCACTTTTCAGTTGTTGTTGTTTTTTGT TTTTTGCCTTGTGACTGATAAGGTTCTTCCCAAGGGGCTTGTTGTTTTCT TAAGCCTTTTAATCTTGGTGTTTAAGAACCTAGCAGTAGGGGACTAAGCG GGAAATCTCATCACAGTTCATTCTTGTGTCAAGAAGCACTGCCACATCAA TTTTTTTGACCTCCATCTCAGTTGTACTGATCTTAATAAAGAAAGTTGTT TCACAAGATTTTTTTGTCTTTATTACTCTCCAAGTGAATGGTAGAAAAAA ATGTTAAAATTGTTGTTGTAAGTCAATTGAATTTAAAAAAAAAGTTTCAT TCACGATTTGCTTGGACACGCTATACATAGCAAAGTTTACTATTTGAGTT CATTCTTCCTAAATAAAATTTAGGAAGAAGGGGTTCAAAATTTTTAACAT CGTCTTCTATCAATATAAACTAATAACTTTTCTAAGTAATAAATACTTTA ATTAGACATAAATCAAGAATAATGAAAAACGTTTCTCTTGCATTAGAGGT ACTTTAATTTTCATTTAGCTAATTGGTATATAAAAGTAAATATGATAATA TTTGTGAAATTTTCTTGTCTCTGGTCATTTTCTCAAAAGGGCCCTTCAAG GATGAGCGGGCAATCTGCAAAGAATTTGATGAAAAAACAAACAATATCCC ATAATTTCAGTACCTGCAGCTCCCTGAAGTATATGCCTCAAGAAATTAGC CAGGATGTTGAGTCCATAATGGCTARGAAAWCATTKTACGACGAGCTTTA TATGGTCTTAGGGGAGCTACTGATCTCGAGTGAGTGGCCTCAAAGGTTTT TATTAACTTGCAATGATATTATTATTTAGAGCATAATATAAAAATGTAAA TCCCACGAGGAGTTTTGCTCTGACTGTTCTAAACGAGTTTGTGTGGACAA AGATCATCTCATCTCCCTTATTTCATTCTTTTCAAAAAAATTTATTGAGC CAAAATGTTGTATCAAAATTAAGTCTTTTTTTTTAAAATAATTAATACTA TTCATTTCTTTACTTTATAATTCATTCAATATTCTATAAGTTATTTTGTG ATATTTTATCTTTTTAAATTGACTGTGATTGTGGATGGTTTCATATTAAA AAAAAATGTGATAAAGATTACATGTAGAGGGTGATTTAAAATTTGAAATA TTTTTAAAAACCAATATCATATACGGGGCATACGCCATTACCAATTATAA AAGTAATTATCAATATACTTACTTTTAAATTTAGTATTCTTTATCATTCC TATATTAATTGCGGCTTAATAACTCTAAGATGCCTGAGGTATAATGATGA TGACGTAATTATTCCATGACAATTTTTTTTGTGTAAAATTAGGATGTATT CCTCAGTTTTTGGGATGGCATCATATGGGATTGCAAAATTTTAAGATCGA CGCATTTTTATTTATTAGACTATATTAATTTCTTTAAGATTTGTACGTAG TTCAGTTAGCTCTGTTTTGGTCTTGGTATTTTTGAATACTCATTAAATCA TTTACTTATTTTAGACAGTTGTATATGTTTATTACGTAATAAAATATTTA AATTTCTTAACATTTTTGAGGATTGCTTATACTAAAAATGCAAATATGAA AAATGAAAGAGAAATTATTTTTCATTTTGAAAGGAACCTATTATGGGAAA GCTTTCTATTATGTTTTTTGTTCTTTCTCTTTCAATGAGTGTGGTTTTTT TTTTATTAATGATTGACATAAAAATAGAAAATGTGACCATCTTGAAAAGA ATGGAAACTATCATTTATTTATGAAAAAGAAACATTTACATTATAATATT TACAAACATAAATATATATCTTCAAAATACTCTAAAAATAAAAATATCAA GGATGTTACTTTCATAAGTGACTCTTCATTTATAGGCAATACACATTATT TGCACACAACAACAGTACAAAATAACCTTGAATAAAGCTATTCTTAAAAT TTGAGTGCTTTGCATTAGAAACAAAAACAATTGCTTTGTGCCAATTTTTC TTAATATGTAATAAAGGAATATATTTAATTTTAACCTTACGTAACTTCAC TGCAATTCTTTTTGATAGTATTTCTTCCGGGGTGTTTAACAACCCCGATA TTAGAATTAATATGTATCATTATTTACACATTGTAGTTGTTACTTTTGAT ACAATTAGATTTAGTGTGGAAATAAATATTATTTAAAATACATTATACCT GTGAATTCATAATAAAACGGACCAGACAATAGTTCTGAACTGAAAGGTAC GAACTATATGATGAATAATTTATATATTTATTATCCAAAAGTATTATATC AATACATATAATTATGTATAATAATATGAAGGATAAATAATCTTAAATAG AATCACTGTAAGCAGGAATAACGACTTCTTGGTAGGGGCAGAATTGGCTA CAGGKTATTTTKATGTAGGCCTGTGACATGTCAGGCAACTTTGGATTGAT AAAACCCTATTCATCTTTTACATTTGGGTATCGGATTTTGCACACACTTG GGACTTTACTTGCAACCAGATCTTATAGTATAGGGGATTCCGATTTCGTG GTTTTGAGGGGGGGGGGGGAAGKGTTCCCGATAMAACTGAGCTGAAGGTT CACATTTTCACAATTTTTGCTGTTTTTTGGTCTCAAAAGAGACACAACCA GTGTCTTTGATGCACTTTGACATGTTCAATCTTAAGAAATTGACGTCAAT GGTCATCTTTGTCATGGAGAGATCTGATGATTGATAATGTCAAGAGTTCT TGTTCAAAATTTGACAGTTTCAGTAGTTTATTTTCTAATTTTCATTTTCA CCCTTTTCCTGGCTCTCTTTGATTCAGTATACAATTACTTTTGAACCATA TTTGGTATCATTTACTACTTTTGGAGGCATTCCAGTGGCAAGCAAGGGAT GAATCTTTCCCCTATGTTGTTCCTTTGGTATGTTAATAATCTCTAATATT TTGAATTTAACGTTAACAAAAAGAGGAGACGCAAACCTCTCTTTTGAAGG AAAAAATTATTAAATTGTTCTTTTGCATGCGCTGAGATATAAGTTTTTTT ATATAAATGTCTTATAGTATTTGCATGACTTTGTATTATAGAAGTTGGAT AAAAGAAAAATCTATATTGTAGACTGTAGAAAATTGATTATTTCTAAATT ATAATCACAAATATTTATTTTATAGAGCTCTTATTGTCCTTCTTCCTCCT TTTTTACATTCATTGTTTGGGTAAATAAACGATAATAGTTCATACAAACC TTCATTATAACTTTTATAACTAGTTCCAAAATTTGTTAATAGTTTTGAAA TAATAATAATGTACCTATGCAAAAAAATAGTACAATAGAAGGGATGATGA ATTAAGAGCTGACATCAAAGATAAAATAAAATATGATGCACACATGATAA GAGAAGAATTTTTTAGTCTCCGGAGTTAATTCGGAATTATTGGAGGGTTA AACAAAGATTTGGGAAAAATGTGGTGATTTGATGTAAAAAAATATGATAT TTATTAATCATCACACAAGCAATAAAAGTTTTGACTTTATCAAAAATGAT TTGTATTCTATAAATCAGATGTATTTGACACAATTTTTACAAATCTGTCA ATTTTCAAATATATTCATATTGTCTATTTTGAGTAATTAATTAAGTTTGA TCAAACATTTGTCTTAAAAATACAATATAATATTTTTAAAATTAAATTCA ACAGAGATTTCTCATTAAAGAACATTAATAACAATAGAAGGTCTAGTTCA GTCATTCATTTCTACTTTATGATCCAGAGATTGCTCGAGGAGGATATATG AAATAACATTTCCAACTCCATTGTTTATCTTTTTACTTTTTAATTTCATT TTTAAAACGAAATAGTTTATTAAAAAGGAATTTGCCTTGAGCAATTTTTG TATTAAAAAATTAAATTAAATCTTTTTTGTAGCTAAATTAAACATTTCAA AAGCAAATACTCTTTTGTGTATAAAAGGTCAATTATTTAGGCTTCTAATT AAATCATTTCAATCAAAAAAATCGTTTGTAAAACAAATGTAGTATTTCTT TTACATTAGAAGCCTTAGGGGTTTTTACATTTATTTTGTACTTTTTCATG ATTGGATGATTTCACGAGAAATTTATAAAAATAATAAAAAAAATCTTAAT AATTTTTTATTTTCTTGTAGAAATCTGGGTTGTTTTTTTAACTCAAAATT ATAGAGTGGGTCAAAAAGATTCTTAGAACCAATTAGATACGAAAAAAAAA TTACAGATTTCTAATTAACGCGTCAAGTACTGTTATAAGTAGATATGAAA AATAAAAGAATTTATGTTATGTTGTCTTATGTTATGTGTATGTAATTTTG TGATCCTTTCAAATATTATTTTTTTAAAGTATCTAATCAATGTCTTTAAA AAAAACAATACTTACAGATACAACCTTTGCAGAAGAAAAAGAAAAGATCG GAGTATGTCTTATGGTACTATTTATTTAAAACCTATAACCTAAACTTGTA AGGGGTAAGGAGGTATTGATGCCTCCACATTTATTCTCAAAGGATGAAGT TGATTCTAAAGAGGAATGCCATATTTGAATCCTTTGGATTATTTTTTTTA GAGCAAAATGGAGCCTAAAGGCCCCACCAAAATAATTTCATTAATTTAAA AACTTCAATTATCAGGATATTGGTTGGCTTTTGTTGATTCTGTGGAAATT GTCAGACCATGAAGAAGCTTCCAACCTTGTCTTAAAGTATTTGTGGCCAT AGATGGTGAACAATTTGAGATATAAGTTTTAAATATTGTAGTTGTTGATA ACTTTAATAAAAATTTGTGACATAATTTCTAATTTTTCCTTAATCACGCT CAGAAAATATTTACCCCAAACTGAACTTTTTTGTTCTTAAAAAATTTACT TAACTTTAAAAAATTATGTTTTTATTTGGCTACTACTATTAACACTTTTT TTTGATGAACTCATCCCAAGAAACCAATTTTGTATACGGAATTTTTTTTT AATGTTCCTTTATTAGGTTAAATGGAGTTGTACTGATTGAGCATAATTAA CATTATTGTATTACTATCACTCCATCTAATATAAAAATTTAATCTTTGTA GTATATATACATTATGTTTTAAAGTTTTACATAAGAGTTGCTTAGCTGTC ATGACATTGTAATAGAYCCGCTGCAAGCAGCCGTCAGAGGAAACACATCA ATACATAGTCTCTACTCTCTACATGGCAAGGGCATATTTATTTATTGATT TTCAACAAGCTGCGATAGTCAAAGCCTATAATGGTTCACTCCTAGTTATT ATTTGTAAAATATTTTAAAATTCACGTTTACAAACAGGTTATACGTTTTA ATACATATTAGGTAAGAATATTAAAATTTAAAAAAATAATGTAATTTAAC ACTTTAATTAACTTGCAGATATGAAATTTCCTGTGTATTAATGGAGCTTA TCATAGTATTATCTTTAAAAAATATATGTATAGATATTAAATTTATTTAT GCTTTTAGAAAATTTATCAGGTTATATTTTTATGCCTTTCTAATGCCTTT TCCCTAAGAATAATGATAGCATAAAAGTAGATATTTTTGTTATATAAATA TTTATAAAATCATTTAAAAATTTAGTTCCTGATCAAATGTTCCGGTATTC TGAAACTACAAATGATTAATTCAATGAATGCTGATATCAAACATAATCAC CTTCATTTGAAATAAAAGTTTTAAGTACCGAATTATAAAAAAATGTGTTT ATTTAAGTAAATTTTAGAATTTTACACGTAATTTTCAATTTATTTGGGTC TTTTACTTTACTTTCTTCTTTATCAATCAAAGATCTTAGTGCTAAAATTT GGAAGACAATTGAAAATTTATGCAAATTTTATTCTAAAGTTATTTTTTAG CGCTTTTACCTTTGAAATTTAGGTTTCATTTTATTTTGCAATGTTTAAAA CATTAAGTAACTTTAGTCACTGATTTCATAAAAAGTTAATGATATCTTGG TATTAATATCTATTTTTTTGTAGAGTTTACAGGAATTTCTAAATTTTTAA TACTTATGAATTATTATTGCAAAAAAATTTGGATGTATATATTGGAAGGG AGGAAATTGGGAAACATTGCAACTTTTTTTGCAATTGGCTAAATTGTACA GAGCTAATTTGACTTAGTCCTACAAAGTTTAACACAAGAAAGCTTCATAT TTATGCAATTCTTAATGTTTCTTTAATTGGCATTATAATTATTCTATCTG AACTACGAATTGTCTTCAAGTTCCATAAACATAAAATATATTTCCTTTTT TGAGGAACAACCATAAATCAAACCCACGCACATTTAGTTAAAAAACCAAT TTGGAGTTTGCGTTCGTTACTGATCTATGTCACTCTTTTACATTATTGAA TACATTTAGAGTGTTTACCTCTCATTAATTTTTCCTGAAATTGCATTTAA ATACAACTCCTGAAATGCTATAACTGTTTCTGTCATCAGATACGGCTGSA ACAGKCTCAGGAGAGATTAATAATAGCTAAATAATAGAGTTTTGTTAAAA ATTAAGAAAGTTAGACTAAATAATATTTTTAATGGAATCAATGAATGGTT TAACATCAATGAACCATACAACATTAAATTGTAAAGTATTATAGATCTGA AATATATTTTATATTCACTTCAATTCACTGTGCATTTGGTCCCTATCTCA AAAAACCCTTTTCAAGATTTTACTATGCATACATATGAGATGCATTCTAT ATCCAAAAGTGTGCGTAATCAAGTGCTATTGGGCCAATTAAAGCTTCATA GAGCCTTTATTTCAATTTGTATTTTCCATTGCAATGGATCTTAGATTATA GAACAATCTTTCTTCAAAATGTATCAAATTTCATACGCTTTATTATAATT TGAGAACGTCAATAAAAAAGAATAAAAAAGCAACGGGTCGCAGACATTGT GAATTGGTCAGATAACCTTATCCTTAAAGTCATGATGCTTATTAACAAAC GCCAGAGTCTCCCCAGAACGACAAGAAGTGGAGAACATGACAGAAGATTT CGTGAATGGGGGGCTCAGGGTGGAGACCAATCAGTACCAGGAGGTGATGA AAGAGGTCTTGAAGCCCTGGTTGGATACCAACTACCTCAAAATAATTACT GTTGGTAAGAAGACTCAGAACCTTGTCATAGGGTTATAACAGCACCAGTT ATCTGCAAAGAAAAGCTCACTGAGTGGCTCCCATATTTACTGGACTGTTT CTTWCTAGACCATGGGATATGGGGTGTACTGGAAAGCAAGGCCTGCAATA TCCCCCACACAGTTTTGATTAATTGAAGGTCTTGCTTGTGATTTGCTGGG ATGATAAGTCAAATAACTAGGTCATCAAGGTGTGTAAGACCTTTGGGTCT ATACTGGAGACCAAAATGGCAGTAGACAGAGGACATTTAAAGAAAAATTG ATTATATTGTAAGGTATCATTATTCTAAGTACTAATCTTGTTTATATGTA GATCTTGTTCTTGAGAAAGCTTCTTATATTTTAATATAAAAAAAAAGGTA AAATTTCCTTACTTATACTGTATACGTAAGTATATACAGGTAATGAATAA TATAGAGCGTTTGTATCACTTTTTGTATTTTTATATTTTGTATAGAGTGT TACAATATCTCACATTTATCTGTAGTGAATGGGTTCTAATTGATAAAATC AAAACATAACAAGCAACAATATTTTATATTAATTAATAATAGCAGTTTAT TATTTTATTAAAATATAATTATGTGGATAAAGCTGTATTGGTGCTCAGAA AAAAAGGCACGTAAAAATTTAATAATTTATATATGAGATGTAGCAAATGT ATAATATAATAAACTATTCCAAGGATATTTTTTGAATCTTTGGGTTTGAC AAATACTCTGAAGAAGTGTGGATGGGTTTGAATTTTGACACAATATTTTC TTTGTTGTAATATATAAAAAATATTATTATCTTTATTACATGTGTTGATG ATTTATTTAATGTCTCCCAGACTTTAGAAAAGTACAAATTACGACATTAA ACAAAATCATACATTTAAAAAATAAAATATCTGCAACATTATAACTTAAA AAAGCTATTCTATTGTTTGCCTGAGTTTTCATAGACACAATATATAAGAC ATGGGCTGATACGTCCCGGGCTTCACATAGATATGACATTAGTTGTTTTT TTAAATTTCACCTTAATACAGCAATCAAAATTTTATGACAATCTGTTCTT AAGTTTGCAAAGTTATTAGGCTAGTACTAAATGTAAAGCTACTTTTTTTA GTTAAAAAAAATGGCGCAAAATAACAACCTGTTTTAATTTGATAATTTTC TTTGATATGGAAAAATTACTGTTAAAGATATGCAGGGGCTTGAAAAGTTA TATGGGGACTTTGCTTTATAAGGGAATAAAAAAAAATAATATTGATAATT TAAAAAAATCCAATTTTAAAGGAAAAAAATGTGCTTTCTTTGTTATACCT AGAATTAAACAGACCATGTGTTACTAATACTAAAATATCTCTTGTACACA TGTTAGGAAAAAACCTAGATTTATATGTCGTATTCAATTTATGTAGTCCT TGAAAATATTCCTGAAATAGTGCATTTCAGTAGTCTTAAATTTTGTTCAA TTTTCAATAGGCAACAAATAATTTCATATATTTTATTATTTTAATCGTGA GAAAAATGGATTTATAGATCATGGGATTTTCAAATGTATAGATATGCTGG TATGCTTATATTAGATTAAATACTTAGCTTTATCCACATAGTTTCAAAAT GAAAGAATTGTGAAACTGTAATTCATTTGTAACATAAACTATACGTATTA TCCATTAAAATTTTAGGGGGGCTTCAAAAAACTATCAGGGTTTAAAAAAA GAAAAAAAGGTGGCTTTCGAATGCTTACGAGGCATTTTCTCTAAATTGGA AAACAATACGAAAATATTCTTTTAAAAATTGAATCTATAAATAACTAGAA ATTATTTATATATTTATTTGAATCTTTCAAGACAGAATAACAAATCACTT CAATTTTGAAACGAAGAATTTCGTAAAAGATAATATTTTGTCCCATATAT TTATTATAAGATCGATTTATAAATATATAAAAAAATTTAAAAGAAAGAGG AAGTCAAATAAGAAGCAGTAAAATTTTAAAAAACATCAAGTTTCCAAGAA TATTCTTGTTGAGAGTTATTTATTTCGAAAATAATATTAATTTTTCTATC AAAAATAATAAAAACCACTTCCAAAATTTATATTTCAAGGTTATATTAAT ATTATTTTTCTTTGATTGTTACTCAATTGATAAGAGACAAAGTAATAAAT TCTGCTTAGGCCTTTAATTCCTTCTCTCTTTAATCATAAGTGATGCATAA AATATGTTGTACTAGTTTGTAAAAATAAAAGAAACCGAAAAATAAATACG GTAATCGTGATAAATCAAAGTATGTTTGGAAAAGAGGAGCTATGTTATTT TTATGAGATCAGCTGGAAATAGCCACGAGAGGAAGAAAATAACTATAAAT GCCTCCCCGTATACAGTAAGGACATATACGTCATAATGACCCTGATATCA ATATTGAATTTTACTGTGAATTCAGTCAGTTTGTAAACATATAAATCCCC AAAAAGTTATCAATTTTCTCTCCGTCACAAGTGATATAATAACTTTATTC TTAGATGTTCCCTCTTTATAATTAAAATCTATGATTACAGTCTTTAAGAA AAAATAAAAATCATTACTCAGATTGTCATTTTTTTCTGTTGGTCTTTATT TGGGATTAATATACTTTCAAATTTAAAAACATAAAGGACAAAGACACAAA CAAAATGAAACATGCAAAAATGAATATTAAACAGATTCATAATCTCCCCT GTAAAAATGACAACTATACTTGATATTTTAAAACACTCGAGTACAACTTT ACAATGTTGAAAACTCATCCTGTGTCCTTTTCTTTTTTCTTGACCTTTAA ATGTACAAAATATTATGTAATTTTGTAAGCTTGTACTCAAAAAAGTAATC TAAAACGTAAAGAACGTCTCTATATATTATATTTAAAAAAGGATATCCCA CTAGAAATGATTGGTAATATCCATTAAACAGATAAAACGGCATTTTCCAC GTTTGTCCTTATAAAATTTAGTTCCAACTTCCAAGATAAATTATAGTAAA TAATATGTACTATTGTTTCATGAAAAATAGTTTAAAGAAACTTCTTCAAT ATTTGAGATAGCTAGAAAAAATTAATACAAAATAATGAATGTAACTCAAG AAATTTATGTTGAAAATGGGGGGGGGGGGGGGGGAAATGTGTGGGAACAA AGAATAACATGTTGTTTTTTTTTAACTGGTGTCTTAAAAAGTCTTTGGAA AGTACAGACCTACATTATTAAAACTTTAACAATAGGACGACTCACCTTTA AGGTACAAAAAATATAATAATTTCTTACTTTACATATTTAACAAATAATG TTAACATTTAAATCACTTACAAATGTTAAAGGCACGGTAAATTTAATTCT CAAGCTCATAGTTGTTACTAAAATCAGACAAACTATTATCTTAATACCTA CAATTTGGATATCTCGCAACAATATAAATGATTTTTTTTTTTGCAGGCTA TAAAGAATAAATATTTGCAAAAAAAAATCCAACTTTTTACATTATTTCTT TACTTATAAGCTTATATAATAATTCTTATTTTTTTCTTCGAAATGAGAAT TCTCAAATAATAAAAAAATTACAAATCGCTATACAAAGTAACGTTTTATA AACATGCAATAAAAGACGTAAAATACAGTGAGCCACATTTTAAAGAAAAA AATTTAAATCAAATAAGAATATTTATAAAATGCTTGCATATTTATGTATA TAATAGAGAAACGGTTGATGAACAGCAAACAAGGAGTTAAAATATAGGTA TGAGACCCGTAAATAATAAAACAATCTAAAATGATTTTTGTTTAAATTTA TTCCATGTTACATTTTTTTTTTAAATATCCTAAATTTCATTCAAAAAATT CATCTGATAATACCTTGGAGGTACTGAAAGTATTACTTAACGTAGAAAAT AATTGATTGTCACTGTGGAATGATAAGAAAATTATAGTAAGTGTTTCAAC AGCTATATAGGGGCCGAAAAATGCTTCAGATATCAAATAAACACATAAAA CTATATTTTAAATCATTATTTTATCTNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNTATGTCCATGAAATCTAGGACTTAATGTATAAATGATAAAAA CAAATTTCAAACAATTTTGATTTTTTTTCAAGTTTTTTTTTCTGCTCCCC ACATAAATGTAATACATGTAATATTTAAAAAAAATACACATAGAATCATT TTTAATAGTTGAGCCATTACAAATAATGTTTTTTGAAATTATATATGTAT ATGTTAATAGAAAAAAGTTTATATGTCTGTATGGTCGTAAAGAAATTTTT GGATGTGCATTTAATGTCTTATAACTAGCATACTGGATTGGTATTGTGTA CTCACATCTCCTTTACTAAATTGCATTATTTTTTTTTCATGTCATAATAA TTTCTTCTAATTATTTTAATTCCAAATCACACAGTCATTTGAAAACGTTT AAGATCATTTATGATAGTTTGTTATTTTTAGCAGAATATAAATAAATTTC AGAAATAAAACAAAATATGACTAATTTTGCCAAATGACGTGAATTAGTGC AGATACATATTATGCACCCTTTCGAATCAAATTAAACTGTGTTTTTTTTT TGTTTTTTGGGCACAAACTATTGGAAGGMCTTGAAACAATCAACTTCAAC TTTGAACATCAGAAAAGGTAGCTTTTTACAATTATTTGAAGAATATCAAT TAGACCTAATACATGTGTGCACGTCTAAAACTGAAAACTATGAAATTTTT TAAAAATAGTCAAATAATTTTGTAATTTTTAAAGTGGTCGACCATAATAT ATTTAACATGAAAAATGAGAGTCTGAGACACAATTATATTCAATGTCTAC AAGCTTGAGAGCTTGTCGAGGGATTCTCTTGTAGACCTTAAGGCCAAGAT CTTTCTTAACTATCTGGTCCATGGTCCTTCTGCTAACGTTGAACTCCCTG GAGAGGCCGCTGACGGTGACATTGCCTCTCTTGTCCTCGACAGACTTTTT CACMGCATCAACCATTTTGTCCGACCTTCGAGGTCTTGACTTAGATCTTG TGGTCACCTCAGAAGTCCCTTTGGCTACCACGCTGTTAAAGGTGGTGCAG CTGCAGTTCAGAACCTTGWCAATTTCAGTGGGAGTTTTTKCCCGCGCGGA AAGTTCCAAAATTGRGACTTGACGTCTCTCCATATTATCAGCTGTTGTTT CACTACTGCTATTCAATTCTTGAGAGCTTGTCGANNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNCTCGACATACTTTTTCACGGACAGCATCCMTTTTKTYCGGCCTTTGA AGCCTTGACTTAGATCTTKAAGKCGCCTCAGGAGKCCCNTTNGCTACCAC GMTGTAAACGGGGTGCTGCTGCAGCTCAGAACCTTGGCAATTTCAGTAGG AGTTTTTCCCCGCGCGGAAAGTTCCAAAATTGCGACTCGACGTCTCTTAT CGGCTGTTGTTTYACTGTTGCTATTTATATTTTKCTGGRGTTTTGATTAT AACTAGTCAAGACCCTTGCCTCGAAGTATAAATCGGGTTCAACTCAATAA AATCACGAATATGTGCAAAGCGTAAAATTTAAATGAGTGTTCTGTTTTAG ACCTGCAAATCTGTATGCAATCACAAACTTCTCATGCAAGCGTCTTTAGG CAGAAGGTTAATAAACACACTTGCTCGACCAAGTATAACATGATACGTAC TATACTTGTATAATATGAGTTTATAAACGTCAAGAAAACGATTATTATGG AATAAGGTGAAATGTTAAAGGTTGCCTTATACTTTTGCATATAACTGTAG TCAGACTTTTCAGTATTAACAGCCCCCAGCCCCTTCTTCTGTCTCTTTAC ATTTTTGTGTATAAGAAATCATACTTATATATTTAGTATGTAAATAAAAG TAATTTGCCTCTCCCCTGCATTATAAATTTTAAACTCTGACTTTGGTTGA GGACACCGTCCACACAGAAACGTTTTTCTGCGGAAAAAGCATAATATTTA TTCGTTTTGATATTGCATTTACTTGAGAACGTTGTTTTATTTCCCCTACT TCTACAAGTTCCTATTTACAAATTATATAAATTAAGAATAGGAGTAAATT TTTACACGCCAAATCTACTCATTTTCCCATTAGATTCAACAATTTTAACG GGCTCAGATTATTCAAATTTCTTAATGATGAAACTGCAAACATTTTGAGT CCTAATTAAAGAACTACAGCATTGCTTTAAATCGTGTTGGTTGTGGTAGG GCCAAAGTTTAGCATAAGGAGAGAGCAGAGGTCGTTGGTGCAGGGGTCAA CATGACTTTATTCAATTTGTGGTATCATTCTACGAGCTGTAATTTGTATT TTTCGTTTCATTATCACTTACTAATGTTGCATAGGATACGGTTCCTTCAA GGTGGTGAGTGTATACCCTCTCCTATGCTGTGGTAAATTTTCTGAATTTA CAGCCTCGGAGTACTTTTTAAATGTTCATTAATTTACGACTAATAACTTA TTTTCTTTTTCTTTTATAATAATAAATTTATTTGCTGTTATTTTAATAGT TAAATATTAGTTATTCATTATATATCGTGTGAGATATTTGTTTTGTTTTG AAAAATATGTTATTAGCTGGAAAGCCAATTGAAGCACTCATATTGAGAGA TATGCATAATTTATGTGCCAAGGGAGTGTAAAAGTAAAAAAGATAGAAAA TGTACGTGGTTACACTAACAATTTAAAAAAAGTTTAGGGAGGTTGCAGTT TTGTTGTCATGTCGTTGTATTAGATTAGCTGTAAGCAGTCGGGAAAGAAG GAAATAAACACAAATTTTTCTCCATATATAGCAAGGACATATAGGCTAGA ATAATTCCAATGTCGATCCTCAATTTTATATTTACATTTGTTTGGTTTCT AGTAGTGTCTACAAAAAAGCTCAATATTGTCGACTCATGATAAAATATTA TAAAGCACTATGATAAAATCTAATGAAATAATATGGTAAAATGAAGAGAT ATAATGTAGAAGAATTAAATGAGATAATATGAATTGAATTAATTGAAATA TTAAGGGGGAATTGTGATTTAAAATATTGATTTCCGTCTTATTGGTATAA ATTTATCGACTCCATCTCTGACCGTAGACCGTAAATGTCTCGTGTTCTTC TATTGTTTTCTCTCTCCCGTCCTTTANNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNACTATCTTGTTGGTTATTCTATTTCTGAGTGAGTGCTTCTAATT TGTTATTCAGAGACTCAAACTTCTTGTCAATAGACGTTAATTTTCCATTT GTTCATCAATAGTGTACATAGACTGAAGAGAATCAGAGGTATCCCTGTTT CTTTTTTCTTACCAATCACCCTGATGATAACAAGATGKTTTTAGTGATAA CCGAAATAGATAAAAAAGAATATAGAAGATTGACAGTTCTTAGAGTTAAT TGCAGGTAGATTTGAAGAATTGCGCGTCACATGAGTGCAAGGAGGAGTTC TTACGTTTGCCACAGTTTGGTTCTCCGTTGCAGGTGACTCAATATATTTT TTTACTTAGAATGATTTTTTGTTCACTTCAGTCTTAACCCTTTATAGTTT TTTGAATTAACAGAAATATTTGTTGAAATAAAATGATATAGTGATTTTTA TTTAATACGAATTACTAATAAATAATTACCTATTCAGTTTGTTTTGTGAT CAAAATCGTACTAAATATAAAAAACACTTAATGACATGGTTGTTATTGAT GTAAAACCAAATTGGCAATTGTCACAAATCAATATTTTCCCTTATACAAG CAAATATAACTTTTTATATTAATTGCTACTTTTTATGCGTAAATATTACA ACAAATATAAGTGTATATCTAATTATTTGCCTAATTTGTATAATAATTTT ATGAACATTATTATTTTTGTTAAGCTTTTACTTTTAGAAATTAATTAATG AAAATTAATTTTAAATTATAAAACAATGTCATAAAAATAGAAGATAGTCA AAAATGCTAATGAATGTAATAACATTCTGTAAAATAAAGAGAACAGCTCA TGATTTGTTTTCTTTTCAAAGGCTTGCAAATATAAATTATTGGGATTTGA TGCTATTGTAGGATTTTCTTGTTGATCGATTGAAAAGTATTGGCGTAAAG TTTTCTTTTGTAGATACATTGTAGCCTTATTTTCACAAAAAAAAAAACAC ACCTATGGAATAGTGGACAATAGAAACGTTGGAGTATGAGTAATTCAAAG TGGTTTAGAAGATTGAATGGGAGTAAAAGTACATGGGAAAGAATGATAAA GGTGGATATGAAACTCTCGTTCGAAACTAAAAAGTATTAACTGATCCAAT GAAGATGGAAAGTGGCGGGSAATATACAATTGGAATAGTTACAAAATGAT GGTCCTATTTTGATAAACATAAACGCATTTTTAAAAAAAATGGGTTGTTA GTTTGTACCAAAAGATCAGTGAATGTATTTTCCATTCACTAAAAAGTTTT TTCAATGAAAAGGATCAACAACCCCATAACTCCAACTACCTCATCTAATT TGAGGCTTATCCTAAAATTCAGGAAGAGATTGGGGATCAACAAATGTGCC AAATTGATTTTTTTTAATATTGAAAGCTTTCTGATTTTTCATTAAATATA TTGCGTAAATTATAGGCTCATCAAAATTTGCTGCCTAAAAATAAACGTAT GAACAAGAACAGTAGACGTATTTTTAGGTTATGTGAAGTGATGGAAGAGG ATGATGTTCATTTTTTCTCGAAGTTTCGATATTCCAAAAGTGGAAGAATG ATAAATGATAACATTTGGGAATCGATTATGAGGGAGATATCTACTTAATG AGATATAATGTTAGTACAGTGAAATTAAGGTCTATAATGATAGACTATTA TCGATCAACAAGAACCCCAAAGTTTTGAAGGAGAGTTTTATTGACTATGA ATTGTCTATTTTAAGTGATAAACTAGTTTTAGATATGTAAATACTTTGCC ATTTTAAAGCTTATGTTATTTAAAATATCTGTACGTTGGTTACTTTAATA CTTGTTGGGTTGTTAGTTAGAGAAGGTGGTTGTACTCCTGTTACTTATAT GGGTTTACTTTGAGTACAATAAACCGGCCAAACTCCGGCTAAAGAAAAAA AAACAAGGACCCCACTTTATCAAGGATTATTCAAAATCATTCATTAGATC ATCAATATTATCCACAGCATCAATATAAGCCATATTTTATATTGAAACAA CTTCTTTAGAACTCAATTACTCAAAAAAATTTACATTTTTGAATGTATTA TGATGATATATTAATCAAATTTTCATAACTGAAAATAAAACTTTTTTATT ATCCTTTAATTTCAAGATTGGGCATCTTTCTCATGCTCTTCATCAAGCTC CTGTCTATCTTCTCCTTCACAAAGTCCAAAAAGGATAGAGTCCTAATTTT GTGGAGAAACCCGATGACAGGACTCCTTGCAATGCTTGGCCATCCTTTTT AAGCTTCTTCATAAATCAGACGACGATCCTGATAATTTCTGCTACCTTGA TATAGCCTCCATCACGCTCTCGATAGTAATACAAATGTTGCTGTAACAAA AAAAAGTTAAAAAAATTGAATTATAGAATAAGCTCGTGTAACATAAAATA ATTTAAAATAAGTGGTACTAGCTCTAAACTGGTTTAAATCCTACTACATG ATTCGTTGCCATACTTTGTACACAGTGTGACATCAGTATATTTTTCGATT AAATGTTTAGAATTATTAAAAATAATTCATAATCAACAACATTAACAAAT CAGGGTTAAAGCTTCCTTTTTTTTATGTGGACTTTATATTTCAAAACATA AATACAAATTTAAAACTATAATATATATACCTTGACACATACAAGATTCA ATAGTTGATAAAATATGACAAGAATTCATTAAGTTTGATGAAGTTGTTAT TACATAATTACGACACAAAAACACAAGGCATATAATTTATTAATTATCCA TTAAATATTCTTAATTTTATCAAATGACCAGATAATATCTGATAGTTCTT AGGGTTTCTTCTGGATGAAAGGCCAGTCAAAATTATGAAGAAAGAGACTG TTCATGTGAAAGGTACTGCACAATTTCTTGATCATTAGTATAGATCTACA CTTGTACAATGACAGAAATCACGACTATGTACAATATGTTCATGACCATT AGGACATTCCTTCAATCTCAAAACCCATTGTAAAAAGGGATTCGATTATA TGCGTCGTTTTGTATTCACAATAAGCATTCCAATCTTATCAAACCTCTTT AGCACTTCGTGGGATCTTAAGAAGAATATGTTTAGACTTATATGTATGCA AAAGTTGTTGTTTCTTCCTACAAAAGGATAAATAAGACTTTAGTGACTAA GTTATCTTTTTTTTAAGGTCAAATTTGTGTGTAAGCAGCGACATTACAAG CCAATTCCACATCGTTTTTGCTGATTTGCAATATTCCCTCAAAAACTCAG TGGTCATATGTACGAAGTGAACTACTTTTAGGGGATTCCAAAACAGAGGT ATTAAAGTCTTACAGAAAGAGCAAGAATGAAATCGAACGGTTTCTTAAAA TCCCCAACCTCTAGAGTCCTAAGTGTTTAGTCAATTGCGTATTGCATATT TTTTGAAATATCAGTTGTAAGTTTTTATGTAGAAAAAAACCTATTGATGG GCAGCTATTTTATATTCGGTATTGTTTACATTTGTTTAGCAACAATAACT GAAAGAATTTTACATGATATATTTGGAATTGTTACTACTCGGCATGGACT AATATCAGTTCTATCTCCCTTGATAGGAATTTAAACAAGTTTTCCCTTTG TTACTGATTTCACTTTTTTAGTACGTATTTCCATCGCCCCACAAATACAT AGTAACTAAGGGGTAATTTAACAACTAAAGGGCTAAAAAATTTATATCCA ATTCCTTCCAGACTGATTGCATTGTCATCTTTGAAATAATTATTGACGTA ATGAGAAATAATATTTGTCAAGAAAATTGACACGTTCCTTCTAATAAAAA CTACACCTCTGTCCTCTGATACTGGATTGAATATTTAATGTATGTATTTC TCTTTTATTGTTTTCTTCTTAATAGATGCTTTAGCAACTCACGCTCCCTT TTGAAATGGAGTCCTCAACTGTATACTCAAGTTGTATAGAATATAAATAT GAAATTCTTACATACCGCAATTATAAAATCTATAACAATGTACTTCTTTA TATTTTCTTTTTTTAGTATGACGAGTACACTTGATTGGATTGTTATTTTT TTTTTTAGATCAATTGTAAGACAGTCCTAACATACACTGATAAATGACTG TATGTTGCACATTCACAAATGACTTATTTTATTTAATTAAGTAATGTATA TAAGGATGGGTTGCTTGTTTTTAGGGAACCGGGTATATTCGAATATTTTA ATAGCTGCAAGTAATTTGTAATTACATACATTGGAGGAAAGGTATGTTTA TTTTCTCAACACTATGAAAAGTTCAGTGATTATTTTTTTATATTTTGTTT TGGCTATCCTTTTTACATAAACAAACTATAGTAATCATTTAGGTATTTCA TTATCATGAGCAAGCAAAAGCTAAAAGGCAGAGCATCTCATATCTCCTAG ATGCCTGAGTTGATGTGATAAAGATTAAGGACATTGTAAAGTGTTATAAG GGCATGGTGTTTAACTTGACCCAGATAGAAAAAAAAATTAAAAAAATGAA GAAGACCTTTCCAGAATTCCAGGAATTGGATGGCACAATTTAAGGAGGGA TAGAAGTTTTTTTAAGTTTGGAGAAGAATATAAAGGAGGATCCCAATAAT TCCATTAATCGTCTCGCCAACAAATTCTCAGTGGTTCACAGGACTGTCAG GAGGAGTCAAGAAGATCAAGAAAATCCTAACATAGATCAAGGGAAATTGG TCAACAAAATTTTCACAGTTGACCAATTATACAACCACCGGAACGACCGT TGGCTTGCAGAAACAACAATAGAGGTCCAAGGGCTTATACACCAAATATA TGGTGCAGACAATGGTGTTCGGTGTTATGGCCTCTGATGGAAAGAAGATA CCTTTTTCCCAAAGCAGGACAGATGTTCGGCGATGAGGCCTATTATAAGG TGCCTAGGTACACCATCTTGCCATGGTTGAAAACCAACTCTCTGGAGGGT AACTACGTGTGAACTCAGGACTTCACCCCCACTCACACGTACAACAAGTC CCAAAACTTCTGTGTAGATAACATGGCTCAATTCTGGCCCAAAGATATGT AGCCCCTTCCTCACCATATTTGACCCCACAGGACTTTTCTATATGTGGCA CTTTTGAGAGGGAAACCAACTGGACCTCACATTCAAATATGGACTTACTA AGTCCCCCTATAGCGGCTGSATGCGACACCCTGTCAGATGATTTTGTCAT CAACTCTTGTAGGGCCTTCAGGTGACGTGTAAAGACTGTGCTTGATAAAT AAGGTGGCCAATTGAGTGAAAATTGTATTGCAAAAACTTTGTCTGCATTT TTTGATAACAATATGTTTTTGCCTATTATTGAAAGTATAAAATTATTGAT TAATTTCAAAATCCATTTCTTGAGTCCACGTTTTGCTGCTCTAACCTGTA TACATATAACATTAGTTAAACTTAATATTTTGGTTGTTCAGAGTAATGTA TTAATTCAACTTAGTAATGCACTTTAGACAATTGTTAGTAAAAAGACTCC CTTACAGGGAGCCATTGTCTAATCCAGTTTTGGAAAAATTACAACAATGA AAAGTTGCGTAATAATAAAACATTAATATATGACGTACAGCTCCTCAATT TTGATTTGGTTTCCAGTGCATCTAGTGATAAAGGAGAGCGTAGGAAAGAA AAGATTGGGCGTTCCATGTATGATGTCAACGATGACTCATCTTTTGTGTA CATAAGTACTGCTATCAACAAGAAGAGACTAAAAAATTCCTCATAAATAT ATAAAAAAATATATGGGTATAAATTAGTGCTTCCAAATAAATAGAAATCC AAATGCCGTTTTTGCAATTTATATTTTTTACATTGATTTTCCGCGTACGA GTCCAAAATCACAAGTGGACAAATCTGGACCTATCCTGATTTGTCATACA TTTTGAGAAATATTATATTATTTCTCAATTTAAGAATCTATGGCTTCACA ATTCAAAAATATTAAATTCATTGTTTCAAAAAATAGTTATATATTTTGCT TTATAAATGAGTTGACTATTTATGGGAAACAATTATTTAACTATTTTTTT TTTTTAAATTAACATATTTATTGTACATTATGTTAATTTAATTTTATTGA ACATTGTGTCCTTCAATATGAACATTTGACATGTAAAAAATTATTATAAT ATTGGACAAGTGCGATTTTTATTTTCTTTTCTTTTCAGAAATACATTTAT TCATAAATAACGTATTTTGACATGAAACTATTACTAACATGCAAAAACAA GCTGTGATATATATATATATATATATATAATTAGGATAAAAGTCCTGAAA AATGTATAATGAAAAAATAGACAAACACTCTCCCCGAAATAAAAAATAAA ATTTTTCATGAAATATGATATTTTCCTAACAAATGTTTCGATTTTTACAT ATATTTATTTCTACACAAATGTTTGTCTAGTTACACTAAAAAAATGAATC ATTTTCTATTGTCGACATAGAAAATATTACCTGGTGAATAAATATTGGTG AGGAATTAAGTTCATACCTTTATTCGATGCAGCTAAATATGTATACATTT ATTTGTTAGTCATTTGTGTTATTTACCTTGTGTATTTTTTCAAAGAATCC TAATATCCTATTATCAAAGCATTAGTGAGCAGCACTTGAAAGAGTATGGG AAACATGTTTACAATTTTGACTATAACACCACGAGATTGATAAAATMGTT CATATTCCTTTAAATATACATTTTATCTTATATTAAAAAAATAMCTTAGA TTCTATGCCTTAGATTGATAGATTGATGTTCATGTTGTTAACAAAACTTA TGTATATGTCACGGTGGAGCCAAAAAAACCATCATAGGCAATTTAATGAA CTCCAGGAGGACCATATCGGGCATCATTAAGTCCTTAAACGTCAGCAAGA CCACAGTATGTCAGTTCAGAAATTGTTTGGATGATGGAAACAANNNNNAA ACGAATTCCGTCTTCAGCGATATCAACAACTCTTGAATGATCCGAAGCAC ACCTGCAACTTGGTAATTTTGATTATGATCAGGTGGTATGCTTTGGAAAG GCTGACAAAAACAATGGCACAGTCCCCTAGACAAAACATCCGGCCTCTGT GATAATGTGTGGGATGGAGGCATCAATTAGAGAAAAAATACATCCCATTT GATTTTTTTGTTGGATACTGGTTACCCGCGGCCGACTACGAGANGGMGTT GYACAAATGTGTGGTTTTACAATTACTTACTACGGTGCAAAATGAGACCT GTATACAACACAATCTGAACTCTCTTATAAAATTAAAATTAATTATTTCA TTATTTATATAATATAAATTCATAAGGGGGATGGAGATGTGTGGTCATCA GTGGCTTATATTGAGTTATATATAATGCAGAATAGTCCTTTTTGTGAACT AGATAACTATGATTATCAGAACTATATAAAATGAACATGCGTATAGTTTG TTAGAAATACAAAGTCGTCTAAAAAACAACACAATAAACAAAAAAAAAAA AAAAATAGAGCGCCCAATTGTTCAAAGCGGGAGNGMGCACAAAACGGCAA AAGTTTTTTTGTTATAAATCGACACGCTAGCTTTAGTATCCTGCATGGCT TGAGTTATTAAATGTCGACAAACATACTAAAATATATACAATCTTTACTT TATTAAAATAGAAAATAACTTAAAAACAAATCATCAGTGTTTCGCTCCTT TTTACATCAACACACTTAGGTACTCAATATATAAATGTTATTTCCTCACA AATGAAATAATAAGGACTAGGGATTGAAGAAATAAATATAAATAGTTTAG GTTCCACACAACGCCAATTACAAAATTTGCAAATTCAAATGTTAAGAATA TATAGCCCCAAAAAATTTAAATTATCTTTTCTTTTTAATATGTAAGACTA ACCCTACACCCACTCTTTGTTAAAGCTCATCATAAAATCACTTACATTGG TTTTTATACATAATTTCAGTATTTGACGCGCTGAGCCTACATATGCTTCT TGATAACCTGATCTAAAGTCTATTCATTATTTTTTTAATATGTACTCTGT TTTTTGGATATGACTAAGTCACACTCGCTCGTTGTTAAAAATGAAACCAG TTTTAAATATTTTGTAACAATTCACACATTTGTAAACTGGAGATGGCTGC TTGGAGCAGTGACACACATACAATATGCAGTCATTAGAGCAGGTTTGACA TGTAATGCTTACCTCCATTTACAAAAAAGGAACATTTATTTTCCATATTT ACAAAATGAGAATTTATATTTGCATTAATGCACTTTTTGTAAAATAAAAC TATCCTAATTATCCTAATGATAAGTTTTAAGTACTTTGATTACAGGTTTA AGTCTATTTTTGAAAGTAACAGAAATAAAGTTGGAGAAGAATATAAGCCA AATAATAAAACAATATAGCTCAATTAGCGTATGTGCAAAATTCATAAGTA ATTTTGCACATATTAAAGACTATTTTTCTTGGAAAAAATATTAAGTAATT ACACTTAATATAATAAATTTTGTTTGCATTTTTATGGTACAATATATAGG CATTGTTCATAAATATAAATTATACTTACCCAATAATTGTGTTTTGCAAA ATAAAATAAATTATACATTATTTTCCTAAAATCTAATAATTATATATTCA TAGTTGAATAGGCTCTACTCATAGATAACATATGAGTGCATTATAGATGT TGTGATGCAGATAATTTTCCTTACATTTGACTAATTTTGTCATGAGAACA AATTTTTTGTACTGCTCTGAGTATCTACCTATATTAGAAATTGTATGTTC ATACTTTCAGAACTAAATATACATGAAAAATGCTAATATATAATTTTGCA TACAGATTTTATTAATCTAGAGGATTCGAATTAAATTTGATTATGTTATT ATTGTAATTAAAATGTTTGTAACTTTAACTCAATCAATTCTCGTATATAT ATCTTAAATATGAGGAAATTAGCATTTTGAAAAATATTTGATTAGTGATA TATCGTAAATCAAAGTAATGGGAAGTTTAATACATCATCATATAGCTAAA TTTTTATAAATTTTTTATAAGAAAAAAAAGTAATTTTTCAAGGTTTATTG CCTTTGATTTTTTTTTTTTTTGTAAATTTTAATCATTTTTAGATAAAACG CACAAAAATCTTTGAAAAAGTATAATAAGGAAAAATTATTAAATTAGGGG ACATGGCGTGATTAATAGAAATCATACCTTCATTTATTGTGTAAAATACA AACATAACGTTTCATTAAATAAAAAACGTATAGAATATACTTTACAAATA AATTAATTATTTTCATAATTATAGTASCAGCCATAAAAAATGTGTTGTAT TATTAGCATTATAATTACTATAATGAATTCATAATCTAAATTAGTAATCG GCAAAAAGAATATTTCAATTTGTAGAATATAAAATTATAAATTAATATCA AACACGACATTTTCTGTGTGGAGTAGGACATTTTCCAGATTAATAGTGTT TATTGCTGTACTAGATAAATAACAATAATATTTCTAAAACTTTTTTATAA AACCTGCATCATTATTATCTGAATTAAATAATTATTCAGAAACTATTGAC ATATCACTAAAAAAATTGGATACNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATAA ATATTTAATATAATAATTTTTTATTGTATCTCTTGGACTTGCACTACTTT ATCTAGGTGTGTCTGAAGGAGGTAGTTTGTTCTACTTCTTACAAGAGTGT TCAGTCTTAAGATGCTTAAATCAAGAAAGAGTCGACCAAGCTCAAGTCTG ATAACATAGTCAATGTCTGCAAGGGATTAGGCCCTGTATTGAGGAATCAT TTTCTGAAGGGCGGCATATTGAATGAAAGACGCGTCAAACCCTATTTTCA GATGATTTTTTTAAAATTAATATCGTCACAAAAACTTTCGTTTAAATTTA CTCTTGAAAAATAGAAAAAAAAAATATATGTTACAATAGATACGATCACT TGCATAGGGAAAGTAATTAGGCGGAGAAAAAAATATAAGCCCAATTTCGT ACGTTTATTTAAAAAAAGTACATTAGGTATGTATTAACTTTGGGGTGTCA AAACTTATTTATTGCTGTCATTATAAAATAAACTATTACTAAGTATTTTC TTCATTTAAAAAATATTGTGACTCTTTCAATATAAAATATTTAAGGACCG ATGTACCTCCAAAAGAAAAATAAGTTACTTTCTTTTCAGAAGGGCCGCAT TTGTATTTCTTTTATGCCTAATTGGAGTCACAGGATATTTCAATTGATGG CAAAACTTACTCAAAATATAAAATATTAATAGCATATACGAGTTGATAAA TAGTCGAAAAAATAAGTATTTGATTCATTGCCTATTTTGTCAATTTGACA ACTGAAAAAGGTTTTCTTTATGATTTAGATCTGGAGACTAATTAGGCATT TTTTGATCTTAATGTAACAATTCTTTAGCGACTTCTATGTTTCTGTATCT TTTGGGGTGATTGACGTACAAAAAGGCCTATTTACGACTCATTTTCGGTA TTTTCAACAGAGGGAAGGAATTTTTTTATATTCTCAACATTAATTTTAAT CTACAAATAAAATTATAAGCCGTTTTTTTCTTTGTTAGTGAACAAACTTA CTATTTCGACTAAAATTCAAATTTCATAATTTAATTTTGCATTAATTATA TTTATCACTATTTATCTTATGTGATTAACTATAATAACTAAAGATAATGA AAAACACAGAAAAATATTTTTTTTTACTTAACACAAGTGCTTTAAGTATT AACAAATTTCAATAAGGATAAAAGAANNNNNNNNGAATGAATTATCCTCA TCAGCAAAAAATAAAAACGAGAGTAGGAATTATACTCATAACATCTAAAC AGTGACTCCTAGGGACACAACCAACATATACCTTAGCCCATTCGAAAAAC ATCTCTTTAATATTTTGCTTTTTCATTACTCCAAATATTAAACAAATCAC ATTGAAAATAATAAGTTTAATTTTTTTTTCAAGATATGAGGAGAATTGAG TATCCCTTGATTAAGACTGACTTGCAAACTTAGATAGGACTATTAACATT GGCAGGMGMCTATTGATTATGTGGTCCGGCTACTCCTAGTTTTTGGGACA CCGAAAGTAGTAGAACAATGTTTATAGCTACAATAACCTTTAAAGACTTC CAGACAATGATATTAATTTTGCATCTTCCTAAACGACTATAAAACAAGTT TTTTATGTACAAATATGTAAAAAATTAAATGTATAAAGCCAAAACTAAGA TTGTATGTAGTGTTCAACATTTGATAGTTTATTTATATATTTTCAAATCT TGAATTTAAAATAAATACGGTGTTTGTAAGTAAATATTTAAGAACGGCCC ATTATGAACCGTGAGACATATGTGTGACCACACATGGAGTAAATTAAGTT TCACTTTTTGTTTACTGCGTGTCTATTTTCTTTAAAAAATTGAGGCTTTT TTTGCTTCACATATTGAATATTATTTGAATAATATTTATATTTAAAAATA TTTACAGTTCTTTCAAATTCTTAAAGTTATGAATGTTTTTCTTCAAACAT TGATCAAACAAAAGAAAATTTATATTTCTATAATTGCATCGTTATTTGTT TTTAAGAATATATAGTATGATATAAAAACTATTTTTATAATGTAGATTTA TGCATTTGTTATACACCAAATACAATATTTTTGCAACTTTTTTTGAAGAA ATAACTTTGGGAATAAAGTTGTACCAAAATTTTGTGATACTGTTTGTATT CCTTTTATTCTAAGGTTACGAAAAAAAAAAAAAAAACTCAATGAAAGTAT TTTTATTTTTGTCACTATGATATATGCACAGATATGTAAATTATTTTTGT ATACTCTGGAGTGATTTTCCATCCCTCTAGATCATTTGGTGATCTTAATT GTTTGAAGAATGTTTAGGAGGAGAGGGGWTTASCTGCCACGACGTTTATT GGATCAGCAGCAAGCAGTCCTGAGAGGTAGGAAATAATTGCAAATCCTAC TTTTAATAAAGCAAGGAATATAGGCAACAATAGTTCAGTTGTCGATCGTC AAATCTACTCCAAGACTAACAAGGACTTGCACTCACTACTCCCAAGTCAT CCCCAATTTGTCATAATCAATCACACATTATTTTATACTTATATGTTATT ATTCAAGAATGGAATATGAATGATAACAAATTTGAAATATAAAATATCTT GTTCAGATTGCCAACTAAAAAAGGATGTTCCCCCTTTGAGTACATATTTC ATACACTTTTGTAAATATATGTGTAAATTTAATCTAATAAATTAATGTTA ATTATTTAATATCCCGTCAGGATATTTATAAACTTTTAACAACATACTGT ATTCGTATATATATTGCAAAACATTTTATTTCACTTCTAGATAAAAAAAA GTTGAACCTTTGGAAAAGCAAAATCGTATTGTCTTTATTATATATTTTGT ACACTTACTTCACATCTAATTATCTTCTTTTAAAGTTTTACTTCGTTTAT ATCATAATATTGAAGGCAATAGACGATGTTTATAACAGCTAGTTTAAATT TATTATTTGTATTGAATGTTTATGTTACTGGGGAACTTGATGGCGGTAAA GTTTTATCATAACCATCGTACCGCTTTTTTTAAATTGTGAAACTGATAGT TCTTCTTTATTGACTTTCTTTACATTAAAATGTACATTAGTTTAATTTTA AGTCATAATATTGTAATTTTATAAAATTATAATATTGAATCATTATTAAA AACCAAATTGTGGCTTCATTATTGTAAGAGCAGTATTTTTTGAACTTCCA TAAAATAAAGATTTTTTAAAATATATTGGAATAAATATAATTTTTTATTA AAAGTAACTTACAGATTGTTTACAGCTCATGTTAATACAAAATGGAATTA TTTTCTACATGAAACACCTCTAAAATTAGAGGTGTACCTTCTCGAAAAAA CACGTGTTTTAGTACTTTTTGATGTGACAAAATATTTGCAAGCTTGGTCA TACATTAGAAATTTGAATTTTTAAGTTTAGGTATCTGTTATTTATATATT TTCAATACTATCAATAATTATATATAGCATAAAAATAGTTAAGTTTCTCT TATTTAAGATTCTAAAACTCATGTAATAAATATGATAATTATGTATTTGT AGGATTTAAAGTAACTGATGCATTTGTTTGATCTCTGTCATTGAGACAAA CAAAAATTTACACTGAATTAATATGTTTTTGAATAATACCATATAGGGTA CAGAGTGGAGACCTAAACTTGTAATTTTAAATTAGCATCATTACCTAACC AAAGGTCCGATGAGACAAAAATAAACAAGTTATTACTTTTGGTCTACCTC TTTGTGTCTTTCTTCCATCCCTGATCTCAAATTCCTGTAATTTGTAGTTT TGGGCGTTCTGGAGAAAAATATCCGCCTTTCTCTCCTCCAAATTTGTATT CACACCATACCCCCATTACGGGCATAGCCCTCATCGTCAAAAGCTGCCAA TCAGTTCGCCGGCCAGTCAAGATTGCTATTAATTGTGAAGAAGGGAATAT AGCTAAGCAAAGTATTGAAACATATCAAAAATTGATTTTGAGTCGTCTTT TCTTGATTCTAAAAAAATTATGTTCTTGTAATTTATTCAAGCAACTGTGA CACTTTGTAAATTACAAATCAGTCTTATTAATATTCCTATGATATTAGAG TGGTAACTTTCTACAAGGATCCATAGCAGTGATAATACCGATTTATGTTC GTTAGGAAGTACCCATTCCACCCAAGATAATATGATTTAGTCATGCCTGA TATTTCAATTTATTAGATGCCTTTAATAAAAAAAATAATTTAAAGTATTA TTAAGCAAAATGGTTTTCTTTATGGGCGCTCCAAAAGGCTACCATCACTC ATTTTTTTGCAAAATAGAAAATACACTTGAACGTTGACCTCATAACAGTT AATGAGTTTTAATGATTTAATTTTTTAGGAAAGCATATATTTTAAGAATA ATACATATATATATACAAGTACACATATATAAAAAAATACATTTACCATC TTTCATTATATCTATTAAATAATTTTTTTTAAATGAGTATCATGAAAAAA AGTCTTATGGGCAAGCACTAGATTGTTCCTTTAAATATATTTTGTTTTTT TATGGATAAGAGGAAATTTGCAGTTTGAATTATGTTTATCAATGTTTAAA AATTGCGCATTAATGTAGAAGTTTCTCCTTTTTACTTTGACCTTTTAGAA AAAAGTAATATATTAACTTTTAAAAATTCAATATATAGCAATAATTTAAA AAAATAATAATTTATAAAAATCTTTATTAGGTTTTACTTAATTACCTCCA AAGTTTTTTGTCAAGGCAATATCAGTGTGGACATTGATGTGTATCAGCTA TATTTCTCAAATAAAGTAATTATTGTCGGTGTATGATACAACATGACAAC ACACAATACTGGTTTTATATTTTATAAATCGTTTTGAAATGCCAATATGT TTTAATACTATACTTATTCTTATAAAATCTAATTATGAATTTTTATTTTC GTTTTAGGTAAGAAATTTTATATGGACTATTTCATTGAAAGCTTAATTAA TTTTAAAATACTCATATGGTATTTGAAAAAACTACTGAATATTTGAATAT ATATGAGTTGAATATATATTAAGTTCGAATCTTTATTTAAGGTAACCATA TTTGATTTTCAAAGGACACTCGGCCTAACAAGAGTCGTTTTTATTGGGGG GGGGGGGGGGRGTACTTTTATAAATTTATAAAAAAGACTTTGACAGAATG TAGTAAAAATACACGTTTCTGCAAAATCTAACTTTATGAATATGTACCTT TGAGGAGAAGAGTTGAAGTCAAGAGGTCAAATAATGTAACGACTTAACTC CATGGACAATGCGATAAGAAGAAATTATTATTCTCTTGAACTCAATGTGG ATAGATTATTGGTTCAGTCGTTCCTAGATAGGAAATATACTAGATTTATT TGGACTTCAAAATAGATTTCTTATACAGATTGAGTAAATATAACACTATA ATGTTTATTTATACTTTATCAATGTAACTCCATCTGACCAATTAAAGAAA CATTAAAAAAAGTTGTCACGTAACGAGGAAATACTATAATAAAATTTTAT TATCTTTCTGTTTGTTTGTTTTTAGGACTGACGGGTAAATAGTATCTACA AAATGCTAGTATTCTAGCTTTTATTTTTAATAAAAAAATATTTCTTTGAT TATCATAAAAAAGAAACAAATGGTTTTACTATACGAATACCAAATGTTAT CTTGTTGAGACTCCAAAGTCGTGTTGTTAAGATTTTTTTAAAATATGGTT TTGTTTTTTATCGATACTATATATTTATAAAAATATTGCTTATAAGGGGA TAACAAAATTCCAGAGAATGGTGGCGAAGAATTCGTATATGTAATATAAG GGGGACTTAATGCAATACCAGAGTTCAATATCAGGGAAGTTCTTCTCTGG CAAAAAGGTTAAGCAATGATGATGTTTTATCTGTTTTATGATGGTAAGAA TATCTAACACCCACTATCAAAAAATTATTTTCATGCAAAGTTAGTCATGT AGATGTCAGTCATGTTGGGAGTTGACAAGAATCAAATTGTATAAGAAGAA AAACTCTTTTTTCATTAAGTTAAAATAAAATTGTCAACTATTGCCGTGTA GTTGAATGCTAAAGGGGAGTGGAAAAATATCAGGACATAAAAAAAATTAC CGTCAAAATAAAAGTATATTTATCTAACGTCACGTTTTATTATACCTATA AATTATACCCTAATTTGTATTAAAATATGTTATTACTGCATTATAAATTC TTTTGTATACATAATACTTTAAGCATAACATTCGCAAGGATCAGATATTT TTTCTTCATCTATCGTACATATATCGTCCTTATACATTTAGTAAGGATAT TCAGACTATATTAATGTTATTTGATTCAAATATTATACTATACAAATCAA ATTTTGGGACGCCTGCTGGCGTAAACTTACCTTTAGTTATCAATAATTAA GCCATATACCGAGTGGTCCTTAAAAAATCTTAACATTTTCAATTTAAATT TCAACAAGATATAATTTTTGAATTAACAATAGAATTTCAACAGCAATAAT ATTATAAATATATGTGTGTATGAGCTCTATTAATCATAAATGTAGCAGCC CTTCACAAAAATGAAGGCTTCCAGGTGGTGGAAGGCCTGGCACCTGCTAC AGATATAGTCCTCTGTCCTGGCGTACTAATACTTGCTGATAGTGGCTTTT AGGGCCTTGATATTGGCATGGCGGSCACTTCTGGCCTTCCCCRCGACATT TATCCAAATTGTAAAGTCTTGGGGTTTGGCATCAGTGCTATTAGGGGGGC AAAAGGGATCAATAAGATTTCAACAGAAAACAGAGACTCATTCAAAATAG TTTTGTAACGGAGAAGATGAGTTTATATCACTGCTGGTGCCAAAAGGGGC CTCTACACCCTCAAAAGTATATTTCCACCCACTTTTTGTAAATATCTCTG GACAATTTGAAGTGCAACCCCGGACTTGGAAGGATTGGCTTGGCCTATTT TCAATAACTCATGCGTGTTTAGTTTGGTCTTTTTAATGGATCCCTTCTTT CTCACCAACGTTTTGGACTTGTTTACGTTATAAACGGTAGTTCTAGAGAC TCCCATCCGATTAAAGGGCTCAAATGGAAATTCGTTGCCTACGTGCAAGT GTTATTTTCTCAACATGTTCATAGGCTACTTCTTTTTTTGTGTTTTGTAT CTAATTGTATATGATTTTCTATATCGAAATATGAACTAATTTAAATACTC AACCTTCATTTACTATTGGTATGTGTTGCAATTTCAATTAACCACCAGAT CACACAAAAATGAGATTTAAAATTTTTAATTTCATAAAGTTTGCAAGTTT TTAGGGTTTAATTTCGATTCAATGCCACATTTCATAATGAAATAACTAAA AAGATGGAAATTAAGGTAATTATAATGATGAAAAACATTTTACGATGTTA AATATAAATATTTTGAAGTTATATCATATGCATTCCCAATCAAAAAGTGT CTCATCACATAAAAATCAAATCTTTGTTGCTCTTATTTTGAAGGTGATAT TTTGTTAAATTGTAAAAAAAGGTGTCTGTGGAAAAAAGTTTGATTATTTT AAGTTTAACTTTTTGTTTTCTTACAGAATATGTTATGAAAATGCAATGCG AGGTAGTGTAAACATGTTTCGAAGTTAAATATAATTAAGAAGTAATAAAT ATTTTAGAGGCAGCAAAAGTTAATATGAATAAGTTTATTTTGATTATTTA CATCTAATCGTTAAATACTATTTATATACATGAGATATGAAACAAATATA AATTTAAAATTATCCTCACTCTAAANTTACAATTATTCAAAAATAACGAT TTAATCATATATAATTTCGAAACATTTTCTTAAATGTAGCTTTTTATAAC AATGCCTTGAGATACAAGTTATTCAACTTACCAATTTTTTTAGCATTGAA AAATTTAAGAATAGTTATGGAACGTTTAACACATATAAATAACCTTGTAT AAATCACTATGGTTCGATGAGCCGGTACTACATTACTCCTTCTCTTAAAT TTTTTTTGGGGGGGAAGGGCGGCCGGGGGAAGGATAAATTTGTCCTGTAT CAAATATAGCAAGAATATAAACTTCTTACTATGTAATTAAGTAGTTCCTA TGTACAGGGGGGGGGGGGCAAAAATGTGTATATTAATATAATGAAGTTAA GCAAGTTTTCAAAAAGAAAAATTTATTTTCCAATCTTAAAGAAAAACAAT GTAACTTGCAAATAAATAAACAGGTAAAGTTAATAGCTGAAAATTTTCCA TTCTCTAAGAGAAAATAGCAGCCCAAAGTTATACTGGAGTTAAGGAGTGC CCTCTTTTAAATGTATGAAAAACATCAACAGAGATCTTTATGTTCTTGAG TGTCTTGGTGTTGTTTCTAAAGAGGTGTGTAGACGCTAACTAACAAAAGA GAATCTAGAATGACATAGGGTATGAGAAAGAAGTTGTGAATGAATAAGAT ATTTAATATAATATATACACAAACGATTATTTGACTACTCTGACATTCAC AATCATGTCAGGATATTTATAGTAAGGAAAATATAAGTATTAAATGTCAT AAATAAAAAATACATATAAATAATAATAATATTTAAAAGAAGAAGGAGGA AGGAGATCCATATCATCAAGAAGAGTAAGTACATTAAACCATATCCGTGC AGTTGATTCACAAGGTACTGCCTAAGGAAAAGTTTGTAGATAAGCTCCAA CCACATGCAAGTGTGGACAAACCATCTAAAACCATTTATGTTCAAAAGCA CGCCCAGAGAATACCTTCGGCCATTTACACTATCTCTACACACATACCAT TCTCCCAATATGTACACTTGAGAAAGGAGAAATATAGTTGTAAACCACAT TTACCCTTAAATAAAAAGATGAACGGGAGAGTAGGTCATGAGAGAATGAA AAAAATCCAGTGTATTCAAGCATTCTGTGATCTCTCAATCGGATACGCAA CTAATCTCTTTCAAGGGCAAGAGTTTAATATCATCCTCAACATGTAACAA ACAGTTCTGCTCTACATTTTTGCGAAGTTTATGATTCTTCCTTTAAAAAA AAGGATACTTCAATATCGTGTCTGACGATTTTACTAGATACAAACTACCT AAAGAGGATACAGAATTACCTAAACAATAGTAGAGAAGTCATGGAGGGAT AGGATATATTAATAAATTCTATATATGTCAAACAGTTTTCATATTAGTTT GGCATTAACAATCATAACATATATATAGTAATAAATTTAGAAGCATTCAA TGTCATAAATGTTACTCGCGTATTAAGTAATGATAACAACAATTATTTAG AAGAAGGAGAAAGAGATCCATAGGAACAAGAAGCGTAAATATATGAAAAC CACACTTTCTTACATTTGTAAGACAGATATGGAGTTAAAAAGAAGCCTGG AAGTCACAAGTCAAGATAATTGATGTTGAGACAGCAAAAGAGATTGTAAA GGCCAATGATTTTAAGTCTTTGCACTTTTATCCAAAAAGATATGTTCTTT GCCAATTCCACCTTATAGGATACAGGAGAAGCCTTTGCTGACTGACAAAA TTAATCAATACCATGTTAACTGTTGCAACTATTTAAGGCAAAAAAGAAAA TATCTGGCCTTCAATTGTGSCTGSCATACTCCCMGGACCAAAWATTTTCK ATTATGCCATTTTGGAGCATTTTCGATTATGCCATTTTGGAGCATTTTCC AAACAATAGGGAGGCCCAAACGCTTACTATGCAGCTCCCAGAGTCCACAA ACAGATGCATCAAAGCTTAGGGAGACGATTTTAAAGTCCCATGTCAAGGC ATTAAAAAATTTATTGAATATTAACCAGTAGAAATGTTATTATACCATTG TGTAGCTGAGTTGAAATCATGAACTGTGAAAATATTTAGTCTAATTTTAT GTTCTTCGAAGTCAAAGAGTTCTTTAAATTTATAAAAAAAATTATTTATA GTTTGTCGAATTAAATCAATTGTTGAGTCATTTTTAAATGACGGGGTAAG CATCCAAATTATTCTTTGATCTGAGGCTTAAATTTGTGAAGTTAAATATG TAATTTTGTTGGGTAGATTGGTTCTCATTATAAGCCAAATTTACAGTCTT GGTTCATAATAGTGTTTATCAATTCTACAAATGGATTTTATGAAATATCC ACAAAATTTTTGGAGCAAACAATATGAGATAGTTGTGCTAGTCCAATATC TTTATGGGNATTTAGGTCTTATCATGGCCTCACTATAATAATTATAAAAT AAAACATTATTTCATTTATCCTCTTCTAAAGTAGCATGGACTTGTTGGAG CTTTATATGATATTCCAAAATCTTTTCCAAAAATAAATATTTTTGTTGAG AAAGACCCGAATTGTATTTATACCCATGATTTCCTCCATTTTTCTAAATG TACAGCTTCCATCTTTAAAATCATCTTCAGGCTTCTAGAACCCTAAAGAT AAAATACAAGTCTTATTTCTATTCACAGCTTATCCTTTTTCTTGAAATCT TCCGAAAATTATTCAGTAGGGCTTGTATTCTTTTAATTATCCAAGACTCA GAATTTGATTCTACAGTTAAAGATACATCATCGGCATCAAAATCAATAAC ATGTTGAGATCCCTCAAAGGTAGCAAACAAGCTTATTTACATCTTTTTAA CCCTTCAAAAAAGTTCTCGGATTGTATCAATGAAAATTAGTGGAGCTGAG GGGTATCCTTGATAAAAACTCTTTTGTAAATTGATTGGCTTCCTCTCTTG TTCATCTAATGAAATTGTTGAAGTGCTGTTACAAAAAAAACCTATTTACA ACGAAAAAAACCAGTAAAAATATATTTTTTGAAAAATATAAGAATTTGCT TATGTGTAATAGAATCAAAAACTTTACAAAAAATGTATCGCTATAATCAC TCTAAACTTTTTCCTCCTTTCCTCTCTATCAATTGTAATTTGAATATTTT GAAAGACATTGCAAATCTCCCTATACTTCAAAAATCAGGTTTGTTCAATC CATTTTTTTATGGAGAATTGGTTCTATTGGTTCGGCCAATACTCCAGAGA GAATATTATAAGATAAATAATTGGTCTCTAATGAGTATAATATGTTCCAT CTCCCTTCTTCTAAATAAATTCAATTCTTCCTTTGTCTTTGATTTGCGTA ATCGTCCAATTTTTCCATAGAACCTCAACTTTTTAAAAGATACAGAATGA CTTCATCGCTAAAATTTGAAAATACTTTTCCCAAGACTTCATCTGTACCA AAGGCATTATCATCTTTATACTACTTTTCTATAAAGTTAGAAATAATATA TTTAGAGAAGATATAATACCCTCCAACAGTAGAAATTACCTCTATTTATG AGACCTTTTTTTGTACCTAACCTTGCAGATTAGGGAAAAATAAAAATCCA ACAGCCTGTCAATTTTTGAGGCTTATAAAAATTATTAAATTTTAAACAAT TAGTTTATAAACCAAATGTATTCATCACTTTAGACAAGTTATCAAATGCT TCTCCTGCATCAAAAAGTCAAAAAAAGGTAGGTACACTCCTTGATTTGGG CTGCCACTATAATGCTTACTCATGGAAACTGTAAACAGATAGACTCTGGC GCTATTTCTTTAAAAATACAGTTTAATATTTCTCTAATTATAGAAGAACA TAATTATTCTGAGATTCCACCTCTTACAGTTTTTTCATTGTTATGGAAGC TGTAATCAGCTATTAAACTGGATTTGTTATCTTCAAATTGCAAAGACAAC TATGCTGCATCTCTTGCAAATAAGTATTTACAGATTTATCCAAATTTTAT TGCAAAAATTTATCATTGATGGTAAGAAAAGATTTAGGATGCCTCATATA ACCTTCAAAAGTTGCAATTTGTGTGGTTCAAGAAACTGAAAGAGTTATTG TTCAAACTATTTTAACAGATAAAGCCTCTAATTTTTATTTCAATTTAATT CATCTTTCAATTGCAAGCAAAGAATTAAAAAAGATTAGTAAAAACCATAA TTAGATTGGTAATACTCTTGATGAATACATGTTTAATGGAAATCAAAACG GATAATCACATGTTTATATAGATCTACAGTTGGCATCAACGTATTCCAGG ATCAATCTTTTTCATCAATGGATAGTCAATGAGCTAAAATTACAATCGGA ATCAGTGAGGAAGACAAATGAAAAGGCAGTTTTATTCAGAGGACAATACA CATAATAATTTTATTAAGTACATTAAAACTAAACTTTCATTTGCGTTAAA TATAGTTTATAAATTATAAGCAGTACTTATTATATAATCGTTAATCATAA TATTTTAAAGATTAATTTCTTTATGGAGGAACCATTTAGAAAAATATTAT GTTATGTATAAAAAGTTTAATACCTTAATTTCAACATATTACTTTTCCAG TACAGTTTACATTTACTTCTTCTTTTTTATAAATCATTTAATTCTTTTGG CAGACTTTTTTCCCTTCTTGTTCTTTATAAATAGTTATGTAAATTGTGTT TATTTTTTAGCTGGACCGCTTGTTTGAAATTGATCATCTGAAAAATGAAT TTTCTTTTCTAACACTTGCCATTATTATTAATTCCTGAGTAGTATCTTTC CTAAATAGATTCAATTATATTCAAAATCTGATGGAACATTCGTGCGTGCT CATAAAAGACGGAGTGTAACCCTTAAGATTTGTAGTGGAGTTATAATTGT AAGTCTTTGTTAGACTCACACTAGAATTGGGGATCGACATCGATGTAATT CTTGTTAATTTCCCTGTTGATTTCCTTCTGATATTCCTTATTTTATTGTA CAACCTTTTCTTCAAAATCAGTGGNTTAGTCCTCAAATTCTTTCAAATAT GATATCAATATTCAACTGTTGTTGGGAATTGGGAATTGGTTAAAGCTTAT AAAGACATAGTTTGAATTTAATTGATCAAAATTCATTAGATTAATTATGA GACTCTTACGATCTCTAGAAGACAAAAAAGTAACATCGTGGACAACATAA TTTAGAGGGGGGGGGGGGTAACTTGTTATTTCTATTTCATATGCTCAAGC CTCTTTCATTTATTATTTTGAATAAATTATGAAGCAATAAAAAATAGTTT TGCCCCTTCAAATGTTTTGCAATTCAAGTTCTCTGCACGACTTTACACAT TAATTATATTACATCAATTTTTAAATGCATTTCTAAAACGTGAAATAATT TGGTTATAAATAAAACTAAATTGGGGTTTTCATTCTACTAGTTTATAAAG TTTATTTTATGCATTAATAAAAGTTATATATATTTTTTGTAACTAACAAC ATAAAAACATTATTTTGTTGGATTATTCTAGGAATTAACTCTTTTTGCCT CTATTAATTTTTTTGACCAACTTAGGGTTAATTTATTTAGAGCAGAATAG TAATTAAATGAAAAAAGGAAGTTTAATTAAAATAATCGTATAATGAATGA CTGTAAGCTTTAAAATATTTATATTCTTTATCTGTTTTTATTTTTTTAAT TAATGAGAAAAATACAATTATTAAAAAGTTAATACAATACCTTAAGACAT TCAATCAATGATTGGTTAAATTCAATTACTTTATTCATTCAATAACGATA ATAATAAGTRTGTWTTTGTAAACMGGGATATTTTKCAGCCGATATTGATA AAAATGATTTTTCTTCTATTAGTTTATATTTTTAGGTATAATACTTTTCA GTATGCACTTAAAAATAAAGTTATATATTATATTCAATTCTTTTTTTAAT CAAAGATTTTTATTCAAAATTTGTTCTTCCTTTTGATTCTTCGGATTATT AGATAAACATAATCTTGCAAATAATTATTATATATAACATACAAGTTACC TTATACTTACACCTTATATTACTATATGACTAACAAATTACATTTCTTTT AAATAAGGATTTTTTTGGATGTCTTATATTCATACAGATTTTTTTTACCA TATTGTTTGAGATTCACTAGTAAAAAAATAATGATGTAGTTTAAAAAATC TTATTAAATTTAAATAGCTCAATTTTTTTAAATGTTTAACATGCATATGA TGACGTTTTATTTTTGGGGCTTTCTTTTTTCCAAAGTTAACTAACTGTTT TATAAAAAGGATCCTCAATGACAATGGGGTAATATAAATATTGAAAAGAT AGCCTTTAGTTAAACAAAAATAGAAAATGGAAATATAAAATAAATCATAT TCAATCAAAACTAGCTGTCACCTTGCGTAAAAAGTACCAAAGCTTACTGC AGTCATACAATGACTGAATATCTCTGTTTTAAAATCTTTTTCGGATTATC AAACAAATTAGTTTTTTTTTGTAACAAAAAAGTAACATATATAGAATGGA ATAAGAACAGCTTTTTGAATAGCATTATACACATTTTTTTTTAAAATTAT ATGAAGAAATAAAAAGATGAGGGAATTGAACATTGTGTATAAGATTATAT GTTTTACTATACAAATATGTTTTATTCAAACAAAATAAGATTCCATATAG TATCACAAATAAACTACTTATCAAAAACTATACAAATGTTTTTTTTTTTA CTCTATTGACGCATTACATACTTGAATTTTATTTATGTATGTATAGAACA AAACGATATTCCTCATAAGAATGTTTCAATGTAAATTGTTCAAAAGAAGA TATTTATTATTTTTACTTAATCAAATACGAAACCATTTCTCGTGGATTAA TATTTATTCGAATATTTTTGATAAGCGATAGGTTTTTTTTGTTCGCCCAT GTTCGAATCGAATATACTTTAATATTACTATATTATTAACCATACAACCT CCATAAATTCACCTTTGAGTTCCGTAAATGTAAAAAAAAAGCTGTATGCA TCATAAGAAATAAGTGAAAATGAGCGCATTGGGTTTGAAATGTAACTCTT TCTCATGACTTGTACATGTACACTCTTTGTACATGTTGTAACTTAACGAT ACGGGATCGGTCATTTTTTATTCCGAGATTTAGGAATGTTGTCTGGTCTT TCTGTCTCTTCTATCTCTTCTGTTTAGTGAAAGTATTTTGAATGTTTCAA TGGATGCACATATTAATTCCTCTGTACTTTCTGAGATTTACTGTTTCTTT GGAGAACAATCAGTATCTCAAGATGATCTTTTTGTAACTGATCTTGACCT TGTACATAAGGTCATAGTTTCTACTATACTACGAAGGGGTTTCTTTTTCT TATTCTTATTCATTCGACTCTAATGAGATATCTTCCAATGATTATGTCGA ATGATAGTGAAAACAATTTTCCTGGACTTATTTTTGCAATAGATATCTTG TTCAACGAATGAAATTAGTCCAAATTCACTATTTACCTCCTGTTTTCCGG ATATCCAACATAACTTGTTGTTATTCTGTTGCAAACACTACCTATTCTGT TTCAATTAGTTCCAATAAGTGATAGTCGATCATTCCTTCATTAACGAAAA ATACAAAAACAAACAAAAAAACATTATTATTTTATGAGCTACGAGACGTA TAATATGCAAAAATAGTTAATATTTTGTTATTTTTGAAGTCTTTCCATAG TTGTTAATTTTGAAGTCTTTCCATTGTTGTTTATCCTTGATGTAGAATGC ACAATATCGAACTTATGCTGCATTATCATTTGTAAAACTGTATGAGTGCA CTTTTTCTGAAATCATAATACAATATCTTATAAAAAACTTATTTTCTAGC CAAAAATATATCTACAAGCCAACAAATGTGTTTTCTCACATACTTAACTG ACAGTGAAGAAGTGTAATTTTAGTTTTGTACGCTTAATTTGTAAGCACTC AAGAAATTGGAAATGCAAAGATTCACAGCTAGTAGGGATCATTTTTTGAA ACATTTGTCAGGTCTTTATAAGTATTTATGAAGATTCAACAATACGCTGT TGTTTTAAATATAAATACATATGTTTTAAATTAATTAAACCTTTGTACAC AATAGGTTTTTAATAAAATTTAGTTTACACTCCTATCCCCCCCCCCCCCC CAATTCAATTTAAGTCATACTTAAAATAATTACCGTTAGTGTTTTGATAC ACCAAGATCCAAATGGATATTTTAGCAATATATAACTGTATGTATTTGCT CTTAGTGGTCGTTACATATGATACAAACTATAATCATTAGTTAACAAATT AAAGCCTGTTTTTTCTAATGGGACGATTAAAATCGAACGCTTTTTCTGGA ATCAAAATCAATATAAGAAAGACAAGAAACACTTTGGATTCTTGTGTATT ACTAGCTTTAGAATGTGTATTACTTTTATAAGTAAAAAAATATATATATA TCTATCTCAAGATACAGAAAACAAATATTTGAAAATATGACTTAAGCCTT AAAGATTTTTTTACACATCGTAGTAAAATAATTTATGATCAAATATAATC AAAAAATGAGAAGAAACAAATTGAACATAAAGAAACATGTTTCAAACTCA TGCATTTGGAGAATCAATTGTTATTTTAATGAACTATTGCACTAATGCTT TTTTAAATATAAAGGATTCTCCTCATTTTCTCCCTCCAAAATCACATACA AAGCTACCAATATTAAAATGTGTCTTAATTTAATAATACGATATGTCTAG CCCCTGCCTTCTTTTTGCCCTCTTACAAAAATCCCATGTATATTTAGTAT GCTCCAACACGCGTTAATTTAATTTAAAAAATGTGATCTGATGTTAGTAA GATGTGGGAATCAGATATATAAGTGAAATATTCTGATCACTACCTTTTAC ATTATATAAGTTGTAGATCACTTCTAAATTATTATCAAGCCCAGCCTAAC TTATACTAAATAAGACATCTCCTAATCCCATTTTACCAATTTCCTGTTAT CATATTTATCATTGATGTAAATAAATTATAAAAATGTTTGAAGGGCAGGC CTTCATAGTGAAAGTATATAATAAATAAATAATTTACATAGAAGGTGAAG CAAAAACACATTTTATATAAAAGATATTAGAAGGATATTTCAGTCTCTAG TGTGGATTAACGCCTGAAGGAAGTAAAATATATGTTGCAGATAAATTTAA CAGTACAAAGACTATACGTGTTTTAATATATGATGTATTTGGTTTTATGA AGCCAATGTATTGAATATGAAAATAGTTCACTGTACTTTAATCCTATCAG AAATGATTTATTGTAAGAAAAAAAAAAGTTATGTGTTTTTTTAAGTATTC TACGTCACTCTTCCTAAATTAAATTTGTTTTTAATTTTGAACATGCGACG TTAAATTCTCATCAAATAAATGATGGGTTTGCTATTAACATCAATTATAT TGTATGATAATTAAATTTACTATCGTAAAACTAAAGGCCATATTTATCAT CTTAAGTATATATGTGCAATATAAATTGTTACTTCACTTTAAGATGGTTG AAAAAAAAAAGCCTCATTCTATCTTTTAAATGTGAAATACAAAATTGTAC GCAATAAAATTAACACAGGGTGAGGATTAAACCTCTATATGTTAGCGACC CTGACTCTATGTTTAGAAAAGCGCGCTCATCAGATTCAGCTGACAAACTG TATAAGAAGAAATACAGACCTACTCTGACCAAGAAAATTATTGAGTTTTC AAAGATTCCCACTATCTACGATTTTTCCAAGCCTTTCAAGGAGTCTGATG GGTCGAAATCACATACGAGGCAGACTCATGATCATTCAGAGAACAAAAAA CAGCACTTTATACTTCCTGGAGCCAAAGGGGTTAAGGAAATTAGACATCC TAGCTCCTCATATCGGGATCCCTTAGTTTACTATGTGCGGAGAGTTTTGA AAAGAGAGTATAATAAATATGCACATAGCAGTTTGGTATCCTTACGGGCT TTCATTTTCGAGGCAGTGACTAAAATGGACAACGACTTCAACACCAAGGC CATTGGGAGTGTGGGTAAATTTCTTTGAAGCCGTAGCTTAATGGATTGAG TGATTTACTTCCGTATGGTCCTCTATAAATAAGAGATAAATATATATGCC TCCTTAATTAACTTTGTGATAAACATTCTCCTAAAATTTTACAGATATTA AATCCTTACCCTGTAAATATAAAAATATTTGTTTGACACATGTCTTTTTT ATAAATTTTAATAAGTTCTGCATTTGAAACAGTGCAAAAAATGTCTTATA GATTGTTTTTATGAAAATATCAGTATACCGGGTGGGCAATTGAAATCGGA AAACTTATTAATTCAATTATTACGGAAAGTTGAGTGATTGAAACTAATTC ATTTTTTATATATGAAAGCATAAATAATTAGTTATAAAACATACAAAATC AAGCTCTCCAGTGAATGTCCAAATGACAATTCAACGTGATATTCCATTCG CACACTCCAAGCAGTTGGGCGTCTCCAACACCTCCGTCTTGGCTGTCCAA AAAACCGAAACGATGGATAAGAAGAAGGGCTTTGTCAAAAAAGACTATAC TGGACGTGGACGAGTAAAAAAAAACAGTTCATACTAATCCCCTCATTTTT CATGAGGACTGATGCAAGCGATCCCGGTGTTTCTCACCAGACTTTCCCGA TAGCTTACAAAATAGCCTTGATTAACTCTTTTTTACACTTTTGGTCACCC CTTTAGCCCTGAAGTAAATATCCTCAACTACAATTTTTATGTATATGTCG AGAAAAAGGCTTGCAGTGTCAGTAATCCAAACATCGAGTACCTCAAAGAC ATTGACGGTCAACACAGGGACGCCATGAAAGAGGACTAAATCTGCATCGG GTACCAGTCTTCCTACCATCCTCTGGAAACTATTGTTGCTGCTAAGAGGG GCTACATAATGGGTTAAGTGAGTTCAGTCACAAAGCTTTTTATGGTTTTG AAATCATATTATTAATTAATAAATTATATCTTGTTAAAACTTAAAATTCA AAGTGTTCAGATATTAATAGAACACTCGGTATGAGTATATCCATGGATAT TTATTTTTTTGCATGCATATGTTTTGCATGCAATTTGAATAAAATATAAA CGGGCAAATAACTTATAATTGGAAACTTAAAATAGAGGCATAATATATTA ATGCTTAACTTCCTTATAGAACCTCATAGAACTTAATCCTGTTTGATATC ATACAAAAGTTCTTGCTATTTTTCGGTTTATTTGAATACTCCTTTAGTTG GTCGGATATTTTTGTTTCATATTTGTTTATATGGCCTAGTGTCACATTTG AGGGGATGAGTAAGAAATCCAAGAACGTCAAATGCATAATTATGCACTGT TATATGATATTTATATGATATTAAATAAATGAATATTAAAAAAAAATCAT ACTTTTTTCCAATTAATATGATAACTCCATGGCAATGAAAACAGTGCTTA TATAACGGTCGAACTCGAGGATCTACATTATTCTATCTATAGGTCATTCA GAGCGTGTTAAAGACATAAAAATTACTTGAACAAAATGAGCCAATACCAA AATTGTGCCTAATTGGATGTTACAGCATTAGGACCATATACAGCTACCTT GCAAGCGTTTTCCCCTTGTTTGAAGAGAAGCTGTAAAATATAGCGTATTT TCTTTTTGCTGATGTACATCTTGTTTGTGCACTCTAAAAACACGGATTAA AATAATTACAAAACTGTCTGTGAAGATTTTTATAGTACAAAATTTTATCT TTTTTTACGTCATTCATAGAAAAAAAGATCGCCTTGACACCACGCGATAT ACAAATTACAAAAGTCATCTATTGGAAAAATAATTGATTTCATTTTACAA CTCCTATTATTAAAAAAAATTAAATTAAAGTGTTATTTTTTTTATTGAAT ACTTTTATTCGTTCTTCAAATGACTTTTTTTTTCTATTAAAAAAGTTTTA TTGAAAAAGTTTTGGGAAATTCAGTGACGATAGTTAATTTCAAACAGATT TATCGATCTTTCCCTTTTGTTATATATATATATATATTGTGGGTTAGGTA TATGTATATACCGACTTTCTTGCAGGTGTATGGATATAATATGTATATAG TAGTTATATACTAACCCTATTTGGCTGTGTATATTATTTCCCTTTTTTAT AAATCACTTTATATATAATAAATATACATACAAGGGGGTCCAGATACATT GGGCCACTTATTTTAAGGCATATAAAGAACAAACTACATGGGGCAGGACC ACCTTGTATATATGGGAATGCCCCTTTATAAATTGATATTACCCCCCCCC CCCTCTGCGCTAAAAAGCCTTTGCTGCCAGAGGCAATCTTGAGACCAACT TCGACAAAGTTTTATGTTCTCATCCATTGATGGCGTGGTAAATGACATTT ATGTATGAAATTTTTAAAATAGACAAAGAAATTTTTTAATCAAGGTTTAG TTAATTAATTAATTATTCGCTTCAAAGTTGTTCTTTTGTTTGTATCGAAG ATTCTACTATTTTTTCATTGTCAATACTGATACATTATATCAGTATTTAA AAATGGTCATATTGTATTAATTATTTTAAATTAAGGGATATCTGAAGGGG TGTTGTCTGTAGGGAGTGTGTGAGAATGAAAAAAAATTGACTGGACAAAA GAAATGAATAAAGTAGAAGAAATTTTTTGAAAAAACAATTTTTTTATACA GAAAATTTATTTTTAAAGGATCTCAATTCGAAACAAAAAAACATTTTATA CCTATGTGTAATATGTCCATTATTTTAATCCTTTATGATCGTATATGACT AATTCGGCATACTATAAAAAAAAATATAAATAAAGAACAAAACAAGAAAA ACTTCGACATAGAATGAGGCTGATAGAGAAAAGGTTTTGTTTACGTTTTA TGTTAGTGTTACATCAAAAAACGCAGGACTTTTCAGTCAAAACAAAAACT TTGGTGATACATTTACCTGCATTTTCAGTTCTCTTTGACATGCGTTTCAG TTTACTGAATAGACAAAATTCCTGGTAAGCTAAATATTTTAAAACAACAA GGTACGTTTATAAAAGTATTCGTTTATACCACTAAAACACAATATAAGTT GAGATTAAGACAAATGGAACAGTTTTTTGGTGGGACTTTTTGGTAAATCT GCAGTACCAACTACCAATTTTTACTTTTATCAATATACATTTTTCCAGAC ATAGGAAAAAAAATACAAATATTAACTATATATACCCTAATATTCAGATT TTAATAATTAAAAAAATATATTTTTTTTAAATTTAATTCAAGTGGTAAAG CGTTAATTGAGTCATTGATATAAATTTTATTTCTGTAGATTGCCATTACA GTTTAATAATGATATTTTGATCGAGGGTACGTGAGTGAATGAACATAATT AGGCAAACATTTCTTCTATAAATCGCGCGGAGTAAAAAAATTAAATTTTG AATTTTTTCCATAAAATTAGAGGAAAACATGCCCCTTCCCAAATATGATG TTACGGACCCCCCTGATATAAGACCTTCTTCCTCATCAAAATTATTGGGT ACTAATTTGATTCCCAAAATTAGTATAAGCTATAGAATAATTTTTTTTCT TTAAATAACAAAAATTTATTGTTCAAAAATGTTATGATTTATATAATCTC GATATCTTTTTTCATAGTAGTATATTTCGAATTTTAACTGATATTTCTAA TGTAAAATGGATTAATTAGTTAAAAAAATGATTCAAAATTAAAATGACGT AATTATTATATTCGTTCAACTGTTTATCATGAAACTTATTATGTTTTATT ATTTACCCAGTTTACTTAATGCATTATAAAAAGGATGTTCACTAGCTGAT TGAAAAAAAGAGTAAAAATGGCTTAAGAGGCGTTTGATTTTGTTTTTTGT TGTTCCCTGCAGGAAATATATTAGCTTATGGTTAACGCAAAAAAGGGACA TTCTAATAAATGTATAAAATTTCCTTAGGAGTATGTAGAACAATTTTTCC TTAAAGTTTATGAGAAATACGTTACCTGCTTTCTAATGTCCCGATCTTTC TTCTTCAATAGAAGAAGTATGTAAAATTATATACTTTGAGAGTAATTCAT ACCCACTACAACTTTTTACACATTATGTTCACATAAATAATGTAGATATA AGTTCCTATTCTTGAAAAACGAGAGAGAGAGAAACGGAACTGTAGGTATA TTTAGTAGTGTTTTATGTTACAACATAAAATAAAACTAACGCGCATTAAA GATTTTTTGGTTAATACATATATTAATGTAGTCATATGACGCACGTAAAT TTTTTTGTACATGAACTATTTCTCTTTTAAATATTTGATATATAAGCTTA GAAATCTGAAATGGCACAGACTGGTTTATTTCTTACTCGTATAATAAAAA ATATTTGGTCTTACATTAAATACTGTTCGTTAGTCCTGTGTTAGTCCTTA TTGAGAACCATGACTGCAGTCCAGTATAGTTTCGGTCTAATCCAGTTTAG TACTGCATATCAGTCCTAAAACATTCAGTCCATGATGATGTCACTCAACT TTATTTCTTCTTTTTTTAATAAGTTTTATTACTGACAAATCCAGTTTACT AGCGAACAAATTAACATAGAATATAACTCTCACAAACAGCTTAGTATTAC TATGTTCTCTTTAAAGCACATTCATGTTGAATTACTCATTTTTAAGATTA TATCTTCAAACAAAAAAAAATTATAGCAATTTGAAAAAAAAAGCTCTTCT GTTAAAATAATTACGTGTGTTGATTAAACATTTCTTTAAGAAAGGAGAAA TGGCTTATGAGACTACTGTATAAAGAAGTTTGATAAACATAATAAGGACT CTGTACCTTCAATTATAACAGTTTATAAGTGATTTCAAGATTTTCGGAGT GGCTATAGGGGCATAAGGGACGCTAAATATTATCTACGCCCTGTTCAGAT TACTACTCCAGAAACTGTTGATGAATTCCATGATATGGTGATGAATGGTA AAAGAGTGAAGGTGCGTGATATTACTAGTGGTGTGGGCATTTCAAGTTGA ATCCCTATTTCCATTAATTTTGTGGCCAAAATTGCTGAGGTGTGAGGTGG TGAACTGTATTAATGGAAATGAACTGTTTTGTGGGAAAATCGTTGGTGTT TTTATTACACCTCGATTTTCAAACGGTCCAATAACGATAAATAATATGCC CCCTATAAGTTTTACCCTTTTCAAGATCATCGATGAGGATTATTCCTTGT GAATTCAAAACACAGTTGCCATAATCCTACCGGACGATTCATCGATTCAA ACGAATGCCGATCAGAAAGAAATAGACAGATCTGGCTGAATGTTGGTGTG TGTTCTTCCAAGATATGCAACTAACTAAAAATAAACTCGATTCAAACCAA TAGTGCCATCTCACAGACTTTGCACTGAATTTTTTAAACTACCTACATAT ATACTCCCTTAGATTTTAAATTTTTAAATGACGCTCTGGCTCAATTGCGT AGTTTTGTCTGTGACCAAGTTTCCACGCTGTACAAGGGTACACTCAAAAC TAACTCAGTATCAAAACAAATAAGCTTTGCTTGATAAATATTGATTTGTG TAAAAAAAGTTGAATATATTCATTGATTCTGAAACGTTGATTTAATAATA TTGGAAAGGATATTTTTTGTTGTTTAGTATTATTTCGAGTGAAATCAATA GCATTATTTATTCATATTGTTATTGAAACAACAAGTACTTTTTTGTTCAC ACAGAATGTGAATAAGTACTAATTATATGGTCTCAGAGGAACTTTTATTA TTCAAAAAAACTATAATATAAAAACATGCAATATTCACTCATATTTGTTT TTTTTATATTTTCAAGGAGCCAACAAAAAAATTTGGTAAATATACAAAAA GATTTACTACTTTAATCATGAATATAACTAATCAGTTAGGGATCTATTCA TTCCTAAAACTAATATTCATCGGGAAAGCTCAACTGAATCTGTATGAAAA ATAAATTTAATGTACTTGCATAAACGATGGTTCATTTAAACATTTGCAAT CAGAGAAAACTAAAGTTAAAGGCTGATTGGACCACATGTTGATAGTGTCC CCAAAAACGTCCCACTTCCTATTTTACCGTCTCACTATGTAAAGCCCAGA ATGCCCTCGTTATCTTAGATTTCAGGGATCTTGTTGTGCTGTTGGGATCT TCATCAGAAACCCGTTTAAAATTGACCAAGGCAAAATAATATACAGGGTT TAATTCCGGTCAGTTAGYAAGCCAATAACTTCGTGGGACGTCCATTACAT TCTCATACTCAAGTAAATTAAGTAATTTTTTGCTTGTGTGATAGGGTGCT CCGTTTTCCTGCCAGACCTAAGGTCGGTCTTTCATGATACGGCTGYTCAA AAGAAATACTTTGCCCTCAGAACCCTGATGTGAATCTTGGCTTTGACTTA GGCCTTGCTTAAAGATAAAGGTCGGCATAACGTGACCCGTGACTGCTAAC AACGGCAAGATCATAACAAGCAGTGGGCACTTTGCTTTCATGATGCTAAA GGCGTTATAAAGACTTTTTGCAACCCATCTATTGTTTCTTGTGTTATACT TTTGGGTTTGACCGAAATTTTTCTCATTTTAAGCAGAACTTCAGAAGATT AAGGCCGCTTCTAGGTCATAAAGCTTTTTGAAAATCCTCGTCAGTAGGTC CACACTATCTGATTCGGTATGTTTTTCTGAAGTTTTGGACGAATCGAGTT GTACGACGGACCGTTTCAACCGAAAATGCGTTGTCTCTTTTACAATATAA AATTACACAAAATCATAAATGTACGTAACATTTATGTTCCTGATTAAAAG AAGCCAGGAATTCATAATGATAAGAAAGCATAATGAGCAACCCCAAACTT ACTCTCTATTAGTGTGTGCGTATATTAAAAATGGTTTCTAGGGGGGCAGG ATGAAGCCAAAGCAAATTGAAAACATTTAATTGAAATACCCTTTAAAAAA GTCAACCATAGACTCAGAAAATATCAATCATTATTACAAATATCGATTTT TCTTCAAAAAAAAGTGGTGGACTATTTGTTATTTAACTCAATTGCAAGCG TTAGCCAAAAATATCCAAAAACATGGTTAACAATAACCATTAGAATAATC GATTTTGTTTAGTACCAAAGGAAATTCCTATTTATATACAAATCCTTTCT GCTTTCTCAAAAACGACCTTGTTTGCTTTAAAAGACTTTATGCAATATCC ATTCCTAACAGTATTTAAATTAAAATGCGTACCTATTCTGAGGGTACATT ATATGAATTCAATGAACTATATGTTATTTAGCCCTTACTTTTCTTTTAAA TATTTCTTAAAAAATAACAATTCGAGCATGACTCAGAATGATTTATTGGT TCCAGTTGATTAAATATCAAACTTTTAATGTCCTAGATAAAAATAATAGT ATCAAACAAAAGTTGTCATAGCATTATACACACCTTTTTGTTTTATATGC AACTCTTTTTTTAGATAGCACGCTTTTTTCTAATCGTTATATTTGATGTT TATCCCTGATAACTTATTATAAACAATTATATGTAGGAACTGTAAAGAAA ATAAATAAATTCAACTAAAAAAATAGAGTGTCACAAACAAAAAACATGCA GCAACGCAGAGCTGCAATTCCAGAGCTATTCACGTGTAGAAAATAATTAT CACATATGTTTTATGTGCTGAGCTGTAACCACTCTACTGTGAATGGGATG ACCGGGATAGGCAGCACAAAAGCTTGCATAAGTTTATGGTCAAGCTCATG GCCAAAAGAATTGGTTGCTGTAGTTAATGGCAAGAGAGACAAGTTGACCG TCAATCGCGTGCATTTGACAGCACCCACATCACTATGCGCCGCTAGGCGA AGGAAGGTCTATGCCGTGGTGCATACAAGGGAACTCATCATCATAGTTTC AAAACTTTGGATGGAGTAAAGTGTGCAACCCGGTGTTAAATCATCCTCAA CAATCTTAAAAAGTATGGCCTCCTTACAGTTCTGACTGTCCTTCCTAGAC TTTAGTTATGCACTTGGCGGAAACTGGGCATCAAGGCCAGAGATGGCTAT ATCGATTGCAAATGTAAAATAAGGGGTTCTTTGATTGAATTTACAAATTA AATTTTTTGATGATATTTTTTGAAAAATAACAAATTTTGTCATTTTCAAA GTGTATCATTTTAAATTTAACCATCAATGACCTTTGAAATTGTGTTTCAT GATTATCTAATTAATTTGTCTAAAAATCTTTTAATATATTTCTGAATTTT TGATTATATCAAAATCTTCCAATCTAAATACATTTATTCTCTGTCGATAA AATCCTTCGGTTTGTTTAAGAAAAGCAATTAATTTTACAATTCTATCTGA ATTAATTGCATATGTATAATATCTTAATGATCTACTGTTTTCAAAAAAGA TAAAGTTCCGTACTAATTTAATGTATCCAACAATTATGGATGTTGCTAAA ATTATATTAAACAGATAGCTAATAATGCGTGATACTAAAAAAAAATTAAT ATATTTCATCTTCAAGTTAAGGCTTAAACTTAATTTGATTTTTATTCGAC CCTCCTAAAATACAGGGATTATTTGAGTGAAGTAATTAAGAAAACAAATA TTTTCTGTAGTTCTTATAATGTTCTAATATTAAAAACAAGCTATCAGGAA AAAGTTGGGTTTATAGGAAGAGTTCACCTTTAGAGCCCTAAACAACTTTG ATATCATGTAAAACAATTATCTACTCTTCGGAATATTAATGCATATGAAA TTTGTAATGGTACAAATGGAAGTGAGGAAGACGAAGTATAATATTAATGA AGAACTCATTTTGAATAGAAAATCAACAAAGTATTGTAGACGAGAATTAA AAGGATTTTTTCAAATATTTGCATTGACAATCAACAAAAAAAAATGTATT TCCTAATAAATTTGTAGAGTAAACATTTAAAAGATCTTGCTTGTCCAACA GGCAATTTAATGTGGTTACTTTAAGGGTTAGGGAGTCGTTTAATTTGTCT ATTTATGCCCCAGATTAAAAACAATATAAATGTTACTACAAAAGAATATA AATAAATAATTGAATAACATTTTTAAATTTAATAAACAAATATAATTAGA TATTTGATTTGAATTTACTAGTGACTTAAATTTGCAATGCTAATCAATAA AATACAATATAAATCTTTAGAAATTTTTAAAGTTAGTATTTAAAAAATTA TACTTCTTAAACGGACAACTTTATGTAGTTACTTTGAGGGTTGGAAAATC GTCTAATGTATCCATTTATTTTKTAYATTYAAAAAAAAAAATCCAGATCC AAAAWAACTTNAAAGGGGGGGGGGTTGMGAAAATCAAATTTAATYTTAAT CCAATTTTTTGGATGCAAYAGSATTTTTTAAGGTCTATGAATAATATTTT TCAATTTTTGGCCGTACTAAATGAATGATTTCATCAACAGAAGACACATG TTTTTTGATTTGAAGATTTTGATATGATCAGAAAATTGATTGTATCTAAC CAAACAAAGTTCAAAAAATTATTATAMCATWRWTTATACYAAGTWATAAA TTCAATATAAATGGGCCATGATGGAGATTGCAATATAGAGTTGGAACAAT AATGAAATGGCAACTTCTGTCTGTATTATTATTTTTCTCCTGGAGATTAA AGGACGAATAAAAATCAACTGGAACCAATCAATCATTTTGAGTCACACCC GAGGTCTTATGTTTTATAGAATTGTCAATATAGAGCAATTTACTACCAAT TGTARTATAGAATTGGGMTTCTSKCAGCCAATATATATATATATATGTAT ATTGTACATCTTTACTCATAATTATTCTACTACGTTAGGCCTTTTTATAT TTATATATAGATACATCAATTCTAAAATATACATTACGAATATTAAAAAT ACTCGTTATGGTATTTGCATAGAAGTTTGATACCCTTCAGTAATATGTAT AATTTTTCTGCAATATTTTTTTTATTTGTTTATTCTCTTACTTCATAAAC AGTTTCTCTTTTTATTCTTAAGTTAACTATGTCTACATATGAATTTGCCT CTCCAAATCACAGTAATTTATATTACCTTTTATATCATTGCTTTGATTGT GCTCCGAAAAGAGTACGCTAATTTTTTATCGTTGGCACATGACTAAAGAT ACTGCCTTGTAGATATCACTGATATTTCAGAACAATGAGTTGTGAGTTCG GAAGTTAAGGATCTTAAAAAGAGTTGGACACACTTATTGCAAAAACGAAA TTGTAAACTTAACTTGGTGTTATGAAATAAATAATAAACACCTGGTCCCT TGGAACTATCAAAATACATATATTTAAATGTATGAATTTACTTCATTGAA GCAAGTATTTTATGTTTAAACCTTCTTTTTTGAATAAGCTTATTTTGTAT TTCTACGACATAAACATATATCCTACAAAAACACATACATTAGTTATCAA CGAAAATGATAAAATATTTTGTAAAATATTAGACGTTATTTATTGTGACA CAGCATACGTAATGTGCAACACTAAATAACAAAATAATCAATTTATTGTA ATATATAAATATAATTTCTAGATATGTTTAAAATTGAACCATTTAGTGTT CACTAATTAATTTAAATCAGGCATATGCAATAATTTAATAATACTACCAT TGTGTGTGGCTCCCACTGATGTGATAACAAAAAGTTTTCACCCATCCAAT TTTATCTCGACTTCTCCTCCAAATCACATTTAACTTATTGTTTCTTTTAC TTAAAAAAAACTGCATATCCTCTTTCCGAAATTCAACAATTCTATATTTC CTGTATTTTGAAAAAACTTTTTTTCGGAAAAGTAAAAAAAAAAAAAATCT AGAAACTTCTGGGGGTTTACAGTAAACATGTATTTAAATTTCTTTGTTCT GTTATCTTTTTCAGTCACTGATGACTAGAATATCCTCTACAACTTTCTAA TTATCAATTTTTAATAATGGAAAACTGTTTTCAAAATGATAAATTTATAT ATTCTTGGGTCAAATCTTACTAATATTATCGTTTAAATCCTTTTACACTC AGCAGAAGTCAATGTTAGCAAAATTTAGTATTTTCTTTTACTAGTAATTA AGATTTTAGAGTATATTTAATATCATCAATATGATATCAATGTGACTGTC TATTTATGTATGGGTATATCCGGAAATCACGGCCAACCTGAAGGATGGAT TTAAAAAAAAAAGTTATTCAAGTTTTTAAGCCTAAATGGATGGTTTTGGC CGCAAGGCCGTAGTGCCATTAAAAGAACATTTGTTTAAACGATAATTTTC ATGATCAAACGACTACTTCATATAAAACAAAAAATAATACCGTAAAATTC TATGAACTATTTTTAGTTCTACTAAAAATAATGTTGAAGAACGATTAAAA AAAAAAGATTTTTGATCATAATATGTAAGTTGATGTATAAATAGTTCAAG AGGCTTTTTTTTTTTTTAACTTTTAATTTCTGTTAAAAAAGGTACAATGA TACACTTTAAAGATGAAGAGAGTATAACTATTTCTGTTTTTGTTTGGTTT TATACGAACAAGAAAAGTTTAGAATTAAATTTTACTTTGGTAATGTGCGA TCAAGCATACTCTAGTAGTTATTAAAAGGGAGTTATGAATATTTTGTCAT CTACTGAACATAATCATAAGAGAACTTTATACCTCTCTAAACTTAAAAAA AAAAAAAAGAAGAGTGCTGAATGAATTAAAGGTATATTTTATTTTATTTT TTAAGATATCTATGTTTAAGAATTTTGTCGGTTTAATGTATACAAATCAA ATTATTCATAGTTCAATTCTTTGGGACTTCTTAATGTCCCTTAAGTATCA AAGAAGTTTTTATGTCGTTGTATCAACTGAAATATTTTACAGTTGAATTA TATAGAGATAATGGAGATTAAAAAATATATTTCCAATTCAATGGTGGTTT TACTAGTCAACAAATCAGTACTTTTTTGATAAAGTGGTTAGTCGAGGKGA AAAATATATAGATAATAAGGTAAATGCTTTAAATACGGAATTTATTATTG ATATAGAGATTCCAAAATAAGAACTATGCAATGTAATTAGTTTAGAGCCT CTCTGGTAACAGTCACATTATTTTGAAAATTAAAGAAAAAAAAGCAAATA AGGGATTATCAATAAAAATACAACATTATTTAAGATTTTGAAATAAATAC TGGATCAAATGAATTTATTTACATAATTCTTGATCACTTAGCTTTAAAAA ATAGCAAAAACTTGCAAAAAATGTGTACATTTTGCTAGAGAAGATTAAGA AATAGAAGTTTAGTAATATGTACTTGTGTGTTTACAAAATCATATTAATT GATTCCAATATATATTTTATAACTTTTTTTAATATTTTATTAAAGAAAAT AGTAAAAAACCATGATAGTTTATTCAAATTTATTACTCTGTTGTATACAA GGATATCCTTTAAAATTGTTTTGTCAAGTAGAATATGAAGTAAAAGTATT AAAATACATTATCAAAATGAATAATTAAACCTAGATTTTGATAAGATAAA AAAATACCACCGAAAGGACACCAATATCCCATAATATTCGTTAATCAACG GTAGAACCTACAACTTCTTAGTTAATGTAAATAATGTTAGTATGATCGCA TAAACTTTAAAAAAAGAATGAACATTCAAAAGAAAACACATTTTTATATC ATATGAATTTAATTGATTTATGAACATTTGCTACAGCATTTATTAGAGTA ACGTTTACTCTTGTTAATAATTCCATCAATTTTAAAAGCTTCATCTGCTA CGCTCAAGATGAAAACATTATCTTAGTTATTTTTTTTCTATTTTTTAAAT CAATTGAATGTAAATGATGTATCTATCAATCAAATATTTCACAGTACATA AAATAAGTAGCACTTAGATATGAAATAAATAAAATGATTTAAAATATAGT TCTTATAAGAATTACTCAGATTAATGTAAATAATCTATAAACTGACAAAA TATTTTACGTAATATAATTACATCATATAAAGGCATTAATATTTTGACTT TTATAGTTATAAAATTAAAGAAATTACCTTTATATTTTTATTTAAACTTT AAATGTAACTTTTCTATGTATATAGATAGATAGACGATGACTTTTAACTA TTTATACTGTCATAAACTAATATAAAAATAAGTATTACTTTATTTGATGA CTACTAATTGCCTAATTACATTTTATATAAAACAATAGAAATTCAGTGTA TGTTAATACTTTTTCATTTTCTAACATTCAGTTAATTTCATTTTTTTACG AATATATATGTACTATCATATTTAATAGTAATAGCTATAAAAAATTGTGC TTTCCTTTAGTAAATTTAACAGGAAATACTACATATAATCAGTATTACTA AAAAAATGAATAATTTTTCTACCATTTATATAAATGTGGTAATAAAAACC GTTATTTTCATATAAATGGATTAGTAATGTATTTTTCGTGTTGTATATGT GCAATCAATTTATGACATTAGAATGATAAGATGTTGCGTTAAAAAAGTTT TTCAGACAATTTTTGATTTTTTTGTCTTATGATTGTTAGAGTGCATGTCA AATATGGACACTAGTAAAGAAAAAATAGACAATATATTGCATATTTTTCT CGATAAAGGAAAAAATGCAATTCAGGGGGGTAAAAATTTGAATAGTGGTA ATGGTCGTGATACTGTAMCAGCCAATTACGCGTTATTTTAGTTTAGTCGA TTTATTGCATTAGGCCAATTGTTAGAAATGTGAAAAAAATAATGAAAATT GTTGAGTTTGGCCGTCATTTAAGCACTGTTTTGATCAAAAAGGAGATAAC CATTTATGGAAAACAAACTTTTAAATTTACAAATATCCATTTAAAATAAT AAATTTAATTTTAGAACACCTAACAAATTTTATTTGTAAGTTAATAGTTT AATATAGAAGTTTTAAAATAAAATTTAATTCTTTTGAAGATAAATTGTTA TCAAAGAATTTGTAATGTTCCCTAAAGAATAAAACATTTACCAAACTCAT TCTATATTCCTTATTTAACTTCATTGTCAAGATAGATAAATAAAAAGAAG GCAATAATACAAATTTTTCATTCTTGGAAACCTCCCCAATTAATTCATTA ACTTATTAAAATCTGGGAACCTAGTAAAATACCATTGAAAAAAGTTAATT ACATGAAATGAGTTTGGGACAAAAGGGATTTTGTATTTCATTCCTTCTTA TTTAACTAAGTACAGTTTATACATTATTGATTACATGGAACATACGACAA TAAGGCATTGTAAAGGTGTGAGTATATAGTGCAAACAATTTTTTGGATAG TATTGCGCTTGACTTGTTCCATTGTGAATTATTGTGTGTTCATTATAGGG GTCTCAAAGGAAAAAATGGGTCATATATAAAAGTATCAGGGACCCAAACC AAATTGATTCATTTCTGAATTGGATTGTAACGGACGATCAAAATTGGATC ACCTACCTCAATTTTAGCGAACAAAGATCGTGGTCGAAAGCCTACAAAGC GCACCAGACTTTGGCTCAGATAGAATGAACGGCCAAGAATGTGATGTTGT GTGTCCGGTGGGATTAGATGGGAATAATCCACTATGAGCTGCTTCCCTAT GACCAAATGCTCAATTTCCCCCTCTACTGTGAAACACTCGACCATTTGAA GCTGGCAATCGAACAAAAGCGGTCAGCCATGTTGAATAGAATAGTAATCT TGTTTCATCAAGACAATGCCGAGCCGAACATATCTTGGATGCAGCACCAG CAGCTGTGGGACCTCGGATGGGAAGTTCTTATCTATTCACCAAATTGGTC CAGGCCTGGCACCAAGTAACTATTAGCTGTTCTTGTATATGAACAAAACG CTTGGGGATACAAATTTGGCCTCAATAGAGGCCTGTGAAAATTGGTTGTC CGAGTTTATTACCAAAAGGAACAAGGGCTTCAAGTAATAGGGTAGCATGA AGTTGAATTCTGTTTGGTAACAAGTAATCAAACAGAACAGAGCATTTTTG TCTTAAATTGGATGAATGTAAAACTTCTTATAAATCATTGAAATAAAGAA AAACACAGATATGAATTGTTCACCAACCTTAATTTATATATTATGATAAG TTTAGAGTTTCCATAGAAGATGTAGCAAAAATATGAAACAAGAATGATAT TTTTAGGATATTTTGGTCTCTAAAATAAAATAAAAATTGGTTTTAACTTG TGAAGCCTTTTGATTAAAAATGGTTAATATATAAAAAATATTTTTACATA CACCGCTTAGTTCTGATACTTTTATTTTGGTATTTCAATGAATTGATTTT GAGTTGTAACTATTTTGGTAAGATATAAATATTAATNGAAAGAATAAAAA TAATTAATTTATTTAATTTCCTTTTCAAAAATCATTTCCTCGTACACATG AGCGAATACACGATGGCGTAAAAAGGTTATACTACACTTTGTTTTGATAT GATACCTACATTGAAAACAAAGAAAATTTTAGTAAAAGAATTCTCGTGGC TTTCTTTTTTTTTTTTTTTTAAACTCKCTTTTTTTTACAAAKATTTGGAT TAAGCAAAAGGAAAGMGATTAAATAAAAAGAAAGGACGTACATAATTTTT TTAATATATTAAAAAAATAATTGTTAGATGCTTGTCAAATTAAGGAGTTA TCCTATTAACTATTGCCCTTTTAAGAGTATTTATAAAACTACATCACCAT AATTATTTATCCATATACTAGAATGTATAAGAAATGATACTAACGAATAA TTGCATGATTACATATAACATCATTTATATTAAACAATTAACACTGTCAA AGAGTTCTTATAATCAAGTTTCAAGTCGTTGCTAAAATTTCCAAGTCCTT AAAAATAAAAATAAAAAGGTAATATCATATTGAGTCAAAGTCCAGTTCAA TTCCTTGAATTTTGTATCGAGCCTAGATTAAGTCCCAAGTAAATAAAAAA ATATATATTTTAAAGAGTACTTTATTGTTGAAAAATTGAAATGACTTTAG TGTCCAAATATAGTTGCAAATCTTAGCTTCCAAGCTCAAGAGAAGTCTCA CATTGTAGATACTATGAGCAAGTTGAACTGCAAGTTTTGAGTCAAACTTA AACTTCTTAAATCATTAAAAGTTGAGTATTTATTCACTCCAGAGACTAAA ATGTTCTTATAATATCTTTTTTCTTTCCACAAAATACAGTCTTAATTCTT TGTTTTTTTATTATATAATCATGGAACAGAGATAGAACTGTTGCTTCAGG GAATACTTTTCCATAAGATGTAGAAATAACTATGTCATAATTGGAATCAG AAGAATTTCATTTTTTTTCGCACTGTCCAAAAACCTAACAAATATTAGTG TTCTCAAATTATTTTCTATAAATTTTGTTGATTAGCTTTAAAGTTACTTT AATCATTTTGTAGATACAGAATATACCTAGAATATACAATTAACCTATTA TTACAAGAAAAATATTTTTTCCCTGTATTTAATACTTTTTTAAATGTTCT TGAAATTTGATATTATCTTATGTATAATTGTATTTCGTTTAAAAGGTATT AATTTCTTGAATACTTGAGTACTCAGAAATTCAAATAGTTACATATGGGT TAATATGTTATTTATATCATGTAATCAGTACATTTATCAGTTTTAATCAT GATCATTGCATTTCATTTGAAGGTGATTAATTATAAGTTTGTTCATGGGT AAATATTTAATCTATTTTTATTTTGAAGTATTTAGAGAGAAAGAACAACA TTATAAAAGCAAAAAAGAAAGAAAGCAAGAATATTGCTCATATAAATGTA TGAAGGGAAAAAAAATCTTTTACAGTTTCAGACTTTCTCTTTTATTATTG CAACTTACTTTTTAAATGTCAATGTAAAGAGGCGAAAAAATAAAGTTATA GGAAGGCTTTGACCTTAAATAATTTTGATGCCTTGATAATTTCAATTTAT TGACCCATCCCTTCTTCAGAAAAATTTATGCATTAGTTTGAGTAATAAAT AAACAATCTTATTACATAGTCGACCTGAAATATTATTACGTCACGTCAAG GTCTCGTAACTATTAAGTTGGTCCAAGTGCACCTACTCTATCACCTTCTT ACTTGTTTGCTACACGCCAGACAGTACTTCTTTAGAGGCGTAAAAATCGT CCATTTGGAGTAGATGTCTGATCTTCTTGAACAAAAACCGATTTAATACT CCAGACGTATAAATTAGCCAGTTTCTTATTGATATTTTTTGTTCTCTATA TCGTCTGTCAGTATCCGATGAACGGTTTTTGTGATAGACAAACGTTGGTT GCAACTTTTAAAGTGCTGAGATGAAGATTGGAGTGGATTAGAAGACGAGC ATGAGCTATGCTGTCGAGGCTCTGGGTCTCCCTTCCTGGTATAGTAGACG ACCCTCTTCTTTTGGTTCAAAATATGCTTTAAAAGATATTAACTCAAAAT CTCACCCAATTATGGGTTTCTTAAGAAAAAAGGTATTATTTTTTTAAAGA GGATTTTTTAATAGATTAAATTATTAAGTTAGAATGACTTTTTCCCTATC TAAATTAGATTAAAAAATAAACCGCCAATTTCAACATGGAGGTCAAACAG GGCTTGTCCAAGAGCTGGAAAATATGTAACTGTCCAGCAATTGCAACTAT TGCTCCCTCTAAAGTTAAACTGGGGGATTCAAATCAGGTCAATTGTGAGG GGAGTTAGACAATCTCACGACGGCCTTTGTCTTTATGTAGACAAAGACAT CATTKGTAATATTAAAAAAAACTTTGATCAGGCCTGAAAAGGAGCATCTG CTGTATTAAAACCGATAACCCGGTGATTGGTATGGTAAATTATTAATTCG TGGTTGATTGTGGATGTAAAACATAAGAGTCATAAGGCAAGGCAMTAGCC ATTTTAAGATGTCAGCTTCCCATGCAAGTTACGATAAATTGATGAGTCGG TTGTTAGGAGGCTTTGATCCATGAAGGCTAGGTGAACGGTTAAGATGGGG ATGATGGTGGTCCATTGCCTGTTATTTCTTATAATGTTTATATGTACCTC TTGGACATTTAATGTAACCGTGATTTGACAGGGAACTGTGGAAGCTGAGT CTTGCACACGGTTCAGTKAAGCCAATGATGAAATCCACAGCTGTTAAATA AAATTTATATAATTCTATGTCAAGAATATATGTGGTGTTCCTAGAAACTC ACTTGTTTCAACACCGGATGTACTTGTTTATATAGATTAAGATATTGTTT TTTTCCTCAACAATAAAATAAAACAGGGGAAATTTACGAATAAAAAATAT TGACAATAATTTCTTTCAATTAACTTCTACACATAATGTTAAACTTGAAC ATGATTTCCTCTTGCAAAAAAAACACTAAATTATATTCCTAACATAGAAC TACGCAATATTTCCATATTTTCGAGGATATTTTGCAATTATATATTAATG ATGCAATAATATAAAGTGCTTACATAGAAACATGAATAATTTGAAAGTTT ACCCCAATTATTAGGATAAGCCTCTAAACGCATACATACATTCATTACAC CACAGTTTCCAATAATGGAAAAATTATACATTGCAGAAAACATTTAGGAA TACATTTTTAAGGTTCTTTATTAAACTTAAAAAAATTAATTAAAAAGTAT TTCTCAAGCTACCTATATGAATGATAATAAAGGAAGAATAATTAATTTTC ATAACTGTAAAGATGTTGAACGACCTCCAAACGTTAAAAATTATTTTATT TTATTATTGATATGCTGATCTAAACGTCAAAATAAATAAATTTTTGGGGT TAAACCAAACATCATTTCATAAAATGTTTCATGTTATTGGATTGCATCCC TAATATATACTATACATATGTGAGACAATATATGTAATTAAAAAGTTTTA ATAATAAAAACAGTTTGGGTCGTTTACCTCTTTAAATATATCTTTTCAGC TTATTAGCAACAAAATGAATAATAAAGGCATGTAAAAAAAATAATTTTTG TAAAAATTGTTCCAAAAACATTATTATTATGATGTAATTCAAAAATCTAA ACAAAAATATATCGGGCTTTTTTCAGAAAATGGGTATCTTATGTTAAAAT TTCTCTCACAATTCAATCTTAGAAAGTTGTAGTTTTTTTTCATTAGAAGT GTAGTATAATATCATTTCTAACAGACTGTATAAAAATATGTAAAACTGTA AATGTAATCAAAGTTTTTGTATGTATTTTGTAGGTTGAAATCACTAGCCT TTGTGGAGCATAACNTTGTAAAAAAATACAAGGAAGTTCAATGAACTAAA AAAAAATTAGTTTTGTAGAAATACACATAATTTGTCATTAGTATTTTTTT TTAAGTAATCTCTCAAAAGTGACTCTTTTTTATTAAAAAAAGTTTAATAA TTATGTAGATGCTGTATGGATACTGCTATACGCAGMATAAATAAGTATTT TAAAAAATACAATCCATTATTAATTTGTTTCATGAAATAAAATAACACCT AAATGCATTTTTTTCTCTTCTCCTATATTGGAAATCCAAAAAGATAGATG AAATATTATCTGGCAGTTTTTTGTCAGTACAATCATGATATCCCTTTGAA AAAAAAAAATCACATTTTACACACCTCTTTCTTTTTATATAATTGCATTT AGATTTGTTAAATATGGTATGGAATTACTCACTTCCTTTGGAAATAAATA CTGCTAAATTTGAAAAAAAAAAAGATTTTGTTTAACAAAATATTATAATC ATAAGAATATATAATTTTTAAAACAGTTCGAAACGGAACTGTGCCAGGAA AGAAATTTAAGATCGATCGGCCCATTGCCAAGAATGGAGGGGAAAAGTAA GGATAAGTTCAAAATTAATAAAAAATTATGGTAAAAAAATAATATTTGTA ATCAAATGAGTTTATATTTGAATATTAGAACATTAATAATTATTATTATT TTTCCAATTTAAAAATTCTGTCTTAATATAATTTCTGTACTAAGAAAATA AAAGATAGATAACAACACCTTAATGAAGAAATATTACATATTAATGGAAT TAGGCTTGAGTTCAACTTGCGCTTAAAAGATTTGAAATTTGTACATAGAA AGCAAATTATTGACTAAGTCACCAATTTTTCATTTTTAACTAGAATAGGG TTGCCTGATGTTGCCAAGACATTCAGAAATTAAAATTGATTTCTAAATTC CTCTGCTTCATATTAAGAAAACATTATGAGTTATTTTTGTTGCATACTTC TATGTTTGCCAAAAAAAAAAAAAAATCCAGAACCGTTTCTGTAGCTTTAA AAAACTAAATAAAGTTAAATCAGTAAATTTGTTTTTTCACTTAGATGTGA TTTCCGAACAAATACACCCACATACAGATAGATATTCACTTTTAAGATTT TAATTACATTCTGCAACTTTACATCCCTTTCATCCTTAGAAGCAATTTTT TTTGGTTTAAAATATTCGTACTTATAAGTTCCATGGATTAAGATCTTTAT GTAACATTAATAAACATCCTTTTTTTAACATAATTAGTATGCTGAAGTAG AATTTTACATAAAAATTTTAATGAATTATATGACATGAGATAAAATGTAT ATAGACTAAAATTTACATAATTTAAATTACTAAAATGTTTAATTATTTCA CTTTTTTTTGCACTTGTAAACATAATTAAAATACAAAAAATACTTTTAAG AAGAAAAAACAATCGTAACGGCATTTGTTTTCAAGGCTCATTAGATATAT TTTTTAATTTGATACACTCAAAATTATGATTTCATTCAAGAAAATAAATT ATTGTAATATATTCACTACTTTAAACGATTTTTGGCTAATGTTGTTTCAT TTTTTCACTTTTTTTTCTATTTAGTAACAAATTGTACGCCTGTAATTTAC TTAATAACTTATAAAATATCAAGATTATATAATTTAGTCAACTTTTGTTG AAAAAGATCAATTATACAAATTATTCCAAAAAAGAAACTATTACAAAATT TAAAAAAACTACATTTAGTCTGATTGTACGTTACATGAGCATGCTTAACA GTTTCAAGAATGAAATATTGATAGTTTTTTAAAAAATGGAGAACATAAAA TCCCATTTGACTAATGAAGGATCAACCTGAATACATCTTTTAAGTTTTAG AGGAAATGAGTTCATAAAGGAAGTGAAATTTTTGGTGATGTTTCACTTTG GAGCAATCTCTATTACAACATTTAATTAAGTACATTCACTATTCATTTAC TATATTTCAACAAAGTACTTACAACATTTAATAGTTTTAAGTTCGCATTA ATTAACATCACTACGTCTTTAAAACTCTAACACTTTTGAAAACTTTTTTT TGTCAAATTCAATACTAAAATTTTTGAAAGCTGCTGAATAAATTTTTACA TATTTCTCAAATTTGAAAAAAAAGGAAAAAATATTGAGCTTTTTGAGAAA ATGGATATCTTACAATTATTATTGAATCAAGAGAAATAACGTTGAGCCTT AATAAGTCCTCGACAACTCAAAGTTAAAGAGTTGCTTTTAAAACTAAATA TGTAGGTACACCATCATTACTAATAGATTGTAAAGTTTTCATAAAAAATA TATGAAATATCAATTTAATTAGGCCTTTATGAAATAACTTACTTTTGTTG AACATTAATTTTTTTATAGAGTACAAGGAAGTTAAAAGAACTTTTTTATC TGGCTACTACTCGTAAGTTACTGACTACATATGTTTGTAATTGGTATAAA ATATTTACAAAACTTATAAGAAACTGTGTAATCCGGTATAAAATTGAAAT ATTTTTTGGTTGTGTAGTAATAACAATTTTTTTGCTATGGGTACATATGT TTCCAGTCGGCATTAATTGGTTAAAAGCATGTTCAATCATTTGTGCGTTT TTTATGCACATATTTTCATCAGTGTTTTTTTTTTCGTGCAACATAATTTC GACGACATTTAAGTATATTTGCATCATAAATGCATTTAATTCTAGTCATA TCTAAATATCATAACAGAACTATAGAAAACAATTCCGCTCCACTTAATAT TATTTTAATTAAATGATTACATACTTTAATTTATACAAATTGAGAAATGA ATATAAAAATTTGTTATATTTCATCCTAATTAAAATTACCTTCAGTCAAA AGAAATTATATAATGAAGGAACACATCATCACTAATTAATTACATTACCT CAATGTTCGTCAATAACGAAGAGTAACAATAAATGTTAAAATATATAGAA TGGACACTTGAGAACGGAATCTTCCTATAATTAGTTATCTATTTACTCTC TTTGTTGTGTATGTTTGCTTTGAGTCTTAAAATAGAAGCCTGCAGAGAAG AACCTGTGCTGAAAAAACTTCTCCCGAAAAAAGCCCTACTGAAAAGAATA ATGTTTTACGTAGAAATGAAAATTGACAAAGAAAATTATATAGGGTTTTC TCTGAGTTACAGCAAGCGACGGAAAGAAGACCACATGATCAAAATATTAA TAGGTCAACTAATTGACAAATTTTTTGTCAGTTAGAGGTGTTGACCATAC TTTTTTTTCAGTTATTACAACATGAACTAATATATATCAAWATAAACATG ATACACACAATTTATNTTTCRCCCCCCCCCCCCTTCCTCTGACGTAAGAA AAACGCAAAAGATAAAAAAACAGAAATAAAGGGAGAGTTGATGAGCAAGC ACTCATCCTTTCCTTTCATAAATTCCGTTTGATCGTAGATAAGCTATGTA AGCATAAGAATAAAAAACTATCATTTCAAAAACCAACAGTTGGTGTAAAG TATAAAAAAGTATATAGACAAAACAATTTTATAAAATATATTTTTTCCCA CCATCCATCCTTTCCTATACTCAATCGTCCGTCCATCCTTCCGATCCAAA CTGGATTCCCTTATCTGTGAAATATCCGAAGATGCGGAGGATTACTCCGT ATATTTCTCTGAACTGCTTGGGATCCCCATCCCTCTGCACCAGATCAATT AGAGTATTGAGAAGACGCTTACAACCAAATTTTCAATTTTTCTGCAGTTT GTATGCCGGCTCAAGGCATTAAGTATACTTTAATACTACCCAATAACTTA CGATACATGAGGTCACCCTTTTAATTGAAATTCCATTGGAATTAACAAGG ATAATTCTGCAAAGAGAAGAAAACCTTGCCCACGTTATAAGTAGAGAACA CAAAATGGACAAGCTGGAACCAAATGACATAAAATGATAAAGTGACGTCA TCTGAGTTAGTCTAAAAAGTGACAGCAGTGAGTGAGAAAATCAAAGTGAT ATGACAAAGAATCTACACAAGCGAACTGAAAATTTTCGCCACTTTATTTT ATAGCTTAAAGTTTTAAGATGTGCTCTTCCTACAATGTTCTTAATCAACA TTATGCATATTTTTAATTTTTTTTGGAAATTATAATAGGTCACTCGACGG TCTAGAAGTTCTAAGATTTTTTTTTTTTCAAAAAACTATTATTTACCTTT TAAATCATTGAGTGCACTGCCATTGAATCAAAAATGAGCAGCGCCCATTT TTTCGCACGTGCAGGTGTATTTGAATTTGACAACACCTAATTATTGCAAT TAAATTCAACATATTGCAAGTTCAAGTGTGCCGTTTGATTTGTGACAACT ATAGTAATCCAACTGATTGGTTTCATTTAAATACGTGTGTCAATAAATTT TTATTTATCTATTGGTGTGCCCTAGAAAAAAAAGTTCCATTTACGAGATT TCGTCCTATATCATCCAGTTAAGCCTAGCTTCAGGTTGTTTAAAGGTTTC TCAAGTAGTTGAACTTAGGCTTGATAGAGATTCTGAAACTTTTGATNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNATATTGAATCATTTTTGCCAAGAT TGATTACTAAATGTTATTTTTATAAAATTTGTCATTATATTTTTTTTATA AAAATTTATTAAGGTTATGGTTTTGCTTTTTGATCGTGGAAAATTTCCCT ACCACACTCTGTAGTTCTGTATATTCGAACAAAATTAAAGTTGTTCCTTC TAAAAAGTATCATTTTTCACGCCCAAGGTTCCATCAAAAGTTGTACATTG TAAAATTACAGTGATTGTATTATTCAATTTTTATTTCAATTTTTATTTTA CCGAATATTATTATTGAATACATAGNATAAAACATTTTTTTTTAATGAAT TGAAGTAAATTTTTCTAATATTTCACCTAAATAAAACAAATATATATATA CATATATTTGAGGAAATAAAGTATAGACTAAATGTTACGAATACCTGAGG AAATGAAATGAAACAAAACGAAGTTACTTTGGAAGGTGATCTAGGTTAAA AAAAACTAGGTTAATTAGTCCAAGTCACCCAAGACAAGAAGTAAGCAGAG AACTATGTTGAGTCAAGGTCGAGTCCAATTCCAAGTGGTTCCAAATTTAA AATAAGTTCATGAAGAATTATTCTAGTACTACAGCTTTGGTAACAGATAT GAGCAAAAATGATGGAATAAGTAAAACTGTTATTTAAATTTGTAGTTTAG GGACTTCTATTCAACAAATATATTATTACCAAATAAGTACATACCGGGCC GTGCAGAATTATTTACCTATTTTTGTTCAGAACATATTGCGGACAATACT GACATTTGAATGACTCGAGAAACAATTTATTCATACATTTTTAGAATAAT AAAATAGTTTGTMATKAAATTTAATCAATMTAGCCACCATTTGACTCAAT GACACTGGTCAGGCGACGTCTGAAGCTGACACAGACTTGCTGGATGTAAT CGGCGTCCAMGGCGACCCACGCCTTGTTGACAGCAGCCTTTAAGGCATTT ATGTTCTTGCGTCGTTTTTTGCAGGCCTTGGTCTCCACGTGCGCCTAGTT AAGGAAGTCTAGTGGGTTCAGATSTGGGCTGNGAGGGGGCCAGTAGTCCT TGGCCAAATGTTCATGTTGTCCTTGAGCCACTCCAGAGCTTTCTTGGAAG CGTGGGCGGGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGTGTGTTA GAAGAAGAATGATTGAAAAGTTGATAATAATTAACATTTTCCTTAATTTA ACAAATTTCATATTAAGAATGTTGCACAAAATTAATTTATTTGTAATATA AATATAAAATAAAAAAATTCTTATCAACAAATGGAGTTCATCACTTGAAT TGATGAATTGATTAGTTTTTGTATTTGTATTTATTCATCGAATTTAATTA CAACACATTTGTTTTTAATTAACTACATAGGTAAAGTTTTATTTCTTTAA TAAGAATGTTACTCGTTGTTAATTTGATTTTTTGATTAATTAAACTGTGT TTTAATAAATTTTACTCATTGAAGTTGATTAATGTTACAAAAGTTTAATT ATCGGCAAAAAAATATTCTAAGCCTAAGGCATATCTTGCATACTTTTAAA ACCATTATACTTGCTTACATTTTATTTTTAAATTTGGTTTTATTTTAGTC ATAGTTTGTATAGTTCCATGACAACATACATATTATGAACTTTTATTATT CTTAAAATTGAAACTTTTACTATTTACAAACACCGGTTGCTCCATTGAAA TTTAAACAGAGAAATCTTGCAAGTAATTTGAAGAAGAAGATATTAATATT ATCTGATAGCRTATCCGATATAGATAGTTTAAATATAAAACAAGGGGGTT TATTAAGAGAAGAAATTTTTGGTTGTAAAAATGCCCTCGAATTCCAAGCG TTGTATCACAGTTGGATGGATCAAGCGTCATAATAATAGCACAGGGAACA AGTTTGCTGATGCTTTGGCTAAGGACGGTGTTGAAGGAGGTACACCCGTC TTTGTCCCCAATTCCGTGTGTCAGGCTAAGAAAGCTAATAGAAAAGATAC TTTGAATGATTGGCGAACTWTTTGCCACCACTTTCATCAGTTTATCGTCA AGCCATACATCGAAACAAAAGTTTATAAATACAAGAGACATCAAATCTCA AGTATAGTCTGTATGGTTAGTGGTCAGATACAACTTAATATACATATTTT TGAAATTGGTAAAACCCTGAGCCCGATTTGTCAACTCCGTGACAAAGATA AGGAAACACCATTTAATCTTATGTATGACTGTTGCCGTACAATGCAGGAA ATAACTGAACTTGCTATGGAGTCTGTGGAAAAGAAACGATCAATCGAGGA GTTACTTTGAAGGTTTTAAGGATTTTTAATTTATTGTGTAATTATGATTT ATTTTATAATAATAAAGTTAGAAACTCATAGATGTACCTTTACCAATTAA TACCGGATTGAGTTCTGATGTGGTGGGGGGTTTCTCAGAGCTAAACAAAC AACTTTTTAACTCATTTTCAATATCTGAATTTTATTTTCTAAAAATTTGA TGATTGCATATAAAATGGAAACATATACAGAAAGCAATATTTATTTTTTC AAAAAAAAATATAAATTTATGTGAGTTACTTATTTTTCTCCATTCAAAAG TTGTCTCAGCCCTTTGTATAAGTGTAAAGTTACTCAAAATTTCGAATCGA AAATTATCATTTACCTGATTTGATACAGAAAAAAAAGAGACAGATTTAAA AAATGATGGAAAAAAAAATTATTGAATAAATAAAATTATCAAAAAATGCA ATTTCTTCTACAAAATATAAATTCTCTATTTTTTAATATCAATTTGTTAC ATCCGATAGATACATCATATATAACATTTAAAAAAACAATCCGTAAACCC ATTTAAAACATTTCTCCAAAAAAAGTAGGAAAAATGACAATGAAATTTTT CTCATCTACAGTAGAACTATTTTTCATTTTTTACACAGAAAACACTCTAT AGCTACACGATACCTAGTAAGAGTTTGTAAAAACTGGTAAGGAGTATGAA AAGTAAGAAATCAACAGCAGATAAAAAAACAAAGAACTATTTGTTGATTT ATCAATACCTAAATAATAATACTCGATATATGAGGAAAAAAAAAACTGAC CACCACGTTTATTTTTTTTCCTTATACTTCTACCATTCCGCCTTTTAATC TATTAATTATTTTATATATTATCAAATTAGCAAATGGGTTTTTCTGAATG TAATTCCATACAAATTGAAATTAGATTATATGCACTCACCAGACTTAAAA ACTGCTGTTACTTTATTGTAAGTTTTGAACATGATACAATTTGTATTACT TTTTTTAAGCCTATTCGTCATAAAAAAATATTTTATTTAACTTCTTCTTA CTATTGCAAAGCTACAGTAAACTTTGGAAACTTGAATTTGTCAAAGTTAT GAGTTTTTTTTTATTTTTTGCTCGACTTTATTTATTATAATCAATCAATT TTGTGAAAATCTAGAGTCTTTTGACTTCGTAGTTAAATTTTTAGATTGCA ATTGAAATTGGTATACTAAAAATATATCTATCAAGTATTAAATTTAATTC AAGTCATAAATGTGTACTGTGAAGGTCCATTCTCATTTTTTATGGGAAAT ATTGTGTTTGTAACTGGTTCCATGTCTAAAGTTGTAAACACTATTTATCT TAGAGATTACTAGATAATTATATTGAGAAAACGGAAAAAGGTGCTTTGGA AGCCTACGCCAAGTTTAAAATCCCAAAATAAGGAGAGTCCAAAAAAGAAA TCTAGTCCTGTAAAAAAGTCGGAAGAGAAGTGATCAAAGAATCTGAATAT GTTAAAGACATTGGAGATATGAATAAAAGAATGATACGTGATAAGGTCTT ATACGTATATATAATTAATATTGTATCCCTTAATGAAAATTAAATTGCCA GTTATGGGAGGAGAAGAAAGATATTGAAATATAGGACATCTTAAGCTAAT GCTGACATGGTGGCTCTAGTAGACATTAGATTTAAGGAAAACATTAACTT GCTTCCCATTAATAATTATTACAATTAAGTGTACCCCTATGCTACGCAGA GAGAAAAACATTCCTCGAAAGGTGTACTTCTACTGAAATGAAAAGCTATT GAATAAAAGAGTGTGGAACTGGACAAGGGTGCAAATTTTGTTATTTGTGA TGTAAAAAATGAAGGAGATATGATAAGAACCGCTGTGCTTTATTGTCCAA ATGTTGATCACCCGAGTATTTATTTTTTTTCAACAATATTGCCAATAAAT ATATATATGATCTCTCTAAACGAACGTCTGCAATTATAAAGTTTGATTTT AATCCGGTGAATGACATTGTAAAGAACACAATGAATTATAAAAATGGAAA TAATCGCAGTGCTGTTATCAAAATGAGTGAATTGATTACTACTTTAAGAA TGTGGGACGTTGCATATCACTTGGAACCATTGCCGCAGAACACATTTGAA ATTAAATCTATAAAATAAGTTATAAAATAGGGAAGACATGACTGATTTTT GATGATTTGAGATGCAATGTTAAACAATACTCGTTACTGCCGAGATTTTA CTCTGACCTGTCTCTGAGTTGGAAATTATAATAAGACGATTGAGACATTT GTTTGAATCAGAAATAAGTGTTGCTCAGTACAATGAGTCTGAAAAAATCC TTAAAAGATACATATCTTTTCTAAGAAATCATAGCTCCTTGATCCGAGAG AAGAAGAAAAAACGCTTTGCACATTTGGAAATCCTCATATGGCAAAAGGC CGGGTGTAAAAATATAAAAAAGTGTAGGATTTAAGTGCAGAAGACACTAG AGTGGTGATAATCTGATGCAAGTAAAATACTGGAACTGAATACTTTAAGG GGAAGAAAATTCTTCAGGGAATGGAGAATGTAAAGCAAAACAAGGAAATT TTGAAAATTCGGTTCAGTTAATAAGGTAGGATCACTGAAACCCCAAAATA AATTGATGCAACTCTGAAAGATTACTACAAAAACCTTTATAAGTTTTACA TATTGTAATGACGTTACTCTGAGCCTAAAATGTAAGTACAAAACAGCAGA TTTTTTTTGAATATATAACTTATGTAAAGAGTATTGATCTAATACTGAAT GAAAAAGACAAAATAATTATGGATACCAAAATTGGTAAGGAGGAGATTTT GATTTATTTGATAAATTATAAAAAGAAGAATAAGTTCCTTGAAAATTCAG GATTTCCTATTCAGTTGTACATGACATTTAGGTAACTGCTGGCTCTGATA CTGTGCAGGATATACATATGAGTAATGTTTTGAGAAATAACATCTTTCAA ATTTTATGGAAGGTTTAATTATTTAGTACCAAAAGGGAAAACAAATCCAG ATATGTACAAAATCTTAAACCGATTACTCTTTTAAATAGTGGTAATAAAA TAATGACAGGAATTGTCCCTGAAAGATTAAAAATGGTTATAAAAAAAATT ATACATGGAAATCAGAAAGGGTTTGGCCCTTGTAGGACGCAGTTAGGAGT GAGCAAGACTTTTTGAAGGAAAAATAAGCTATTGTGATAGAAATTGTAAT TGAAAAAGCATTTGACTCCTTTTCACACATTATCAATTCATTGAAACGCA ATAATTTTGGATACGTTTTTATTTGGAATGTGGGGACATTGATTTTGAGA GCAAAACCTTGCATACATGGAAATGGCAACTAAAACATTTCAAGATCTAA CTTTTCTTGTAGACAAGGAGACCCTTTGTCTGCTAATATATCTTTATAAT TACACAAGAAGAGTAACTTAATACAGTACATAATAATGAACGAATATGTG GGATATTTTGTAGGAGACATAAATGTGAAGTGTTTGGAGGTTTAGGAAGA AAAAGTTGATTAAAAATGAATGCAAAAAAAACTGCATTGATCACTATAGG AAAGGAAAACAAATACCAAGTAAAAAAACTACTCAAACTATACTATTAAG TATTGAGTTCGGGAGAACAAGTAGCTTAAACTATTAAACATATATATATT AGTAGTTTATACTATTAAACATATTTTCACTTTTAAAATTACCCTTTGGA TCGGCCTGGAAGAATATTTATATGGAATCAAATGATTGTGTCAAAGATAG GGCATTTAATTTTTTTGTTCCATACACTGAAGAAAAAGAAACAATCAAAT GAAAAGGAATTTCATCTTTCGATTGAAAAATTTAAAGCATAATAAAGGTT GATATGAAAAAAATATATATTTATGACCTTCATTACCAACATCAATCCAG TTATGTCGACATAATAAAACTATTTAAAATTAAGGGACGATTTAGGAATG TTATAGGTGCTGCCTATTTGAAGTTAGTCAACAAAGTTTTATGAGTTTGA AAGGAGCTGAAATTTTATTTCGAAATCCAAGAGTAATAAAATATCTTTGG AGAGCAAGGTCAGAGGAAACTAATCCAAACAGGATGGAGAGTGGTAGGMG ATTTAAAGTTGTAGGAGTTACAAAATGATTGTCTCATTTTGATAACGTAT ACGCATTTACAAAAAATGAGTCGTTGGTTTATCCTGAAAGACCTGTGAAT GTATTTTGATAGAGAGATTCAAGAACCACATAACTTCACATAGCTCATCG AGAAATTCAAGAACAGGTTGAGAATCAACCAAAAGTGTGCCAATATAATT TTAAAAAGTATTCAAAGCCCTTTGTTTTGGCATTACATATGGTGTGAAAA TTATAGGCTCTTAACAAATTTGCTGCTTTCAAATAAATGGTAGAAAAATA ACGTTACAAGTTTTTTAGGGTGTTTATGGAAAAATAAGATGATGATATTC ATTTATTCATGAATTGTTCTTATTTACATAATGGAAGAATAAGACTAAGA CAATATTTGGGAATTGTTGATAAGAAACTACTTTTTTTGTAGGAAATAAT AAGATCTCATATTATTAAAAGGAAATTTGTGTCAACAATCTATAGAATAT TATTGATTGACAAGAAAGCAATAGCTCTGGATCGAAATTTTATAGACTTT AAAGACTTTATTTTAAATTAAAAAACTATTTTGTAATTACTTTTTTTAAC AATTATGTTACATTAATTATTTGTTTGTTAGTTATTTTAAGTGCTTATTT TGTTATTTGTTTTAGAAGTTAATTATGATCTTGTTACTTTTATGTGTTAC TTTCAAGAAAATAAACTTCCCGAACTCCGGGCCCAGAAAAAAAATCTACC TACATATTTTGTAGTTATATGTAGGCATAAGCAAATTAATTTTGGCAAAA TCAATGATACATTTAAATATAAGTAATGATACAAACATCATTTTACGTAT AAATGAATTTTGACTGTTTCATTGTTTATAATAGGTAAGAGTTATAAAAG TTAGGATTTTTTTTTAAATTACAATTGCATTAATCAAGTGAAATATAATT TTTGTTTGCGGATGACTTTCGTATTTTAATATCACTTATAAATAAATCAA AACATAGTAATAATCATCGTTTTGTTTTGTAGTTTACTCTATTGACCACT CGTATGCACATCTTCCTATCAACGTACATAATCAATTGGTTAAAAATGTA CCCCGTAAATATAACATTTTAATTAGATGATGAAAACAAGAACGAGTATT AATAATAAATAACTAGTTGTAAATTTAACATCATTTTTAAAATTATTCAA ATTTTTATGGCAAACTTTTGACGCACAAAGTTTTTAAAATAACAATTACC AACGCGTTTTATTCAATATGTACCCTCAATTCGGAATGATGGGACAACAA TACAGGGACAACAAGAAGCATAGCTGGCTTTGATGAAGTCCAAGGATATG TTGCCCACTCCTCTTTGATCACGGCCTTCAGAGCCTCAGCATTTAGCTCA AATCGAGAGATTTGATCAATGGAAAATTATGGCTTRCTCGAAAAGTTAAA TATATCATGAAGAATAAGATGTATATATTAAGTTTTAATTGGTTTTTTTT GTAATCCTTGATGTTACTCCGAATCAATTTTTAATCATTTCCATAATTTT TTTTACAGTTTTATTTCATTTTGAAATTAACATCCCGCTAGTCGGATAAG CCTAATTATTCATGTCTATATATTGTTTTCTTAGGAAAAATCTAACTGTT AACTAAAATCTATAGACAGTTTCAAATTTATACATTTGTTCAGGCAAGAG AGTAAAATATAGTTGAAAAAAGTAGAAGAACCTGACGTTTCCTGATATTA TTTCTTAGTAAAACAAGAGTATATACAGAGTTACTCCCTTGAATGTAATA AAAACTGTCTATCTTGGAGAACTAGATGAAGAAAGGAATAGAAATTTATA TTTACTAAGTAATTAGTAATTTTATTGTTAAAGCCTGGCGCCTCATGAAA CTAAAACAAAAGTGTATCTATGTATTTTATAATTTATCAATTATATTTYT TTAGTTTCTTTCGCTTTTTTTAGAAAAGTTGCAAGCAAAAGCTTAAAAGG CAATAATGGTCTTCTCCTTAATATATCTACCCTCTGTTAAGATGTAGCAA AGGTCCCATGTACAAGGAAAGGCAAAATTTGGAGCTTCATATATAATATT GGCCAACCTCCACATTATTTTCCATAATTATCACAATTAATAAAAATAAT ACAAGTATTTTTGATTGAAATTTGTAAAAGTAAATTTAAAATGAACATAT CCAAGTATATTTTTTTTATTTAAAAAAAAGTTAATCTAATAATTAAATAA TAAATATGTATCTTTATCAAATATTTCTTCTTACATCTAAATGATACTCA TACTGGCGATAAGTTTAACTATCGAGGTCTCAGGGGTCTTTTATAACTTT TGTATAAATATCATCATCATACTTAATATATATACATATGTGTATACATA AATTTTATCAAAGAATGGTTTCTAATTGTTAAGTGAGTCATATTCTGAAA GTAGTAGCAGAAATCGTTAAAGGGCTTTTCTGTTATAATATTCTTATCGA TACAGATGCTTTATTTTGATATGCGTTTTGTAATAGTMTTTTCTAAAAGC TGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNCAATACTATATATATATATATAAATACCCAATATGGCAA TATTCGATCCTTCGTTTGTTCATCTCTTTATACTTTTAATCCTAGCCAAG GGATAGTTCAAAGTCTCTTCGGAGTGTCCTGCTTCAACTTATCATATAAG ATGTTAGTGAAATATGAACTGTTGTATGCTCCTAGACTCGACCTTTTCAA ATGTTTAATGATACACATCTTCAATAATTACCATTCTATAATACTCAAGA CTCTGTCTCTTCCATTTTATAATTGATATTACTGTGATAATAAAATGCTT TATAATTATGGAACCTGGGATCAGAAGAACTCTTGACAATTCAAATTATT CTCTAAGGATATAAACAAATCAGGGTTTTCTGATCTTATAGGAAATTAAA TCCGACATTTCCTTTCTTAATATCCCATCATCACCTGTAGACGTCTTTAT CGGGAGTCATTCATGGTCTAATAACTAATTTCATCATCATTCCATTAATA TACATGTTAAAAGTTATGTTCGGTTTTTATAAACGGGATCATTAGATTGG GAGCCTTATGTTATATATATCTTCAAACGCAAAAAAGTGATTCAAATTCC AAGAGATCCGTTGGTATAAATATCTTTGACGTAGAAATGTTCAGCTTCTC CATTAATTAGGGTCAACAATTTAGATTCAGCGTTTTCTTGAACATGATTT ACTTGTCATATATTTTATTTAACATGCAATATCACTTATAAATTCATTGT GGTGTGTTTATGTTTAATCTATTTTTAGTTTATTTGTGTTTATTAATGAG TAACTTAATTTGAACAGAAATATCATTTAACTATAAAACCTTTTTTTTTT GGAGAAATTAAATTAAAAAGATGTCTTCATATCTGTTTCTAAACTTTTTG AAACTAAAGTTTCTTAAAAATAAGTTAAATACTTTCAAATCTGTACAACA TTCAACAACTTCTCAATGTATAACACTTGTTTCAAAAAGTTATATTTGAT TGTATTTTGATGGCCTTTATTTCACAAAAATATATAGAAACATACATAAC ATCATGAAAAAATAAAATTAAGGGGGAATACGAAAATCATATATAAACAA TCTAGGTTAAAATTTTCCTCCTCAATTAAAGCCCACCATCCTATTTGTAT TCATTGGAAACATAAAATACCAAAATATAATTTCCATAAAAAATATATTG ACAAACATTGATATAGCTTAAACAAATACGTATTGATTAAAATTACTTTC TAAAATCTAAAATTTCTAAGGGACATATACAACTTTTAAAAAAAAGAACC AAAGCACGATGTTCCTCTCATTTTTTACTTTTCCGGAGTCTGTCTATTAT AGTTTTTATTTTATGATGATATCTAACAGACCAAGAAGGAAAATATCGAG CCAAATATGAGGCGAAGTCCCAAATCCAAGGAATTTTCTCTAGGAATGCT TAAGGAAAAAATGGCATATCTTGCTGCAGATGCAATAATTATCTTCCTAA TTTCCCCTAACCGTAGTTCATTGCTGGATGTAATTCGATTTGTTATAAGA GCTTTAGAACTTATTAATGCATAATTTACCGCACAAATTTCCAGACTGGA ATTTTTTTTATAGGAATCCCAATCAAAATATGGGCGTCCATATGGTTTGA AGGCAAACCTTCCAAGCCCAACAACATAGCATTATACCTTTATAAATACA GCAGCTCCTACATTCCTAGACACCCCAGGAAAGCACATAGGACTGAATTG TAGATATTCTCGCAATCCTTTTGTTTTTCTTTATGCTATTATAGAAAGTA CAACTACATAAAGTACTTACACCGAATAATGKCTTTCKCCTATCTGCCAT AAGGCCACTTATTTAGCCAGAAGTACAGTTATTGTAATTCAAATATGGAA CCATACTTACTTTCTCAGTCTAAGACTTTTATAATTAACAATATTTATCT AATATGATACAAGTTAGTACTTATATTAGAAAAGGGTTGTGCCTATTTTG TTTTTTTGAAATGGGGTAGACACTCATAATTGAGCTTCCGACTAGGGTAT AACCGGAAATATAGCCTTGTATACATGCAAGTAAATTGCAATAACATATA CCTATATCATAATTTACAAAAAACCTGATCCAAGTATATAGTAATGAATT AATGGAAAGAAGTATTGAACCTAATATACTGATGAGTGATGAGGCCCCAG GATGTGATTATTTGGATAAAGAGAATTGAGCATAAATACTATAAAAAAAT TGTTAGTATGAGCAAGATATGAATGCTCTTATTAATTAGTCCTCTCTATT TTGAACATTTATAACGTATCAGGGAGTGAGTAGCATAGTATTGTATAGTC ATCTCTGTCAGTAAGTATGTCGTCGATCATACCTATCATATTTTTTATGA CATTCCCTCAGTTGTGGGTAATATGCTATCTGCAGAACATCAATTTTCAA TCACCCTCTCCTGTGTAACTGCGTGAAATGAACGTCCAGCGTTTGTTAAC ATCAGCTTTGATGCTGTCCATATTTGAATAATAATGGTAGCATTGAGCTT TACTTACTACCAAATAGAATAATCCAATGGATTGAGATCAGTGACTTGGA GAAGCTTAATGCCTAAAGCCAAAAGATTATTTTTTCTGTCACGCAATTTT GCACAATTCTTGCTTTTTTCTCATTTAGATTTTATGAAACAAAATGTAAG CTTTATATTATAACAGGTCTTAAATAATTAAATCAAAGAAACAAAGAGGA ACAAAGGAAATAAGAAGAACATATAAAAAAACTTTAATTACCACCAAACC TTTAATTACATTACGAGTTTTGTATTTCACAAATCGTTCATAAGTTTTCA ATGTTTTAAGGGAGAGAAAATTGAGATTTAGTTTGTAAATGTCTTTTAGA AAATTACATTATAATATATCATAAAAATGATAAATTGTCGTTGAATTGTA TTAAAAAGTCATTAATTTTTTCCAAATTAAAAAAGTTAATCTAAGATGGC AAGAGATAATGGTTCTATTATGATTCTAGAATTGAATAATGCATATTAAA AAAGTTAAAAAAGACAGTTCTTAATATTAGTTATCATAATATAAACTGTG CCTGGACCAAGGGCTTTGACTAAAATTTGCCAATTTTTAATAGAATGTTA AAAATATGGGATTTATTTTTTTAATTACTAGGCGTGTCATTGGAAACTAT ACATTTTGAATGTGGAATTTTAATTAGTTGTATTACAGCAGCTACATTTT GTATACTTTGTTCAGATGTTTGCATATGTGATGCCATTTCTAATCTTCAA TGGAACTTCCATCGACTTTGATCATGACCTTGATTAACTGCTCGAAGCCT TGGCAGGTGGTAAAACTTTAATTTGGGCTGATGGAGTTGAAATGCTCATC AACAGAAGCTTTGTGAGTCTTTAATTTTGGTGTACTTGTCCGGCAAGACC AATGCCCTCGACGTGCGATTAGAAAGTAAAGTCGAGCAGCATGACATCTA AGGAGTATGGGCAAAACATTGTTTTTCGCCTTAATGAAATGTTGCTTTCC AGAAAGGATCGTTTTACCCTTTGTATGCCGGTGAGCTAGTTTCCATGTCA ATACCCTTTAAGCCTTTATGACTTTGTAAATAGTATGTCTGCTTCTCTAA GTCAAGTTTTGATCTTTGTTCATCGCGAAATAGATCATTAATATCGATTC CTTTGTATTTTTGTAAGGCCATTTTTTGATAGATTGTATTATAAATTGGG GGGGGGGGTGTCAATAAATACAGATTGGCAGCTGATGATAGAAATTATAA TTTTCTTATTCCTCTATTTTTATAAATATAATTTATTCAATTTCGAGCCG GTTGTAAAAAAATATTTTATCAATAAACTTCTCATATTAAAATCATACTG GTTTTTTTGTACAAAATATCCAGAATTACATGGATGTAATTTTTAGTGGA TCACCAAAACACAAAAAATACAAAAATACTTCCTTGTTTATAGCTTCATT TTTATGTCCATTGGACCTGTTCAAATTTTAAATTTTTTTTCAACCCCTTT AATTTTTGAATTTTTCCCGTTCTTCAAGGTATATAGAAACTAAACTTACC AGTCATTTGGATTTTGGAGCGCGGCTAAGCTTTCCGCATGGGCCTTGAAT TTTTTATTTTTTTTCGTATTTCCACTGACTCATCCTAATTACGTATCTCG CCTACCGCTCCGAACTTCTTGTCCCGATGACATATCTCAGTTGTTCACTA GTATTCATATAAAGTAGAGCAACCAAAATAATACTGTTTATTAATTTGCT TGATGCGTGGCATTTATAAAGAAAATTACTGACAGAGTACCCAATGAATT AATTTGTCAAGTCTAAAACAAAGAAAAAATTCAGTGTTCAGATTGCACTC AAGGTTACTTCGATGTATTTATTTGGATAGTATGTAGATAAGTACGCGGA TCATAAAACAAAGAAAAGTACTTTGAAGATATCATTTATGTGTATGTTAC AAACAATTTATTCATGGGCACAAATAAAGAGGTAATAACATATTTATATA AATTGAAGCACAGTTTTTTGGCTTTGATTTGTGTTTTATTCTATTTTTGT ATACATATACGCCAAGATAATAATAACGTAGAAGAACACCTAAATAGACA GGGTAAAAAAATAAAAAACAAACATCCCTAAATATCTGGGGTAAAATTTA CTCATGGAAAGAGATAAAAGAAATTGAAGCACAGTTTATTGGATTGGATT TTATACCTATATCAATGCTATACGGTAAGCCATTACGAAGCTAAAGTAAA AAGAATACAAAAAAGTCCATTTTCTTTCGCCCTTTCTTAGAGCCACCGAC AATAAATTTTCAAGGCCCATGCGGCAGGCATAGCCGCGCTCCAAAATCCA AATGACTGGTAAATTTAGTTACCATATACCTTGGAGAACGGGAAAAAAGT CAAATATTAAAGGGTTTGACAAAAAAAATAAAAGTTGAACAGGTCTAATG TACATTCATACTACTTTGTACTTCATAGGCATATTTGAGTCAAGTAAAGG CGTTGAATGTATTAATATACTCTAAGAATTTTAGGAGCAGCTTAAAACCT TTATTTGATGTAAGACACTTATAGTGGCCCCCTTATGGCTCATTAAAATT TAAAAGAAATAMCAATTTTAATTATTTTATAGAAACAATCAATTTTGATT CTTTTGAGTGCAATATGCAGTGCTTGATAAAACAAATTGACGATAATTCG TCAAAAATACAAATATAGTCCCCATTCAACTTGGAAAATAAAAATCAGTC TATCTTGTTTAAATGCTCAACCCTCATGCTCATTTTTGTAAATGTGATTT TTTAATATTGACACACTCTTTATTTCTTTTATTAAATAATTTTCAGTCTT TTAACAAATATCCTTCTTTTTTTTRYGAYAAATTAATAATTTTTTAAAGC TATTTTTTCTTTGTAATCCCTCTTTAGTCACGTTTCTAATTTTACTTGCA ATTGAACAAAAACATGAAGATACCATATTTTACCAACTCGAAAATTAGTA AGACATTTTTTTCAAATCTGATAACAACGCTTCTATTACATATATTNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNCTTACAAACCAACATTTGAATGCAATG ATTTTGAAAATAAAAATATATTATAGATAGATACAATATATTATATCAAT GTCTTCAATACTGTCATCAATGTGTAGGAGMGGTACGCACATATATAAAA AAGAATCAGCTGCATGCATAACTACTTTCCCTTTTCTTTTGTGTTTGGGA TAAGAAATACGGTGCTGGGGGTTTCAATACATACAGTTTACATGGGACAA ATGGAAATCATTTTTCTCTTTGGTTTCCTTTTCTATTTCTCCCTCTTTCT TAATATGTCGATTTTCCTTTCTTTTCCCACTCCAACTAAGATGAGGGACA AAGAAAGAAAGGATGTCTTTCTTTTTATCAAAAAATAAAAATAAAATATG CAAAACCATCATGTGCTACGGGAAGAGAAAAGCTAATATATTTAGAAGAT TAACGTATCCAGTCTATAGTAGTTTCAAGTTCTTAAAAGCATACAATTGT AAATTATTATTCAGCTTCAATAAATCTGTTTTATAAGATGGGGTTTTTTT CTATTTTTTTCGAATTTCGATTACGGCTGGTCTGTAAAAGTTGTYATGTG ACCAAATTTCATTKTCCTAAGATATTATCTTTAGGTACCAAATCTAGTTT AAATTTTGAAAGGATACAAATATAATTTATTTTTACTATGAAGGACATTG ATCCATCCTATAAAAAACAATAAATATTTTTTTTGTAAACTTCAGTATGG TACAAAAAAAAAAGAATAACATAAGATTTTTTTGATTTTTGCTTTCCGAA AATTTAAAAATAAAAATGCTTTCTATATGCGGATTATGAAATTTTTACAG TTTTCTTTCTTAACACTTTTATAGGAAAAAAAATTATGTGAAATTTATTT AATGCAAAATAACTCTAAGTGCCTTCTTAGTATCTATAAGTAAAAAGTTT TTGCCTTTTTACAAAGTTTTGATCCAAATGTGTTACCTAAAGATGACCTT TTTGCCAAATGCAATAATGCATAAGTATTTTTCATACCAAATGAAAACTT TCCATCACTACCCGTAATCGAAATTCGAAAAAAATGAAATCAAACCTCTC TAATATTAAAGCCTCCGCCAATAAACTGAGATATCATACAATCTGAGAAT TGAGTTTACATTTCAGCCGCAAAACTTTTCAGTATTCTGCTATAACATAA AATCTTATCATATGCAATTTAAAATTTATCTTTATAGTCTTAAGGATTTA TTCACATAATTAGCAATTTTGATAAAGATCTAGTGTCTTTAATGGACTGA TTTGCTAAATAGTCGTTAATTTGGTTTTTCTTTCTAATTTATTGATTTTT ACTTCTTCTTTTAATGCGACAACTGACGGGTACAATCGTCGTTAGAGTAA TGTAATATTGCAGATATTTTTTATGTAGTACATGCAACCTGATCAAGAAA TGCAGAGAACTCATTAGGTAATGAATATTTCATAGAAATGTTTAACAAAA ATAAATGTGGACTGAAGCCACCAATTAGAGTATTTATAAACAACAAATTT CTTCAGTTTTCCTTCTTTGATACTATGTTTGAACAGTTCCTTGAGTTGGT AATAAAATTTGATGATCAAGAAAGCGAATTTTGATCAAGTATATAATTTT CGACATCAATAGAGATTCGTTGAAAATTTGAACTAATATCCAAGTCTTTA ACCGAGTCTAGCAGATTTTGTGTTCGTGTAACCTCTCCCAAACAAATAAT ATTTTAAATCGCAGAACCTCTTCATTCCGAAAAGGATAACTGTTTAAAGT TTTGAAACTTATAACATGATAATTTCTTCAAAATAAATTACTTGCACACG CATAATAGATGTGGTAAGCCACTTAAACTCTTTTACAATGACCGACAAAT AACTTATTCTTTATTCAATTATAAAAATGAAGATATTAACATATCCACAA ACGATTTTTGTTTTTTCGAATATCTAACAAAATAAAGTATCGTTAGCTGT AGTTATAAATTGCAGACAAATTAAATAATTGAGCAATATTTAATAAATTA TCTTCAAAGAATTGTAACTATGAATGTTTGTAAGTTTTATTATTGAAAGT TATTGACATTACTTCAATCTAAGTGCATATATATTTTTATAATAATGCAC TGTACTCAAAATGAAATATGGCCTAGTAAAAATATAGCTTGCTCCATCAC GAATATTTTTCGGCAAATAATATGAACAATTGATTCAAATTAATTCTTTG AAGGGACTGCAAATTGCACTTAAGGAAACTCAAGGTCAACATTAAACTTT TGAATTGTATTTTCATAGATGTTAATTGAGATTGGTCATTTTGGGCTAAA CGAAGTCTCATATAAAAAGCTCTGATCGGGGTGACCAATAAGTCTTAAGA CAGCGACTTCAACAAATTATATATGCTAGACTTGTGTATATTTTTTTAAT TATGTTGTTCCTTATAATTTATGGAACCTCTATCTTTGTTTTTTGTAAAA CAAATGTAGCTCTAAAATGTGTTTTTGAGCCTCTAACGACGATATTATAA ACTGATGCTTACAATTATTTCGGTTCATTTGGAAGAAGAGACCTGCAGAG TCATTACCATGGACCTCAATGACAGCAATGTGTCTAAGTAATCGGTCCGC TACACAATCAAAAGATAAAGTGGGACAAGGAGACCGAGAGTCTCGATAAC AGGCACAAAAATGGTCGCCAAGATCCATGAACAACCTCAGGTTGATCGAG GCAATGAGGTCGAAGATCAACCGCTAAAAGAAGTCATCAATGAGAATGTA TGAAGCTGGTTTGTTTCGATAAACCAAGTGTACTGTTGTAAAGAGGTTCT GAGGATGAAGTAGTATCGTCAACAAAAGGTGCAGCTTTTTAGCGAGGCTG CAATGGGCAAGAGACTGACCCTGGCGAAGCTGCTTCTGAAATTCCTTAAA TCTTATACACACGTTTCAATCATTTGAAATGACGAGAAGATCTTCACCGT CCAGCTGGCTCACAATAGTCACAACAGCTGGGTGCTGGTAAGAGAATCGG TGACATTCCCATTTACAAGGGCAGCATGATTGTGCCACTCAAATAATGCA GGATAAACTCATTTTGAAAATCCTATTGCTCATTTGGGCTTTCATTTTAT TAATTTGTTCCTTAAAATTATTTTATTCCCTTTTTGGTGAAAACTAATCT TCTGTAAGAGCGAAAGAACGATATTTTTTGCTTTCCTAAAATTTCATCAT TTTGAAAATCAATACGTGTATTCCTGCTCATAAATCTTGAGCCTTTCTCC AAGTTCCACTCAATTGAGGTATGCAAATGATTTGTCCTTGCGTTTCTCAA TTCATATTTCTGATATGAATTGATACAAAGCTATAGCTGAGTATTAAGTA TGTCTATCACATTACTCATTTTCTTGGTTTTGTTTAAGATTGTGTTGATG TTAACTCACTCCATGTCTACATAGGTGCGAAATAACAAAATATTTGAACT ACATAAATGTTATAAACATCATCACAAAATATAATATCATGCTTATTTTT GATCTATGTACAAAGCATGATCCTTCATTAAAAACATAATAATGTTTTTT TTTATTTTATGTTTTTTTCCTTTAAAATAGAGTTCACCTTTGAATAAGGA AAATAAATAAAAAAAAGTATATCCTCATTTTATCAACTTTTTTCCGATTC CATGTACACAATATTTAACGGATATACTTAAACATTCTACAAAGTGCATG AAAATAATTATGAACAAGGTTTTTTTTTTCTGGAAACTAAAATAGTAAAC TATCTAGAGTTGTATAAAAGATAACTAACCGGTATAAATTTAAAAAAAAC GATAAATGACAGGTTAACCCTGGCAAATGGAATACAATTTTCCAGGAAAT CAACTTAGACGTCATTATGTTTGATTAAATTAACTGCAAGCTGTCGTGAT TGGAAGAAATAACCACATATTCCACTCCATATCTAGCATTAAAAAAATAG ACCCCAACGTAGATCGTCCATTCTCCTATAATTTTGTCCGTCATTTAAAA GGACTTGAATTTACTTTATATATCTTTAAATGCCTTTTTTTGTGCAAATG GAGTTACACTTATTGCCAAACTTTATTTTATTACAATTACTCCATCTGAC CAATGAATGATTTTTGAAGTCTATAAACCTACGTACATAATTTAGATCTA TTTCTTTAGGAGCAACTATGAATTGTACTTATGTACATATCTCCTGAATG TGTTGTCCATTGACCTACGTCGCCTTTATTCTTATACATTATCTCTTCAT AAATTTAAAAAATAGTATGATAAGAGCTCTAGAAAAGACTATTTTTGCCA ACAAAAAAGGATATGTTGCACGCATTCTATTTCATATAACTCTGAAAAAT TAAAATCAAAAATTATGCTTATTATAGTACTAAACGGTACAATAATATTC TTCCATGGATTATAAGAAAATGAAAGACAGTATGTATGGTAGTAAAATGG TGTTTTCTTGCACACTGAAGTAAAAACTCAAAAATTATATTAGCCTTATT TGGACCAGTGTCCTTTTAGAAGTACGCCAAAAAATCATTCACATAATTCA TATTTATAGTCTAACTTTTATTAATCTTTGCATACTTTCTCAAAAGATAA TATAGCACAATTAAGAATATAATTTGGTATATTAATATAGCATAAAGTTC AAATTAGAAGAAAAACTCAAAAGACTATTCTCATTTCTAAATTCAACTCC AGTGAAAAATGAAAAAAAAAAATACTGGTCAATATAGGGTTAGGGCAATT TGGCTAATTTCCTATCACCTTCATCCCCATATCTCAACTACTTGAACTAT TGGGATGGAGCATATCACATAATAATGTATACCACGCACTTTTTAACAGC ACAATCAAACTTTCAGATGTTTTTGACCTTATAAAAATATGGAATTCATC AATACTGACATTGTCAAGCAATAAATCATTTTTTTTGTAGATGCAATCAT TAAATTATAATAAAACAAAGTTGAAACTTTGATGAAGTATAGTGAAAAAC ATAATCATGGTGCAACAGGGAAATTTTCTGCATTAAAGAAGCAAACTCAA AACCTTAATAACTTTTTATTAGAAAAAATTATGAAGAATGTTAATGAAAA TACTTTTAGCAATCAGTATTGACAAGAATTATTCAATATAGCCGTTTCTA GCCTCTATCACAGCCTCCACACAAGATTGAAACTTGGCGCAGGTTGCCAC AATACAATCGGCCGACATGTTGGCACATTGCCTCTTGATGCTGTACTTAA GATCTTGCACAGTTATGAGCGATGTCTTCCCAACTTTGCGCTCTAAGACG CAGCACATACCGAAGTCGAAAAGTTATGGCTGAGGKCATCATGAACTGCC CTCCTTATGGTGATCTCGTCTACTTGAACTCGTTAGCCAAGCAGGTTATT GATACTGGGTCCTGTGATAACATTAATTAAGTAAATTTGTTTTGATTAAT TTTTCCATTTCCCATAAAACACGTACAATTTGAAATTAAAATTTTTGAAC ATAAAGATTGTCGAACTAATTTATGCCAAATGAATAAGATTATGTATTTT AAAATTTAAGACATAATTTATGCAAGTCCACAAAATTTTATTTTTTTAAG AATTATATAATCAAATATTTGTAGCAATTGATGCACTGATCGCGAATCTG TATCTAATTTTTTCCCCATCATATCTGGTTTTCAGGAATGTTGTATTTGT TATTTTTTAGTAGTGTAACCCTTTTTATAGGTTTGAGATAACTTTTTATG ATAATTCATAACATTTGGTCCAAAAAGAGAGAGAAATATTAACTGAAATT GTATTTTAGTTGACAAATTATTTCCAAATATGGTATTATTCTTTATTTCA TATATATTAGGAAATTTTCCACATTATAAAAATGCCTACATTGAGTTTTG ATCCTTAATACGGACATGAAGTGTAGAAAATTGATAGCTGATGAAAAAAC ATACAGATAAGGAATCTAAAACTTGCAGAAGCATGACTAAATTACGAAAA ACGTGATTTTTATGGATCAAGAAATGACAACTCAAAATCAATTTGTGATA TTTTAAATTCATTGTGTATTGCTTAACAAGAAATAACAGCTGCAACACGC CCTTCCTACAGATTGACTGCTCTTTACAATGAAGGCTGTACCATCATTAT GTCAGGCAAAACGAATCCAAATTTGGAGTTGATATGTGACCTAAACAAGT CATCAAAAACTGCAAAGTCCATGATGTTGAGTTCAGGAGGACTATGTGAG GGTCATTTGGAGTGAGGAAAAAAGTCCTCAATATTGCTGCTGTCGAAGTT TTGGTTGTTTTTGTCTGTATGGGCTGCAATAGACTTTTTGATGTTATAGG CAATATGGCAGGRGATACCAACGGKCTATGCAGCTTTCTGATCATCAACA CTAGCGCAAAGAGGATTGCACAATCGTGGAAATTTTTAATGTCACTCTTA TATTTTTAGACATGGGATAAAAATAAAACTTTTTTCTGTTTAACCTGTCG TTTGGTTCGGTTAATTTGACCTTGTGATTAAAAATAATGGGTAAAAGATC GTAATTGAAATCTACTTCAAATTTTGGGTCCAAACTATGTAGAGGGTATG AAATTAACAATGTACAAACATGCAGGCTAGAGCTTTAAATCCTGATTTTA TTGTTTAAGTCACCTCGAAACATTTGACCAAAATAGAAAATGTACTTTTT TTAAAGAAAATCCATGTTAGTAGTGACGTCTGATTTCAAAGTTTAGCTGT AGTTTAGGGACAAACTTTTCTCGCTATTTGAAGTAAAGCTTCAAAAATAT CGAGTATGAAGGTAGTGGAGTTCAGAGATTCCACTTTATTTGATTCCAGT TGTTTTATAAATCTGATGTGTCAAAATAAAATCAGGGTGGTGTAAAAAAT AATAAATTCAGAAAAAATGATTTTTCTGTTTCTAAATACTTAACTTTATA AAAAAGGATTTAATGATTTTTAAAACACATAATGGACCCTTATATCCAAA AAATATTATCAATTGGTACTTTTTGATTATAAATAAGGCTTTGAGGTTTT TAAGATACTTATCATTTATAAAAAAAATACCTTTGAAGTTGCACTTTTTT AATTAAAAATAATCTGTGTACTTTTGTCTTTTAAAAGTTAAAACTGCGGG TTTCATCCAACAAATTGCAAATAATTGTTAATACTATTTTAAAAGCAGAA CTAAAAACATAATTTTAATTTATTGATTGCTTTGCAGAAAATTTATGTTG TGCATTCTTTTATGTTGATACGTAACATAAAATATATTTTTATAAATAAA CCGAAATAATTATTTTTGGGAATGCAGCTTTTTAAAAATCAAAATTTATT TAAGATGGCTCTTTAACCTAAAATTTTAACCACCCTTGCTCTAATTATTA TTTATTAAAATACTTGCAATTTTATTTACTTTCTTAACCTTATCTTAAAT TCAGAAACTTGCATTCCATTTCACCTCACATATTTCATTACATTTCAAAT TTAAATTTAGTGACACATTTAATGCAAATGCAAATAATGCTGCTTCACGT GTATGTTTTGTAAGCAGTAAATAATAATACGCATAGTATTTCCTTGAATT GGTATAAGGGATAGCTGGTGGTGAATTATATGCAGTAAAAGGATGTGCAT GTATTAAAAATTCGGTCTATTGTATTCAAACACTTTCTAAATTAAATGCT CAAGAAATTGAGATAATATAGTTATTGTCAAAGAAAGAGAGAGAAATTAG TTCTATATACTTAAATATATGTTTCCAACAAATGTTGAATTACAATTTCC CCATATATTTTAACATTATACATAATATGGTATTTGATAAAAAAAAATAT TCTCTAACAATCCTTATAGCAAATATATTATGTTTTTACGACCTATATTT TATTTCTAATGGAGGTGTTTTTAAAATATATGTTGGTGTTAATTAGTTTT TTTTACTTTAATTACCAAAATGTTTTTTTTTTAAATAAGCATTATACGTG AAAAGCAGTACTTATTACAAAATTATCCAACAAAAATGTCATAGATAATT AAACAAAAATTACATTTCAACTCATACAAATGTTTAAAATAGAACAATTT AAAAAATTATATCAAAATACATAAAGTTTTTTTTATACAAATTAAAAAAA AATCCCGAATCTTGTTTTAGAGTCCCAGTTAAAAACTAAGATATCCAGTC TACTGCAATGTCTTTTAACGATTGATGCAATACTGTCCAATATCTGAACT TTTGCAATATTTTTGGCGACCTATTTATAGTTGAGGTCATTGGTCCAAGT AGAAAAGATAACAGAGTCGGTAAGTAGATGAATACCTTGCTATCCTTCCA TTTGTTCCATACTATAGACTAAAATCGAGAATAAAATTTTGATGTGACGA TTATTAAACCCGATTTATGTTTTTCCATTTTTGTCCACCGCGGGGTTAAC TACTTCAAAAATATTCATTTTGATGTTAAATGAAGAAAAAAAACTTTTAT TATATTATATTGATCAATATTTAGACCAATCTCCGTTTGTCAACCGAGAT ATTTTACCAAATGGTCAATTAAAATCTAAACACTTTCAATTTAAAACTTC GAGAAGTAATAATGAATTAATTAAAAATATAACTGTTACAAAATTAAAAA CACTTAATCATTAATTTAGCCCTCCTAAGCGGTAATTAGGGCTTCCCAGC GGTGGCAAAAGATCTGGTACCCACAGCGGATGTAGTCCTGTGKCATATCT TCGCAGTGCTGGCTGACAGTGATATTGAGGTCATCGGTGTTTGGATAACG AACACTTCAGGCATTCCCTTCAACGTGCATCCAAAAGGTGTAGTCAAGGT AGTTGGCTCAAGGGTTGTAGGAGGGGAAGGGAAAAAGTGTCAAAAAAGAG TTCAAAAGAACAACTCATAGAACAAATTCAAAAAGGTATTGGAACTGAAG AGATGGCTTCTTTCGTTGCTGGTGTTAAAAGTGGTCTTTCCCCCCTCACT AGACTCATTCCAACCACTTTTTGAATGCTCACTGTGGACAGTTTGGTGTG AAATCACGGGTTATCTTTCATAATCACTTATGCACTTGAGGGGATAGGCC TGGGTTGTTGTCCTTAACTCCTCTGGGTCTAGTTTGACCTTATTGGCACG CTAACAATGTAGTCGGTGGTCTTGGAGACACTCAACTTCTTGGAGTATAG GAATGGAAATTCGTCAATCACAATTAAGTGTATTTTTTTCAACTTCTATT TAAGCAAGAGAGCTCTGGTTTGTTTGGTTTTCTAACTAATTGTTTATTTT TAATATTTCGAAATATGAATTAATTTCTAGTAATCAACCTTTATTAATTA TTGAATTAGTAAGTATTTAGATTTCAATGAGCCAACCGGTACAGCCTGAG ATTTATAATAATGATTCTTATTCCTTTGAATCTATATTTTTCAATATACT TTTAAGTCATAAAATATAATAAATTCAATTCTTTATTGATCTTTATATTT TTTCAAGATTTATTTTGGGATTTAGCAACTTTTAAATAAGATTTAGTCAA TTTAATTTACTACAGTGTTGTAAAATTATTTCCCTGTTTTGTCTGTAAAT TTTTTGTCTCTTTTTTTTTAAATTAAATTATTGAAGATATTTTTTTTAAA TCTGACATGCAACCTTATCAAAAAGCTTTTATTCAAAATTCGGATAAAAT AATAAATATTTCATTGAAATGTATATCAAAAATAATAATTTAATGTTAAA ACCCCGAACTCATCTTCTTAAGATCATAATAAAATAATATTATTTTTTTT TTGTGTGTCTTTTATTCCTAAGTACTTTAGCGTTTTAACCAATAGAAAAT GTATGGTATAATTTAAAAATGATAGAAAATTTATTTGATGTAGCTGTTAT TACCTTTCTACTGTTACTTATGTATTTAAACTCTCTTTAATTTACAATTT TCTTTTTTTACTCCAGTCACTAACTGGCTAATGAAAAAGTTATTGATTAA CAGAAAGTTAAAGTTTTAAATTTCAAGTTTAAGAAAATGTATAAATTTTT ATTTATTGATATCTTTTTAGCAAACATAAATGATTATGTCAAACTAAAAC AAAAATTTTCATTCTGAAATCAATTAATTAATAACAACATAGTAAATCAA ATGTTTACTAAAAATGTATAACTTAAAAACACTCTGTATTTTTTAACTTC AAAAAAAGTTTCGATTTTAGATTATACAAACAAGGCACAAAAGTGGGTAG AAGATGAGAAAGATTTGAAAAGTTTGAGGGATTATTTACTCTACAAAAAT TGAAAAAAATATTAAATATTTGACTTCAATAGAGATATAATAATCTACTC CTTTTGTTTGGCAAGGTGAGTAAATGATAAATAATATTGTTTAAATAGTT TACAACCAGTGTACTTATAATTAATGGCAGGGCAAATCTTTTGCCTATAG TAATTGCAAATATGAACTATTCTCCTATTTTGTATAGTTGTATGGTAATG CTGAAAACAATGGTGTCATCAGTTTATTTTTTGGATACAGGGGACTAAGC CTCCCAAATTTTTGAAAATGTTTTTTTTCATTTGAAACATTAATAATAGG TTGGACAAAAATTAATTTTTTATAATCATCTCGTTTAGACCAAGTATGCT TATCTCTGTTCGATAACTTGTGCCATCTTTATAATGGACTTGACCCTAAT TGCAAAAAACTTGGACCAATTTGCAAACCAATTTTTGCAGGCGTCTTTAC GGGCCAAATTCGTATCCCTATAGGCGTTGGCTATATTCAATAACAGGTAG AAGTCACTTTTTGCTATTATTGACTGTAGGGTTGATGCATAAACAATTTT GATCCGAGCTCCTGGAGCTTATGGCACATCATCAAAGATGTGTGCAGCCT GGCATTATGTCGATGACGTCTTGTTGTCTCCTATTCACCAATGCTGGCCA CTTCTAACGGTTGGTATATCCAATGTAGAGGTCAGAGTTGGGAGGGAAAA AATAACTGCTGGAACCACTGTTGTGCAGCACAAACCTAAGCCCCCGTATA CATTGCAAATTTTCTTGGTCGCTTTTAACTCGTTTTCCCTTTCAGGTAGT GAAAATATAAAATATAGATAATTAATTTCTTTGATACCTCCATACTTGAA GCACAATAATTCACGACTGAACCGGCTAAGTGCAATACTATACAACAAGC GTTTGTAGAATACCCTCACACCTTTTCAGTATTTCATCATATGATCCGAT TTGGCAAATAATGAAAAAGATTTTCTTTGTTAAAAAAACGCAGGGATAAC AAAATAACTTTTTCACCAAACTGAAATATAGATATTATAAATACTAAATG TGTGAGATAAGTATTTGATGGTATTCTTTCAAAAACACATGGGTTTATGG TCACAGATGCATAGATGAATCAGAACTCTGATACGAAAACAAATCAAGAT ATATATTTATTTCTACTTTGGCCTTTCCTGTGAATAACTCGACTGTTTGA AGCTTGCAATTGAACAAAAGTGGTCAGCGTTGGTGAATAGGAGACAACTC GATCTCATTAAGATAACACCTGATTACACTCTGGAAGCTTGGATGGGAAG TAATTCGTACTTGGCACCATGTACTACTACCTGTTTCTGTCTATGGCCAA CGAGCTCTGAGATATAAATTTTGCCTCAATAGAGGGCTTTAAAAATTGGT TGTCCGAGTTTTTGACAATATGAACAAAGTATTCTAGGACAAGTCAACAT TGAAGTTACATTTTCGTTGGCAACAAGTTATCGAACAGAATAAGACATAC TTGACTTCAATCGAATGGCTGTAATACTTCTTATAAAGCATTAAAATAAG GCCAAAAATACAAAATTACTTTTTCCTAATCTAATATTTCAAAATGTTAA ATTAATACTGTTCCTCTTGTAGCAAAGATAGCTCATCCATGAGATTCATT ATACTTCATGGTTGTTTTGCAACAACTAATTTGAATTATTACAGGGTCTA ATGATTTTGATTTTATTTACATTTATGTGATCATTAACTTTATTTTTTTA TTCAAAACTATATTTTATAAAAGCTAACATCATAAACCCCCACCAAAAAT AATTTAAGAATATAAGATTGTAAAAAAGTAATTACTCTAATTTGGATATC TATACGTATACAAAACTATTCCTATGAAATTAGTACAAGGTGTGAGTTTT TTTATATGTACATTAAGGAGCATTAACTAAGTAGATCATTCATTTATTAA CTTTCCAGATATACCTTCATCAAGTACATTTACATTTCTTTCAAAATACA CTCTATGTTTTCAATAAGAGGAAGCTTTATAACTTGGGAATTTGTAATTT TTTTTATTTATTTACAAGGGCAAGTTGATTGATGAAAGTATCTTTTAATA GATATATATTTATCTAAATAAATCTATTTAAGACATTCATCTTATTTTCT GTTGTAAATTTATGTACTTAATTAACGATAAATAATGAATGTGTATACGC ACATTTGAATATAGGTACTGAAATATATATATTACTTCTACTTAAACTGG ACATGAATTGAAATACTGCAAAATAAGACCTTAATGGGAACGCTACGTTT TCATCAAGTTAGTATTCATAGATAGATATTGCTCGTTTGAGTGTGAATTT CAGAAAATATATCGGACAAAAAAAGCTAAATTTCATAATAACATCCATCC TCTGAAACATTTCTTCAAATAGAAAAAAAATTTACATATGCGTGACTCTA AAATTGGTTTCAATGTGTTGATTGATAATTAGAAGCCTACTTGACATTTA TATTTTGTGTGTACATGTATAGTTTGACCAACCTTTACTTTCCCTTTAAA TACTAATGATAATGCTTTCCTGGGTTATGTCAACACCCCAACACAAAAAA TCAGACTATAAGTATGCTTGAACTTTGTAGCTCTTTAATTAAATGACAAA TTTTTTTTTTCAGATATGAATACCGGGCAAATATGAATATAATATTTATT ATGACCGTGGATTGTTTTGTTCTTTTGGTATATCTAATGAAATAAATAAA TATTGCTTAAACTCGATCATATTACTTTTTTAGGGGGAAAAATCATTTTT GATGAGATCATGAGGAATTAAGAAGTAAAACATTATATTTGTAATATATT TAAGTTTTACTTGTGAATATTTACATTAGATCAATTTTTACTCTGGACTC AGTCGTTCCTTTTTTTAAATTGTAACACCCACTTTGTTGTATAAAAATTC CATCAATTAGAGCAAAAATGATGAGTTATAATGAAAAACTCATAGATAAT ATGAGAAACTAAAGATAAATCATAAATTTACGTTGAACGATGACCATTAA AGTTTTTGAAATAGTTCAAAACAAAATGATATATATGAAATATAAGTCGG GTTCAAATACCCCATAAAAATGATAGAGTTTTTAAGAAAACATTATTTAC ATATATATATATTTAAAATTATCTCGTTGTAGCTTTATAAGATACATAGG TCGTTTTATACTGTGAAAATAAGCATTTCAGTTTTTCTAAATTCATGCTG TTGATAGTTCATATTTATTTGATATGATATTRCTGTTTTAATAGTAATCT ATTTTTTTACGTCTATGCATAATGTACATAAATGAAGTTAGTTATCAGCA CAGGAAATTATAGAATTAATTTCACAAATATTCAAAGAGAGTGTATTATA ATTATTTTTTTATTTGAAAAAAATATATAAATATCCTTATTACTTTGTCG TATCTTTTATTATTCAATGGGCCTGGGGTTCATTTTTAAGTATTTGGAGG CTTCTTAAATACTTTGTAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNGTGTAAGTAGTGGTTTTAAACTTCATGGTGTAACTG CTTTTGTAATTTCACTACTTATGGCAGGRGRTAGKTAAAAWMCAACTCGC CYCTTTTYTTWACCCAGAAGNTAGTTTTTCTTATAAATGCTCATTTAATC AAATTTTAGTCCAGCTTTWGTTYTTATKTTSTCGATATAATTTAACAAAT ATTTATACTTCTGATAATAAATTTTATATATTCGATGAATCTAGATGTAG TTTATACTATAGTGTCCAACACACTTCCGGCCCATGTGGTTTGACCTTCA TGCTTTTCCAATTTATATAAAGTTACAACAATATTTCTGGAAATAACTTA TAGTAAAACACAAATTACAGTTAGCGTACTTCATTCTGGAAAAAAGTTGT TCACAAACATATGTGCTTCCAAACAATAACATCATTAGTTTTTCGGGGTT ACCGACCTCTTGATTATAAGGATGAGTCAAAATTGATGGTGGTAGGATTA GGTTATAACGGACTTTTGAGCACGGACACGTCACATTTCCTTACGTGGGA TATTAACGACGCATATTTAATTGAAAGATATCTCAAATTGGTTGTTCCTG TTCTCAAAGAGCATTGGATACATTAGGAAAATCAGTTTGATTATGATTGT GTTTTTATTTTATTTTGTGAGATCAATGCAAAGAAATTTCTTTTATTCCT GTATTAAGTCATGAAGCCTTTGAGCTTGAACGTTTTGGTCTCCTGGATAT GGAAGATCAAAAGATAAACTTCTAAATTAGTGGACGGAGAGTTTTTCTCA CAACTATTTATTTCCTCGTGGCTAGAGGGGKGTCCATAGTGGAGGAACTT AACACTTTTTATTAGAAAAAAGGGTCCCCATATAAACAACATCAGTTCAC TCTAAAAAAAAATAATAACCTGTATAATCGAAATTTTAATGAGAAATGAT AATGTTTAACATTTTTTGGAGAACCAACTGAGGGATTTTTGTACAATGAA GATATTATGATTACTATGATCCTTAATTTATATGTTTCCCCATTTATTGG AATAAGAAAGTTGTATATAATAAGTATATATAATCATATTTGATGAAGGG TACGATGAACATTGCAGTGTATCCACTTTTATTTGTCTTTGAAATACTTT TATGGGACAGCAAAGCAATGTTTCCCATTTATTTAATGATCACTTGCAAG AATTGCCTCCATTATACAGATAATCTATACAAAAAAGATTCCTTAGTTGA CTGAATATTCAATAATAATGACAGTATTAAGAAGAACATTCATCATGCCT AAAATGAAGGGGGGGGGGGGAACAACAAAAAGATTGAATACGCCAAAAAT CATCAAGAATTTGTTTTTTTATTGACTGGTGATTTTTCTGAAGCTAAATG AACTTTGTAAACTCAAAAAAGAAAGACGCATTCCATTTATCTTTATTAAG TTAACCTTTTGCTACTGAGAATGAGGATTTAGAACTCAACAATATATTTA TAAATATGAAGGTTTAGCAAGTACATTAATATCTAATGTTTTGAGTCTTT GTAACCTTGTTCTAAAATATTTTTAATAAAACTATTATGAAAGGCCAAAA TTGTGTGGCATTAGACCATTTCAAAAATATACTTTTTTTAATTTTGATAT GTTTCCGTATTTTTTCTCATACTTTAAGATGTGAAAAGCTTGAAAATAAT TGTTTATGGTTTTAAGTATGTATTTTGCCCTGCCTCATCGGCCTTTATGT TTTTGCAAAATACCATATTTTATGATTTTGCGTATTTTTGGACAAAAAAT ATAAATAAAACATACCACTGAATGCCAAAAAAGACATTTAACTAAAATAT AATAATTTTTAAATAATAGTTTTTTTATGCATTTTATTATATGTATAAGT ATCAAAATTGCCGAGTACAATGACGTTGAAGAGAAGCATCTAGGTACACT GACCCCAGTACTAGAATTCTCAATCAATGTTATTTTCTCTTATTTGTAGC CATTTTTTGCTGAAAAGATATTAAAAATATCAAAAGATATGAGGTATAAT TACCTCAATTTCTTATTTTTAAAAGTAACTTTTCTTATACCAACTGGAAA ATCAGAGTGATATATACCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTATTCTTGCGAAAGTTATAATAAGAATGGATGTTTTCTTCTTTC AAAATTAATTTTCTTTACAGCGACCAAAATAAATTTTTTATCATTATGGC ATTTATTTTTATTTTTGGTGCATTTGATGAAATTATTATATACTTACTTG CTGAAAATCATTCAAAGTTTTAACAATATTATTTTTTGGGCGTAATTTCC AAATATTATGATAATCAACAATTAATTGAATATGCGTATTATTTAATAAA AGTTTTCATCAAAATATTTACTAAATTCAGTGTTATATCCTCCAAAAAAA AAAAAAACTGAAGAAAGAACAATAAAAAATATTCTTGCACACACCAACAA ATATCTTTTTTCGATATTTTGAAAATTGCTTTGGATACTACATCCCAGAT ATTTAAAAATGTACTCTACATTTCATCTTAGAAAGAAATAAAGAAAATTA CTTTCATTTTTCCATGAAAAAACTTAATTTAATTGGTTTTTATATATATT TCTTCGTATGTATAGTTGTAGAATAAACACCCGAGTAACTATTAACGTTT TACTAGTGTACTTCTCTTGTATTGCTACGTTGTATCATATTTAAATATTC AAGATTATTTTTTATATCCTGTAGGATATAAATTTAAATACAAAATGAAA AACTATGTAAATGCTGAGCTTAACTGATTTTTTATACAAATTGAATACGT TACCATATTAAAAAGTTTTAACTTTTTTTCATACTTTTATTTATTTTGGA GGAATAAAATATTGCTTTTTTTTTGTATACCTTTAATATAGTAAAGCCAT CAACAGAATTCTTAACAGAATTTATTAGATTATTGCAATATTGTGCTTTT TAATTTCTTGTAAAATAACATATAATTAAATCGTGAAAATGTTCTTAAAA TGACGTTTAATAAAAATATATATGACTAATTTACATATATAATATTAAAA TAAAATGTTATATATTTAAAAAACAACAACAATAATAATACGTAAGTTAT TATTCATATTTCTGCCTTGAAAGAAACAATTGGTTGCTAGCTCCAGGCTA TGTATCCTGTTGATAGCTTATTATTTAAAAGTATCCAGTTTTAAATAACA CTTAATTATTTACAAATGATTTGAATATAATTTCCATTAAAAAATAGTGA ATATTGTGAATATTTTCGAGCCATCATTTTTAAAAAACTTTCAACGTAGG TTATTGGTGTCAGCAAATCCTGAATTTTTTTGAAAGAGGTCCATCAAAAG TTTTATTGAATATTTAAACAGGTCACAAAACATGATTCTATTTATATGAG CCTAAAACAAAAATCAATCTTCTGTATGTGTCTTTCAATATTAGTCAAAT TTAACTAAAGTTGATCGTGGGAGAAGCACATCAAAGCCAATGGTGGTTAT TTTTTCAGTTTGATATGTCACGTTGCTTTAATGATAGTAAACTAACATAA AACAGTTAATTTTGAATGATATTTGTCTGTCAAATACTTCCAATAAATCC GAAAAAAAAAACCAGAAAAAGGGGGAAATCATTCTTCATCATAACATTGT AAGTGCTCAAACGAAAAGTTCCTTAGCTCTTCAGTACATCAATACAATAC ATTTTTTAATTTTAATACGTGTCCACTTTTTTTTCATTGCTTGAACATAT GAGAAGCTCGAAAATCTTTCTTTTTAGATACCCTCACCCCTTGGCCTCAA AATATTTCCAAAATGCTATTTTTGATTAATTTGAGTAGTTTTTTGACAAA AAGTGTAGTTAAGACACACGATTAAATGCCAAACAGACATTAACAAAAAT AACATTAAATTTGAATAATACCTTATATAAATTTTATTATTTAAGAATTA AGATTGCTCAGTACAATGAAAATAGAGAGGTACATACATCTATTTGCACG GACTGCATTACTAAAAATGTAAACTTGTAACTATCCATATTTTTTAATCT TATTGGATATCCAAATTTTTGGGAAAAAGATAATAAAAAATTCCATAGAT TATACACGTACCTCAATTTATTATTTTATAAGTAAAATTTATACTACCAA TATAAAATAAGAATAATATAATTGTATCTTTTATAACTATTTCATATATT TTCTTAGACTTCTAAAACAGCGTAAAAATCACAAAAAAAGGTATTATTTA TATTATGCATTTATTTATTGAAGACATATTTTATCAAATTTTCAAATCGT TGCCTATTATATTTTACGCCTTGAAGTAAATACTCTCTCTGCTTCGGATT TTTAGTTATTTAGTTCCCATAGTCAATCATCATTTTTATTCATCTCTCTG TAATACCTGACTATTATGTATAATTTGTCTTTTGTTTCACGTAGTCTTAA TCTCTTGACCATGATTCAATAGGTTCTTAACTCCTATTTGATCCTATATT TAGTATAGCTAAAGAAAAAGATGTAATTCTGGACCAATAAGATTAATTTT TTGATAGTTTTTTCACTTATAATCTGAACTATAGGTTTGCCTAATCTAAA ATTATCAGGCTTTTGAGTAGAATATAATATTAGGACTATATTCCTACTTT GATCATCATCTAAAGTATTGCTGAATAGAGGGACCATTACCAACTCCTGT GCCATACACAACATGTGGTTATGAAGCTTTTTCATGACTATCTCTGCTAG ATGACTTTCTTTCTTCTTCTTTTTTTTTGTACACAAACATGTCTTGGTAA AATTTCAAGTCATTGACAGGAGCATCCGCTGCAAATCCTTAAGTAGTTTT TTTTGGTTTGTAAAACAAACTAAGGAATTTCTTCTTCCTATCCAGCTTTT TCATTGAATCTTTATCATATTTCATTTCCTCAATTAATAAAACTATCGTT TGGGAATATATATTCCTGGGCATCCATCTTGTTTGATGAATTGATCCTGG TTTCTTCCAGTGGTTACATAAAGGAGAAGTGAAATCACAGTGATTTCTAC CATATTTTGATAATTAACTCATAGAGATGTGTAGGATTTCTAAATTTTAT CGATTTTCTTTAAGTAATTTGTCTTTTTTTTGCCATTATCCTTTAATAGT GAAGCTTTTTGGTTGTTCTGTATTCAGTTACCCCATTTGGGATTGAAGTG TTTGAACCATAGATTTTCTGCAGACATAACTTTACTTGTCAACTTTCCCC CAAACTTTGTCTACAACTTAATTTMGTATATGCATACATGCAAGATATAA TAGCTTTTGTCTAATTTATTTTTATATAAGCTAAACGACTATAATATGAA TTCCGCTATTACTGGAGGTGGTGTCAAAACACCAGAGCAGTTATCATATC CGTAAATTTTCACGTCTCGAAGAGATCTATTGATTAACCGGCTTAGCATT CTCCTGTTGAGCTGCAAATCACCAGAGTTCAAAACAGTTTTCTTTCAGAA TATCCGTGTTGGATTACCATTTTGGTATGTTAGTGTAGTGCAGCATATGG AGGAGGATCTCTAAAGAATCCCCACATGTATGTTTCATTAAATTCATGTC TAGAAATCATCATGTTTTGACGAGTAGTTGATGTAGTTACAAAGAAATTA TATAAGTCTGCCCAAGTACAAACAACACATGTTAATGTATTGTCAGCTAG TCCTAAACGATCAATGGTATTGCATTATATATCACATTCTATAATTTTTT GAGAGAAAGTCATATGCAGTCTCAACCAAGAACCCTATTTACCAAGTCAT TTCAAGAGTCTTAATTCTTAAATAATAACAAACAAGTATGTAGCTAAACT AGGTTATTATTAACTTAGTCCAATAACTATCTGTCTAAATTTTACGTTTT GAATAATAGAAGTCTAAGAAAATATAAAAGTTAAATCATTCTGATTTTCA TATTATTGAAATGTAATAAGTGTAGGGGGCTGTGGGGGACCATTATTATC AAAATGGTGTTCGAAATAACTCAAAAGACTCATTCAAAAGATTCATGCAA GGAAGAAATGGGCTTCGTTCATATATGGCGTCGAAAGTGGCCTCTTCACG CACAGAAAGCTATTTTCACCTATTTTTTTAATTCGCTCTCTGGACAATCT ACCATGAAATCCAGACATCTCTTGCATGGGACATCATGGACTTAAGAAGA TTATCCTGAGCTGTTTTCTTTAACTCATCCCAGTCCAAATCTTTTTTCCT CGGCAACGTTTTGGACTTGCTGACGGTGTAGACGGTGATCTAAACTCCTT GAAGTACGTGATTGGAAATATTTTTATAAAGTTCAAGTCTCACTTTCTTG ACTATTACGTATGCTAAAGAACTCAGATTTGTTTTGTTTTTCCAACTAAT TCTTGTTCCTTTAATATATTGAAATAGGACTTAATTTCAATCTCTCAACC ATCATTATTTATGAAGTGTTCAGGCTGCAATGGACCACTTGGTATGTACT ATACACTAATGATTAAATCAAATAAAAGATAATTAGATTTTTAATTTTTC AAAATACAGAAAGAAAAAAAATGGAAAATTTTTAAGTGTTCTATAAATCA TTATCTAAATGCCATAAAAGTTCCACTAAATATGTCTAAACGTATATGTT TTAAGATATGATACGTTTTTCAAGGTTTGTTAGGAGAGACGAGGTAGATT TAATCAGGACAGAGACAATCCCCAACTTTTCCCTCTCACTAAAGATAATT TATCAATGCAAAAATTTTAATGAATTAACATATGTTATTTCATACAAATT ACACAATGGATGAATAAATTATTACTTTTTCCTTACTATAGAAAAAAATT GGCTAGGTTTAGTATTTTAAGATTTATTGTTTGATTAATTAATGATTTTC GATATTTTCTATAATCTTTTCCTTTCTTTGTTTTCTCATAAATAATATGA AGTCGTTCAAAATGCCTCTCAATGGAAAGATAGATATTATTCAAATAACA ACATGACAATTTATGTATTTCCCATTAAATAATAGTACAGGGGGACTCGC TCATTACAGCTTTTGGGAAGAAGAAAAATCTGCGTTGTACGTTGACTTTT TTTGTATTGTATATTTTTTTTTTTTGGAAAATAAATTTTGTATTCTTACA GTGTTCCTAACATTGAGACCCTCAATGCCATTGTTAACCAGCACTAGAAC ACATAACAGAGGACTTCATCTGCTGGGGGTGCCAGATTTTCCGTCGCCAC CTTTGAAACATAGTAACAAATGGATTCCAATGATATTCGCCCTATGGACT TTTTTTTATAGACTTTTATTTTTTACTATTATTTTCCTCTGTAATAAATC AATTCAAAGAATCATGTATTATTGATGAATATATATTCTATGAAGTCATT TAATGTTAAAATAATTTTCGAATGTGTTTCTAATGACACTGCTGTTGCTT CATATTTGGGGTTCAAAGGTGCTTAATCTATAGCAGAGCTGTAGTACATG AGTCTGAACTTGTCTCAAGTCCGAATTCAAACAATATTTTTATGGACTCT TGTGAGACTCAGAAGAATTGGTATTCGAAAACATGAAGACTAGGAAAGGT GAACCTCGTTACCCTTGTGATCTCCATTCATCCAAAATCATTGTGAGGTT TATCATATGCATGAAAAAACTTCACATAATACTCACTTCTGATAGGTACA TCTTTCTCTTCGCTATCCTTCACTATTGATTACAGTTTGACTGATAATTA AGATCTTATATTAATTATACAGTCTTAAAAATAAAATGAAACTTCTGATA TTATATTCATCAACCGAAAAGCTGCTTACGCATGATTTTAAAATATTTAA GTTTTTATAGGCTTATGGAGTTATAAGTAATAAGAGAAATAAACACTTAT ATCTAGATAAAAAAAGTATATTTAATTTACATAGAAAAAAGTGTTAGACA TAATTCGTGCTTAGTAAAATGTACAATTTGTAATTAAGTAATATAAAACA AAAATACTTTATGAAAATGAACTGCAAATTTGGTGACATTATCTGCACTG CTACACTTAATGGCCATTAGTTCCAAGTTAAATTCAGAAGTTTGGCAAAA ATCTTTGTTATATATTTTTCATTAATTTACAAAGACAAAATATTTATTTT TAGTATATATAGTTTCTTATTTTTTATAATAATTATATAGACATTATTTT TTGGTTTAAATATTTATATGGATGATTTTAATTTTTATATTCTTAGTCTT TAAACAAAGTTTATAAATTTCAATTTGTTGGAAATTTATCCAATTGTGAA TCAGTTGTGAATAAAATTATTGTTTATGTCGTGATAATAATTAAAAATTT GCTCAATATTCATCCTGTTGCGACGTGACTGAGAGAAAGAGAGAAAAAGG CGTGTAGGAGAGTATATGTAACACTTTATATACAAGGCCATAAACCTAAC AGGACCTCGCCTATCATTATATTTATAGGTAACAAATATAAACACATTTT AATACAAACGGATTATGATGATACAAGAACTTGAGATGTGGGAACGGAAT TAGTTATAATAATACAGAACACTGCCCCTTCAATCACCAAGCAACACCAA GCTGGTTATTAAACCAAATATATAAAAAAGAACATCTCTATCCGGAGCAA CGACTTGTTGGGAAGTGATAATACAAATCCACATTCTCGGAATCTTTTCA TCCAATCGTTAGCTCATCAACGAGAGATATCTTCTTTCTCCAAAACCAGG ATCGAAAGGAGGAATCAGACACATGTCGGTCCAAACATGGACAGTTGTCC CTAGTAGGACACCAAACAGATCTGTAGCTTCATCCTCCAGGATACAAAAC TCTAGYCACAACCATTTAAACTTCAAATACGAMCSCCATCCATAAAAATT CCACCCAGGAACCCACAACAGAGAAGTAACACATGTGCATTTTTCAAAAT CTCAAGTTTAAATTTTAAGTTTTTTTCGTGGATTATAATCTTTACTTTGC TTAAACTATTTTTCTATATTTTGTATATTTGATTTTTAATCATAAACAAC TCTCATAATTAATTTTTATTTTATTTCAAACATAGTTTTTAAATCTGTGA AGACGTACATTTTTTCAAAACTTTGAAAAATGGTAGAGCCCTCCAAATGA TGCAAAAAAAATTTGCTATTTTAATGATTTGTGCAAAATTACCCAAATTT TGATGCACCTTGTGTTTGTATAGCTTTAAAAAAAATACATCAACAGGACA CCCTAGTGTGCAATACACATTGGATTTGATTCCATCCTTGTCGCCAGATA TTGTGACGTTACCGAGAGAAAGAAAATAAAGGCATGCAGGAGACTTCAAG TATGTGTAACACTTTATTTACATAGTTATAATACCTGACTGTGACTCGCC TGTCAGGATATTTATGGGTAACGAACATATAAGTACACTATAATACAAGA GACAGAGAGGGGGAAAGGACTTAGTGATAATAATACACAACAGTCCTTTC AAGATTTTTAATGTCAATAAAGAGTCTTTTCAATATTAACGGGTCATAAA ATTATAAATGCAATGACTATATATTATTCTAAAAAGCTAGCGAAAATTTT ATAAAGATCTACCAGTAATCAATTTTCAATGAGCAAATAGATGAAATATA AAGTATGAGTGTATTAAAAATATCTGTTTTATAGTTATAAAAAAAAAATG GTCGGAATAAAATGAAATTAGGCTGATACAATCATTAGGTAATATTGAAT TTTGTGATGCAATAATTTCGATGATTGCATCATACATTAGTCTAAAAGGG CTCAGAAAACACTACAAGATGTTACTTGAAATTCAATATCCGAAATGGTG AGAGATCACTCTTTGGAGACCAGGGCCAAGGCTGTTGGCATGATAAAGGG CGAATCAAGCCAGAGAGACGTTATTGAAAGGTTACAGATTCCTCTCAGGA CCATTGAGAATTGGTGTAAGAAAAGGAAGAATGGACAACCCTTGCAAATC AGAAGGGTCGAGGAAGGAAGAAACAAATTAGGAAAGTTCCCAAACAGGTG ATTTCAAAATCTTTGATCAAACAGAGGCAATCCACAAGGAAACTTGCAGC AAGATTGACTTCAAAGGGCTATCCAAGTATATTTCCGCATCTACCTGAGG TACTTTTTTGAACTCTTCGCAATACTAACCTCGTCTGCACCCCAAACTTT CAGAAAACCAAAGGAAGGCCAAGTTTCAATTCTGTCGTGAGAGAAAACAC TGAAACGCAGATGACTGGAAATGCATCCTCTTCGGTGATGAAAGTCCGTT TGACCTATTTCATGCTCCAAATCTCCAAACAGATCGGGTTTGGGCAAGAT ATAAGGAAGATGTGGAACCCACTGCAACTGTGAAATTTCCTCTGAAAATT CAGGTTTGGGCCGTTATCCGCTAACAGATAGTGTCAGATCTTCMCCTGAT TTAACGAAACCAAACTGTAAACATCCGAGTACTACTTAACGGAGATCCTC AGCAAGTTTCTGTTGTCAGATTTGTCTCCTACTGAAGAATCTGGACCTCC ATTGAAGAGGAAAATTTTGTCTGACACATCAAAGAGCCATTTTCCAGCAG GATGGTGCCCCTGCTCACGACTCCAAAAAGGCACAAAAGTGGTGTTCAGA CAAATTAGATTCCTGCCAACAGTCCTGATTTGTCTCCCATTGAAAATTTG TGAGCCTTGGTTCAGAGGGAACTCAATGAAAATACACCAACAACTTCAGA GGATTAATTTTAAAAAAACTGACAGAAGCTTGGGAAAAAATTTATCCAGA TACTTTGAATCATCTGTAAGAAGGGATGCTAAAACACATGAAAACATGTA TTAAGATTAAAGGTTGTCATATTGGGAAGTAAATAAAGTTTGTGCCAAAA AAAATCACTTGTTTAGGTTATTTCATGATTATTATTTTTTTTAAACATCA ATTTTTGGACATACGGTATCACTATTAACTAAAAATATATATATATTGTT ACTAAAAGAGGCCTTATATACCTTTTATATATATTTTATCTTGTATGCTC ACAGGGATTTAAACTTTAACTAGAAATTAATGAAACGACATCATTTCCTA AAAGATATTTTATCAAGTTTGTCCCTTCGAAAAGTTTTCATATACATTTA AAGGATATTTATGATTTTTTTTTTTTTTGTTTGTTGCAAGAACATTTTTT AAACATATTAATGAATAGTTTGTCGTCATATGAAAAAAGTTATGAACTTA AAATAAAAAGAACACCATCAGCAATATGGAACGTAAGAACTTCAATTCAG TCAATGAGTGAACTAAAAATTTGTTGTAATCATCACTATGAATTTTAACC AAAAAATAATACCAGATTTTTACAACATGATTTTCATTGCTCATTGAAAT TAAATGCAAAAATAAATGTATTATTCTATAAATATTTTAACTTTGAAGAA AGTAGGAGAATATGAAATGAAAAGGTAGAATAAGAATAGCGACTGACAAA AATGGAAGGTTGTGTGAGTATTTATTGAGGCTGATCATTCGATTGTTTTT GATAAATCCATACTGTAGAACTGACTGTAAATTAAACGTACGCTTATTGA GTTCAAGAGAATATTTTTCCCCAATTGCGTAGTCCAATGAGCTCCGTCGC TCAATATTTTTTTATTGGTCAGTTATTGAAACTAAAGTATTAGCTTACGT TCTTAAATTCTTCTTTTTCTATAAATGTATAACTATTGGTGGTTAATCAA ATAATTAAACATAACTAATTCTTTAACTATTCTGTAAAATACTTCAATTC AAAGTATAAATGAGGAGATGTAAGTTGATACAAATATGTGACAATATATT TATTATTTTTTGTTTGACTAATTTATAATATATTTTCTAAATTAATATTA TTATAAGTATAGGTTTATTTGAAATATATATTTTTAGCTAAATTAAATTT TGTTTCAATTATACCAATAAATACTATTAATAATCCCTACTGTGTCAAAT TTCCCCATGGATGGTTTTAGTTGGTTTAAAAAATATCAATATTTAAATTG ATAAATTGATATTTTTTTGGATAAAGAACTAAAAACTATATTAAACTATA ACTAAATTTTGTTCCAACAGTTGTATAATGTTTTCAAATTTTTCAAACAC AAAACTAAGATCTAAATACTATTTTTTCAATTGTAACTACCCCTTTTTTT ACGCATACCAATGAAATATAAAATTATATTCAAAATTATTAAAAAAAATT ATTTTTCATCTACCATGACTTATAAAAAACATTTATTTACACAAATGAAA TTAAAAAAATAGTTGTTAAGACTAAAATGGACCTAAAACAATGTAACTAA GATATTATCATATGTGATACAAATGATATTATATTCAAATTTTATCTTTT GAAAAAATGTGTTATATCTGTGAAAAAGAATATGAACACAGTCAGTGAGC TAATTTATATCTGAAGAACACAAATGATACATATAAAAAAATATATTTTA CATTAACTTTATAAGGTTTTAACAAAACTGATATTTGTTCTGACTACTTA TGTCAAAGTTATATTCACATTGTAAGTCAATAAATACTAGAAAAAATTTA TGATATGGTTTTAGTAACCTTTTTTTTATAAAAGGGTTAAGTGGAAATAC AGTCAAATTTGAGTAAAGTAAACAATTATTTTGTAGATGAAAAATTGACC ATATTTGAAGCTTTATGTTATCCGACGTATATAGAAAAACAACAATTTTG TCAATACTTATGTAGATTATAAAGTAACCAGTGTTTGATTAAAATCTAGT TTTAAGTCCTGTTTTTGAAAGATCATCAAGGATTTGTAGCTAATCTGTCA AAATCAAAATATTTAAATTTCTTATATCTTCAATTTTGATTTTAAAAAAT ATCTGAAATACACTAGTACTTGATCAACAGTAAAAAAATCCCAACTCAAA TGAATATGAAAATTTAGCAGAAAAATTTTGTTGGCTTTTTTACCAGGGTG GGATTTCTATGTTACGTTACTTTTATTTGGAAATTTGGTCAATTTTATAT ACGTTTTTACATCATAAACTTATATTATGATATATATAGACTGAAAAAGA AAACTAAATTTGAGCTTGTGTGCCAATTTTTTTTTTCAAATATTAGAGTG TCGGGKGACATGCCCTCGTTGATTTGACATGGAATGCTCCGATAGCTATT AAGCTATGCAATTTTCATACGAGTTATTTTATAAAAAATGGTTTACCTCG AACTTATTTTTCCCCCTTTAAATATTATGTTATGGTGTAACTAAATCAAT AATTTCATTAAGAAAAGAAAAAAATATAAAATAAATTAAGCATCTATTAG CTAACCAATTTATTTGAAGTTTACGAGTAATATAGAAAATATATGAGATA TTTAATTTGTTCAGATAAATAAAATTTAATATTTTATGGTTTCTGACAAG TAATGCTTATTATGATCTTATTATCAATCTTAAAATTATTCTTCATTAAT TATTTTTTTATTTAAATTGTAGCTTAATCTAAATATTTATTGGGATTTAA GTGAATAAAAATTATCCTTTTGAAAATAAAACAAAAAACTTTGTGTAATA GTTGAGACTCATAAAATTAAGATTTCTTGTTATTGATATATTCCAAACTT TCTATCCTCCTATGTTAATAGAAAGATAAAAATTCTTATMCCATCCAATA TAAATCAACTACTGGAGTCTAATGCTTACTTTAGAGGCCCACAAAATGTT TTACGTCTTCCCTAAAAACTATTTACGAATCTGTGTTAAACAAAACTCTT TCCAATCTTTCCCTGTCCTATTCCAGAGGCATTTTATTATTGCATTATAC GTCATTAGTTTTGTTGTATTCTGCACAAAGAAAAACAATCATCTTTAAAA TGTTTCCTATAAAGTAAGCTCTCCACGATATTCTATAAATTGATGGACCT TAAATACTGTAGAATTAATACTTAAATGTAACTTTTTTATTTATTTATTT TATTACTATCCTCCAAATAAGTGACAAAAAAATATTTAAAAGGGTCTCCT CTTTCAAAAAATACAGCCTTTTGTTTGTTGAGGAAGGTCTCATAGCAGGC ACTACCATCTCTTTGGCAATTTCGAATTAGGGAGGTATTAAGTCCATCTT AATTTAGATCATGTTTCTTTCAGGCCCTTTCCTCCAAAATGGAGCATATT CCCAAAGCCATCAAGTTTAAAATCCTTCCAAAGCTTTAAAAATTTATAGG TTGCTCTTATCACGTTTGATTTCGATATTCTTATTCTGCTTTCTTTTGAA AAAAAGTTTATCTATTGATTTATTCCTAGGAAAACATAAATAAATGATAT GCTACAAATTAAATGATATTAGCATACTTATTTATTTATAGAAATGCATA ATTCAACGTTTCGCTGATATTTAAAGATATATAAATCTTTTATTCATACA TTGAGAAAGGCAACATCAAATGCTTTAAATCGACTCTTGCTACAAAACCT AATAATAATCTAATATACAGTAAGTAATAAAATATTTTATTGCGTAAATG TTTCATATTTACGTTTTACTTGAAGTTCTTCAAAAACTGTTGGATGTCAT TTGAAAAAGGTGAAAGAAGTAGTATCAAATATGTAGTTATAGTATACATG AGTCACTTTCTCACATTTATCTTAATTTGTTTGTTTTATAGGGGATACCC ATGAGAGTTATAACACTTTTTACTATTTGATAAATATTTCAGTGTTACTG TGACTCTTAAAATGTTGAACAGTCCCTTTAGTCAGAACAGTTGCTACACA TATTGCAAACGTACCTATTGTATTAAGCGTTACAATATAAAACATTTCTT CTCAATCAATAATTTTTTTTGTGATAATAAAATTTGCTAAATAATAAGAT ATTATTTTTAAAAAAACCATGAAAAACTGACTACATTAGTATTAAAAAAT CGCCCTTAATCAGAAATAGTTTAAACTCATTATCTGGAATAAAGTAACAC AAATATCATTTTTATGTATTTTTTATTCAATTGTACTGTAAATTATGATT ATAATAAAAACTGTATCAATTCTCGAAAAGCCTCGACCTTTTGCAACTGT TTTGATTTATCTTTTAGTAGAAAAATTCTCACTTTTTGTTATTTTTCTGG TGGTTTGATAAAAAAAATATATATTTTCGTATTTCTCAAAAACATATAAT ATATTATTTATTTTCTCCAAGATATTTATCGAATATAATAAATTGTATTA TTTACTTTTCACTATTTTGTTTTTTTAACAATATTTTGTAAAAAAAAACC TTAAAATATTCCATTATTAATTATTCTTATTTTATTATTCACCGTTTTTG GATAGATTTATTCAATTCTAATTTTTTTTTCTCAAAGGTTTTGGAATTTA TAAATATTAATTTAATGTAAATAACTGATAAATTATAGACCTTAGTATTT CTTTGGTATTAAAATTTGGAAAAAATAGATTGTTGTAAAAAAAATTGATG TGATACAAATTTGAAAAATACTTGTATTGTTTATCAAAATACAATTATGG ATTTAAAATATCTCGAAAGATTCATTTTTCTTGGAATTGAAACAATATAA AGTTTTTTATTTGGCTGTTTAAAATCCCTTGTAACATATACACCTTAGTA CATTAAGGACAAGTAACGGATAGTTAAAAATAATTTTGAAAAGTCCATCA TTTACTAACTTTTTTAATAAAAATAACTTTAATCATGTACCTTACTTATT TTTTAAGTAAAACCAATATGAGTCAGTTTTGTGACGAATTTTGTTTTTGA AAATATAATGTGTTATTAATATGTTTCATTTCTTGCTATGTTTCATTTCA ATTTCCTAATTCTTCAACTGGGTTCATTCCTCGAACCATTTTCCTCCTCT AGTATACTGAAAAAACTATCGAATATGAATGTAATGCAAAATTTTGTTCC ATATTTTGCACTTTTCTAATTTATCTTCTGTTGAATGTCAGTATCTGCAT TGTTATAATTTCAAACAAATCTCTTTCAAGAATCAAGGATACACTTCTTC AGAGTATAAATTGCCCTCCCTGCTACAATAAATAAATCCAATGTTCCCTT CAACCTTCCCTACTGTAGTTGCTTATATTTATCCTGCATTAAAATGTAAT TAATAAATATAAAATAATAAGTAACAAATCTAATATAATTTTGATCAATG AGGCAAATATTTATATATAGGGTTTCTCATTTCCTTCAGAGTGATATTGT TATCAAACAATAACAACCATAAAATATATATTTAACCATTTTTATAAAAA TATGAGACTGTATATATCACCATTCTCAAAAAAACAAATATTACTTTTCA AATAAGGAACATTTATGCTAAAATAGAACAATTTATAAATTATTTATCGG ACACACAAATTATGGAAAGTTTTTTGGTTGATTCTTGGTCCATAATTTAG TTTGTTTTCCATATAGGAAACGTTCATTATGTGAGTTATTTGTTACTAAT GTATTAGTGGTATTTCATGTATAGGCTATAAAAAGTAAAAAAGGAAAAAA AATGTATAAGACTGTTGTTGTATTAAATAGCAAACCTTTGATTCTTTGTT CGGTATCATTTATTATCGTATCATTTGAAAAGCATAAATTGCACAAACTT TAAGTCAAGTGATTCTTCAATATTTATTCTGGTTTTATTTGATAATAATA TAATCAAATTAAGTTCATATTATGAAATAATTAAATATAATATATTTTGG AGGTTCAAAACGCTTTAAAATATTCCAAGAAAACAGGATCCCTGGCGATA AATCCTAATACCTATTCAATGATAAATTATTTATTTTCTCATATTATGTT TTAACGACAAAATATGCCTTCAACTATAATTGTATTTTTCTTTCAGGCAA GTGAGTCTTTGATGATATGTCAAAGCTAATACTCGAATATATCTAGGATA CCAACCAAATATCGACCTAATATTAAACAAGATATTAGTGTGTGAAGACA TGTACGGACTAATAGTTATACTAACCTTTATTGCTAGTATTAAACTGACT ATAAGTGATTCTGTGACTCCATCAATTAATATTATAAGCTCAATAAAACC TCTAACAGAGCTCAATGACTCCATCAGAGAACCCAACTCAGTTATTAGGA ACAACTCATCATTGGCATATAACACAGTCTATGAATCTGACACAGGAGGC AGCCCTGACGATGAAAGCCTTGATACTCTCTTCCTTGTACTCAAATCCGG GATTCTCATTCTCATCATTATTCTTGCTATATTCAACAATCTCTTAGTGG TTATTTCAGTATTTCGATATCATCGTCTTAGACATATCAACAACTATTTT CTAGTCAGTCTAGCAGTGGCAGATCTCCTCGTTGCATGCTTTGCAATGAC TTTTAATGCCCTTGTTGAAATTACTGGGGAATGGAACTTTGGTTATATAA TTTGTGATTTGTGGAACTCTTTGGATGTTCACTTCTCCACAGTCTCCACC CTTCATTTATGTTGTATCTCAGTGGATAGATACTTTGCCATTGTCAAACC TTTAAAATATACTTCATACATGACTGTTAAAGTTGCTGCAGTTATGATTG GAGTAGCCTGGACGGCACCCACCTTAATATCATTTCTTCCAATATTTTTG GGATGGTACACAACTAAAGAACATCTTGAATGGAGGAAACAAAACCCAGA TGAGTGCATATTCAAAGTTAATCAGGTATAAAAAATATTCATATATTATA AATATAAAATTATAATAAAAGAAAATGGTCTTTTATAAATATAAATAATT ACATTTCTGAGCCATCACATTTTCTGTACCAAAGTTAGAACAAAAATAGT AGTATCTTAACAACATTAGTTAGCCTACATAGTATTAAAATAGTTTATGT GTGTGTCTAATGTTAGCCCTTCTTAAAAAAATATTGATAAAAAATTGCAA AAGGGGACAGATACAGACTTTAGGCATTAAATAAAAGTTGTTTTGTATTC TGAGTTACGTAAGTAAAGCTATGTTTAATTCTGATCAAACAAGATTCTTG GACTCTAAAAGACAAGTTTTTTTTTTCGTTTATCAGTTGTTGTTGTGTTT TTTCATAAAACAAGATTGATTTCCCGTGTCTCAAAGTTTTTTTTATTTTG GTTGTCGATTCAAAAATGGATTACAAAATTAAAAATCCAAAAAACTAATT ATTGTACAAACTAAAAAAGGGAAAACGTATAATACATACGGACTTAATTA GGGAATTAGGTAAATGAAGGAAGAAAAGGATCAGTTAGTTAGTCTTAGAA TGTACCTTCATTATGGTCGAAGAAGGAACATGGCAAGCTATCAATAGCAA TGACAATAAATAAATTACAAGGTCAAACATTTTTTTTTTAAAACTGTATA TTTACCAAAATTAGTATTTAGTTATGGTTAATTATATCTTGCATTTTCAA GAGTGTCAAAAAGGTTGCAGTTGGTATTATATTTACTTCAAAATGTAAAG AAAATAACAACAAAAATTTGTAAAAGGAGGTTTTACATTAAAAATTAACC TGTCATGTATTTATAATAAATCATTTTACTATAGAATTTTAACATAAAGA AACAAAATATAAATACAAATCTTTTTTGATTATTCATTTTGTATCTTTAA GATAGAGCGTTTGCACTTGTAATAAGTTTAAATTAATTTTACTATTAGTA TGAGCTGAGAATCTGTGTTAAAAAATATATAATTTTAAGATTACGCTCCT TTTGTCATCACTTTGTAGAAACCCAATGAGGTAAAGCCAGTGTGGGATAA AATAGTTTTGCATTGGAAAAATGGGAAAAATAAAAGCTGAAAGGGATTTG TTCTTAAAATCCCAAATTACCTCAAAAAATTCTAAGTCTTTGGTCTTTTT GGACAAAGGATTCTTCAATTAAACGATCGCAAAACGAAACAATTTCAAAG ATCATGTCAACGTAATTACAAAGTTTGAAAAAGTAGAAAGGAGGTTAAAA CATGAGGACAATGTATTTTTTGCTATAAGAGGTCTTGAAAACATGAAACT TTCTCAAAATCCCATTAAAGTGACTACAAAAAATGGTGTGAAGGTAAACT TGACAATATTTGGAGAAATAATGATGAAATATGAAGAAATAATTGGCAAT TTGGCAAGTTTTCCTCAAACTATGGCTCTGGAAAGGGAGGAGGACGTAAA AATTTCTACAAATTATCAACAAGTTAATGACGGAGAAGCTCAAGATTGAA ATAATTGCCATGGATAAATTTTCAGTGGTTATTTAAGGAGGTTGAGTGGT TGTTAGGTTGAACTGTCATTGGTGATGTAACAAATTCAGTCATATGAATG TNNNNNATACACGGATTGAGGATTCAGTTTGGTCTTCCTCTGAATAGGTG GGACAAAAGAAAGATCTAAAACAGAGAATGTAATACATCAGGATAAGGAA GAGTATATTCTCGATTCTCTTAATGGATAGAATTTAAATGCAGAAAAGTC TTCGCCACAAGAATGCGACAATTGACAAGGATACGGATATTACTTGCGAT ATTGAAGAATCTTCTTATCCGTCCACATTAAACAACATTCCCCTAAGGGA TGACAGGAAAGTTGATATGCTAAAGAAACGGTACAAACAAACGAAAAATG ACCATTTTACCCTTAGGAAAAAATATGTAAAATAATTCTAAATCTTCTAG ACCATGATGATAAAAAGGGAGTAACCCCAAAGTTTACAGAAGCCTATCGC CTTCCGCTTAGTTATATGATAGGAATGAAGTTATCCGTTTTAATATATAT ATATATATTGTAAGCTCCATTTACTCTTTAAACAAGGCATCGTCAGCCTT CCATTACATGAAAACGATTGGGTTCCCAGATATTCTTGCCTTAGAGATCC CGGGAGAATTGCTCGTATTTTCCTGTCAACTGTTCACTTTTTTTGATGAT TAACTTTTTATTAATGGAAAAAAATGCATCAATTTATTAGTTATTATTTG TTGTTAATAAAATTTAAATTTAAAAAAGTTAATTTTTCTGCATGCTCAAA AATCAATGAATTTCTTGTTGGCTCATAAGGGAGATTGAAAGCCATAACTT TTTATGTTATTTAAAGTCAACTTCCTCACCTCTCGATCTCTGATCTAATT TCAACTACTTCACTCATAAAAAAAATACTTGGAATACTAAAAAAAGGCTA TTTTCAATTATTTTACTAGTCTGGTCCACATGAGATCAATCGGTCTTGAA CTGTCTAGAGTTCCTAACTGAGATTTGTATTCTTGCCATATGAATTGAAA TATTTATTAACCAGTGCTTGAGTCAAGACTTGTGTCTTATAACGGACCCC GGACGATACAAATGATTTGAAACTGACTCAGAAAATATGTACTCGGTAGC AATCCCGATTAACATATTCAAGTTAAAGAATTTTTCAAGTATAATGGTAA AGAATCAATTGTACTTATTTTCTTTGTACAACAGTACAKCTATGTTTCCA CATAATTACAAAATATAATTAATATAAACTTCAATCATAGTTAAWACACG KGTTAAKAAGGAGGGAGACCACGGGGGGGGGGGGGGGGGGGGSMTAGACG TCGTCGTACGTTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNGACTCTCGTACTTATTAATTTATATATTAACTATATA TTTTTTTTCTTCACCAATTTCAAATAATCATTTTTTCCGAATCCTTGGTT TTATTACAATCAACAACATATTTATGTAAATTAAAAAAAGGAAGAAATTT TTTTATTAATGTGGGGGTATATTAGGTCGTTTAGTTGTCATGACATTTTA TTTTAAATTTGAACCCTTGTATCCAATTGTATGGTAATTAAATCGAATAA TCATTTATAACTAAACCTCATTTAAAATATTTGCAGACGGGCAGAAAAGT ACCAGGCTTAACAATGAAAACACGTTTGTCTGTTTTGTTTAAAGTTGCCT TTTTTTACTTGGTTTATGGAGTGGATTCCCCATAATWCTTTTKAAGCCAT TGCTTACTTAAATTGTATTTTTTTCAAAACAGGGAGCAGTGTAAAATTAT AACACAAATTTTTTTATGGAAATAACAAAATATGTTCATGGAATTTTTAC AACTGTCTTTCGAAGGTTGGTACTAACTGAAAATGAGGTGAAAAAATTTT TCCACCGCCTATTTGTGAAGCCCTCGACTTTTCAGCCCATGTGTTATACA TAGAAAATATGGATATTGTTATCTTTACTTTTTTGCAGATATTTTGATTT GAATTATATATGAATTACAGTTAATTATGCAGGTGTATACACAATCAAAC CCTTAATGAAGAACATTTATTTTACATTTATATAATAGACTGTATTTTAT GCAGTAATTCACATAAGAATATCTTTAAACCACGGATGTAGAATAACCCC AATTCTAAAAATAACTAAGTTGCATAGAAATAAAATATTAAACTAACACT TTCAGTATTTGTAAGGGCACGACTAACATCATAAATACTAACTATTTTCT TAGAAATGAAATATGTATACCCCACTAACTCAAAAATCACGAGTAATATC AAATAAACGTAGTGTCGTATATTTTCTAATATATGGTATAATTTATTAGA ATGTGTTTGACAACTTTGAATTGAGTGACACTTTGTAATAAAAATTGTAT ATTAAATCTTTGACCTTCAACAACTATTTGTAACAGTCTACGTTTGTATG TATCTGAAATTGCGCACAAAAAATTGTCGACGTTCCAAGTAATTGAAACT TTTGAGCCATTCTCATTTGAGTAAAAAATAAATAAACAAAATAAAAATAA TACAAAAACAAAAATATTTAATTATTGTTTGATTCGTGATACTCTTTTAA TTTCCAAAAAAAAAAATAACATTTAAAGTTTATTGACTTCTTAATGAAAA AAAATTAAGCAATTATGTATACAGTGAAAGTAGGTGAAATAAGAATTCCA TTAGGCCTGGTGGATCTTGTGTATCAGCAAATAGATGTCTAAAAATAGTT TAAAGATTCGGCGTTCCCCRTGAACATTTATATTTCAGGAGCAGGAGCTG TAAATTAATAATACAGATGAACTATTAGTGGGGGGNTGGGGGGAATTTAA CAAATGAATTGAAAACAATAATCGAATTTATATCCAAAACTCATCTCAAT TTTTCTCTCAATGAGAAATATCCTTGCTATTATTAATGAACAATAATCAA TGTATAATTTAAAAAAAAGATACAAATTTAAAAAAATGCATCTTCACGGA TTTTGGTTCCATATTGTATTTTTTAAGTGATCCCATTATGAAATATTAAA ACTATGTACTATTGATTGGTTTATTCTTTCGATCCTGGAATATCATTACC AAGAAAGGAGTCAACTTTACTCCTCTATGAGGTCTGACAATTTTCCTCCG ATAAATTTACCTCCCAAATAATATTTCTCCCTCACTATCTATTATGATTA ATTTATAAGGATCTAACGAAGAGTCTCGTTATTATAATTTTTCCCCGTAA AAATGGAAATGAATCTATTTCAGAACAAGATACAGAATCAGTAAAAACAT TTGTACATAAGTTTTTATTAAATTTACTTCTGATTTGGGGACTGTTTTCA ATGTAAAATATGACTCTGCAAAAATAATAGTTCCAAGTTACAATAATTCC AGATATTTCAAAATTCAGATGACAAAGATAAAAATTGAAATCAGTTTTGG ATTCTGTGTTCAAATATAAATTACTTTTTCGGCTTGAATTCATTTGTACA AAATGAGTGTTCCCCTCTATAATTAGTGATGTTTATCTAAATTTGGACTA TAAATCTTGTATACGAGCGGCAGGCTTCCTCTTTTTTTTCGTCTTTTTTC TACAATGTGTATTTATTATATGTATTGAGCACTCCCTGGCTCTGAGAGAA TCGTATAAAAATTGTATTCTTCAATTTTTTACCATTCTCTAATTTTTTCT AATTGCATCATTTAAAATATTGTCCAAATATCTAAGAATTTTCTCGAATA TCGATACAATGCTGCTCATATTGAATATTTTTTCAAATATATCCGGTTTT CTATTNCTATTTTGATACGATATGTCAGCTATCGTTTAGTCCCAACAAGT CCTTTTCTTCTCTCTACTTCGTGGTTAACACACATATTTTAAACACCATT AGTGAACTTGGATATTATACACACAATATTGATTTATAAATACTTTTTGT TCCTTTGAACCTACATTTTATCGCCAATACTTTTTTTTATTTTAAAATTA CTATCAAACTATATGAAATTCTATAATTCTTTTGATAATAGCATGCTTAT CATATATTCTAATATTTAGTAATTCTTAATTTAGATTTCGTGAATATGAT CAGCCTTTTTTGCATAGAAATATTTCCTTATTATATTTCTAATTATACTT TTTTTCAATGTTTTGACCGGGCATAGAGAAATAAATACATAAAGGGAAGA AGGTGAGCTACAGAGTGAGCAATTTACTCTACCTGAATAATTGAATATTC TCAAAAGAAATGACGTCATATGTGCTTTTGAAAAATATATTATACAATAT TATTTGAATTTTATATAATGTATATTTCAAGTGGATCAAAATGACCTTTG AATGAAGTTATGAATGCAATTTATTTAAATTATTGACATAATAAAGACCT GGGTTTTTTTCATCATATATCTTAAAGACTGGATAAAATTTGTAGTCTGA ATCATCTTTCTAGATTCTAATTGATAAATCATTAGGAGCGGTTTAAAAAT TAATGCAAATGTTAATTTATCTATTGGTTTATAAAAAAAAATATCTTGAA ATTAATTTAATAATTACACATAATAAATTTCTCGTATGTATGAAGTGCTT GTCCATATGTCTCATTTTAAGCCTAATTTCCTGGTCTTCGACAACTAAAA ATGATGTCACGGATCTTTATTTTTTTTACAAAAATATTTACCAAAGTAAA GTTTTGTATAAATATCCTTGATTTTAAAACTCGATCTACTGGACAAGGTT GTTATTTTGAATCAAAAGGATTGTATATTATGAAGAATAGAAAAACAATT TCAAGGATTGATTTGGCTTTTCATATCCTACGTATAGGAACATATTTTAC GTTAAAAAAGCATATTATTGCCCTGACCTATCTTTAAACCATAAACTATT TGAACTTGAGTTAATGATTGTTTTTTCATCACGTATATTCAAAATATCAG AGTGGATTTTAATGTAGGATAAATATAAACAACTACTGTAGGATAGGTTG AAAGGAAAATTGGATCTAACTTTTATTGCACCCAGGGCAGCTTATACTCT ATTGCATTCTATCCTTGTTTCTTCCAAAGGATTTTTTAATAATCAAAACA ACGCAAGTGATTGTTTACAAGAGAAGAGATGAAATTTTCAAAAATAGATC ATTCATTTGGCGAAAATTCACATCAGACAATCTTAATTGTTTGAGAATTT CTGATATAATAGAGGAGGACATTCAAAGGAAAATTACAGAGGATAATAAC CCCAGTCGAAGAACTAGGAAACTTAAGTTAAATAAAAAATAATCTCTTAA AAGTTAAAAGTATAATTTATAATGGCTAGGTTTAGACTAAAACCGAAGAT ATTTGTAATGTTTCAAGAAGATTTTCAGGGCATGATGTGTGAGAAAAGAG ATCGTTTTCCTAAATATAGTAAAAAGTCTACGGCTAKTCTTTATTCTTAT MAATAAATATTGAACTGCATTTAAATTAATTTTAATAATAACAAAACTCC TGTTCCTGATGAAATGGAAGTAAAATTTTATTCTAAATTTAAATATCATG AGAATTTCCTTATTTACTAAGTGGCGGTAAATCTATGAAAAGCTTTCTTA ATCAATCAGTGAGGAAGGAATAGTATTAATTCGAAAAAGGGAGAAAGGAC TGAGAATGGTCATTGGGGTCCAATAACATTGCTAAASGAGACATATCAAA TTATATTTGGTTTATTTTCTGATCTGATTCACCCAATATTAAATAAGAAA CTTGTTACTTTCAGAAAGATTTCCAAAAAGGAAGAAAAGTGTCAGTTGTC TATCGAAATACACAAAGTGCAATCCATTCTGTATAAAGTAGAAAAAGATA TGGTGCCCCTATCGCCGTTGATTTTTGTAGGCCATTCGATACGGTAAATT ACCACTATATTTTACATATTACGAAGAAATTTCCTCGCAAGTGCTTTTTA CAACCGAAGGAAAAAAAAGGAATCCTAATGCTAATTAAAAGCTGTCTTCC TGGATGTTCTTTTGTTTGTTATGTCCATATAATAATTAGCTATAAAAATA AATCACAAGTTTCTTGGATTCGGTATTTAATTTGATGACAAACCTATTTA ATTTATCTTTACACCGACGATTTGACATTTTTTTATAGAAGTCAACTCAT CAACCCAATTTATTAGAAGGATTGAGGTCATTTTGTCATCTTTTTTAAAT TAAGAAAAGTCTTGCTCGAAAATTAATCAGAGAAAAACTAGTATTCTTCT ATTAGGTACTATATTCCAGTTAAAGGATCAAAGTTTGTAGGTTGCACTAT CAAATGAAAAACTAATGTATTGTATTTGAATATGAAAGTCTAGGAGAATT TTGTTCAAACTGGGTTACACTATCGACAGTAATATATAAAATAATCTCTT TTCGACAAGGTTTGAATCTTATCCAATCATTATGTGTAGATTTGGTAATC AAAGAAGAAATCAAATAGCTTTTGTGTCTCTTTTAACACATATATTCACC CTTTTTAAATACTTCCAAAAAATATTGATGATGAAGTGGTACTCATGTGG GAGATTTACTCAAAATATACATTAAAATATTATTTGATACATCTAATAAA CCAGAATTTGAATGGAGATCAAAATGTGTGTCATTTTAGTATTTAGTCTT AAATTACCTTGTTTTTAGTTGTAGATCTTGGCTAGGAAGTCTAATTTTAA GCTAAAACGTTGATATAACGCAATTTCTCATATAGTATTAATAATATATT ATTTTAGGTTCCGTATTTATCTTGATACAAATCAACATGTATGATATGAG CGCATAAAGATGCATAAAAAAACGTTGAATATTACTTTCCTTATGATAAT CACTCTGTTATTTTGGCTGTTTAAATAGTTATCCAGCAAAAAGTGATCAG AGCATAATACTAAATGAGACACCGGCGTGAAGTCCCTCTAACGCAAAGTT TTTTATATAATTATCCCGAATCTCCATTAAAATACAACAAAATGAAACTA GAAATTGAATTTGAACATATAATTTTTCAATCTAATATTTACCTGGATCT GTAGGTAGCCTATGGAAACTAAGTTTTGAGGAAAACCTTGTTTCAAATTG GAGCAACCATTAGTATTAATTAACTACTAAAAATTTGGTATATAAGTATA TTTTGTGTGCAATTAAAAAAGTGAATATGAAATTTTAATTTACTATATTA ATTATCCATACAAGTATATTTATAATATCATAAAGAAAATATAATACTTC TTATATTAAGGGATAAAATACTTTATTGATTGACAATCTCCAATAATTTC AACATGCTGAAATAATATTCAAATCTGATCTAGTATTTTAAAGTTGGGCA ATCAATTACTCTCCTTTATCTGAAAATAAAATACCCTTTCATTAAGCTAC TGTTGATAACAGTATACTAAAAATTATAATGCTCTACTACGTTATGTAGT ATGCCAAACTATAAATAAAATTTCGTTTTGCTTCAAAAAAAAATTCTATA GGGTAGTAGTTATAAATGGCTTATTCCTCATATTAATGTTAGAATTAGAG GTGAGAGTAATCCAATGTGATATATCTATAATATGAAGATCTTTCTATGT TTCTAAGACTTTATATTAATTAAGTAGTAAAAAAACATAAATTGTTAATT TGAAATGGTATTTCTCTTGCTTTTTTCTCATTTTGACCTAGATGTGTGCT GAAAGACAGCAAAAAACAAAGATATATTGAAAAAATTGTTATAAAAATAG TAAGAAGAAATAAGTAAGTGAAAGATTCCCGACGCAATTGTTGCACAACA GTAAACAGAAAAATTTCATATTTTAAATTATAGCTTAAATATTCATAAAA TATTTTTTTTCTTTTTTTAATTGACATTTAAAAATACAATATGTATGAAA TATAAAAAAAAAATGATTCGAAATTTAAAAGAGTTTAATAACCACGAATT AAAATTCAACAAAGGAAGATTAATTATCAATCAAGTACTTTATACTATTT TGAATTAATGTAGAATGAAGATATTTTCACAACAAATATTTATCTTTTGG TCTTATGAATGTTGGTTCACAGATCCAACTGGATCCAGTCCTAGAAATTT TGAGGCAACAAATACATCTGGAGAGTGCTTCCAAGCAGTTACTGGTAGAT CTTAGTATATATAGATCCTTTCTTTATTTTGGACAGTGCTGATTTGTTGA ATAAATCAAGTCCCTCAAGTATGTTCCTTATCTTAGTCCCACGAAAACCA ATGTTCTTAATTGCTAGTTTATTCATTAGGTCCAAGGAAGTAACTGAATT AGAATACTATAGTGATTTTCTTAGTAAGACTTCCCACGCGTACTTTAAGA AACGTAAAAGATGTTATATACCTTTTCAGAGCGAAAAATAGTTCGTATTG ACAATGATATTAGTTAACAAACTATAAATAAGTTATTGTACATAATATTT AATTAATTATATATTACCCATTTTACTAATAGAGATTTATAGACCGACAA TGATCTAGCAATAGGATTGACATAATGAGCAATAACAAACTTAATATAGT CAACTGTTCAAAAAACTATGGAAATAAAGTGACACAAAAAGATGTCAGAA ATCCAAGTTAAACCTATTARCAACCAGTTAAGAAAATKATAACATTGTAA ATGAATTGGGAYAAAAACAMTAGCCACTTGAAAAGGTATTTTTTCTGTTC CTCAAAGTACGACATAGTAATGGGATAATAGATACTAAAATATTTATGTA ATGGGTAATTTTTTGCAATTAATTTTGTTTTATATCGATAAGGAATAAGA AGGATAATTGCAAAAATATATATCATCCTTTCTAATGTATTAGTTAATTT ATTGGATGCACTAAATTAATAATAAAGCTTAATGATATGAAAACACATTT TTAATATTTATAAAGGGTCTGATATAAAATAAAACAGGATGTTGAAAATA TATAGCCTATAAAAGATTGTAAAGGTCTTCCTTATTTTATTTGTTAGAAA CATTTCGATGTTGAAATGTTTCATTCTTATAAATTTAATTGTTTAAACTC CAAAAATGGCCGATATTTACGATGCTAACAAGGTATCAATAATTAATTTT TTTAGAATTGAATTGAGGAAAAAATATTTGAAATAAATTACAGATCTTAA GCAAAAATTGATGCATTTTCAAAATAATACTAATATTTATTTTAATTTTT TGGCAGCCATATGCTTTCATTTCATCCGCACTAACATTTTGGGCCCCTGT GGCAATCATGTTGTGTATGTATCATCGAATCTATAAGGAGGCTCTTCGTC AAAAGGAATCGATAAGAAGATCCTCAGTTCCCTCGCAACAACATTTAATC ATTGATTCGGACCGAGTTAGAACAAGATTTAATGTAAGTGTACAACAAAA ATATTTGTTAACCTTCTTTTACTTTTCTGGGATATTTGTTGTCCACATAT ATTTTCTTATTCACACGCTTTTTTGGCTCTTTTTTCAACGGAAATTCTTA ATAAATCTGCAATATTCTATTTTTAGTTTTCGTTTATATTTCTTGAATAT TATGAGGTATTACACCATGCAACATCATTTCGGCATTTAGGCTGAAACAC ACATTTAATATTGTTATTTAAGCCGTAGAACACGCAAATGAAAAGTTGCT GGTTAGGTTGTGCACATATATATTTGCAAAAAATTCTGCGTGGGAAAATT GAATCGTTTATCTGTTTATAACTATCAATTCATCAATTATTTTGAATATA AAGCATGCATAAACTTTTTTTAATCCCCTTACATCGAAATTATTGCTTAT TTTATTTTTTAATTATTAGTTATAATCTTATAAACGATCTAATTCCCCCC CCCRRCCGGAATATTTCAGTAATCTATATTAATAACGCAATCTAATCAAC TAATTATATTTAAATATTAAAAACTAATTGACCAAAAATTTACCAAAATC AACCTTTTATAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNACTTAAAGAAAAAAATAAAAAAAAGTATTAGCTT CTAACTACTATCTTTCATTTTACTCCATTTTTTTGTGGTTATATACATTT TTTATTATTAGTTTTAATCGTGATAAAGTAATGAATAATTCACTTTTCAA ATGCTGAAATGTTTGTATCAATTTATTATTTACTTTGACTATCATATATA TAATTCTTTCATGTCAACATGTGGCACTTAATCGTAATTATGCCATAAAA ACTTGATTCTTTAAAATAGGCTTTTAAGGCCAAGCCTTTGAAAGTTAAAA GTTTTAATGTTCATTTTCGTAATCTATGGCTTAAAAGCCATAGAATGTTT TATATTTCATAAATCCTTTTTAGTTTTATCAAATATTGCCTTTTTATCTA AATTAAAATTATATAAACTTGAACAAAAATTTTATCTTCAGTAATCAATG CTTCATCACAACGTCGAAAAGTTTATCGACAATTTTAGAAATATAGGTAA AGTATCAGTTACCTGATTTGCATTTGATTTGACTCATTTCCGGATTAACT CTAAGAAAGTGTTCACGTTATGATTTATAAAAAAATGAACAAATGATGTT AATAATTTATTATGTCGTATTTTTACTCGAATCCAACGTTTTCTATACTC ATTGTTTTTATACAAAACTCCACCAAACAATACTTATAATTTCAATTATA CCTTTACTCATGGTTTAATATACATACGTGATCCTTCACTAAGAAAAGCT AAAAAAATTAAAAAATGTGTTGAAAACATAACAAAGAAATATTWTATTRA AAAAAAMAAACACACATTTAAAAATATGTAAAACTCTCATTTTATATTCA TACACAAAGTATAAAAAAACAAAGTTAATTCTAGTGACACATCAAATTAC GTTAATGTTGGTTTTTTTATGTATAATAAAGGTAARTAATTCATAAAATA ACATCAAAAAATATCAAAAGTTAAAATTCCTTTCATAATTTATGTCAACA TTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAA CTAATAATTTTTTCCCCGATATATAGGAGTTGCAGGCAAATGGTTTTAAA TCCGGAACTGACTCTTCTGGTAACATTACTCTACATGAAATTCATTCAAA TAACAACTATAATCGGTATCCTCCTAACCGTCTTGGTGTTCCTGCCTCTA CATCATCCTATCGAATCAGCCCCTCAACAGAGGATGAGAGCCTTCCCTTG AACGTATCTAGCTCGACCAAGAAGGAAACCAAGTTTGTTGAAGGAAACTT TTCTATGACTCTAAGCAGATGTGCATCACCAACTCCATCTAGGAATTGTT CCTTAACTCCACCTGCTTCTAATAACCTTCTTTCAGTTATAAATGCAAAA GCAAGGAGAGTTTCCATGGCTCATAGTATCAACTCTGATGGTAAGTTAGA TTCCTCCATCCTTTTAATTCCCCTTTGTTGCACAAATTTGTCAAATTTTT ACCAACGGCACAGTACAAACAACTTATTTAACTACATCGTATCTCAAATT AAATTAAGTTGGTTTGCATGGTGTTACATGTCATTTTTATGAATCCTTTA CTAATTACTCTGATAATTATTGCTCAGATATCTGTAACTATATGTAAAAA GAATCAAATAGGGCCTTACTTAGCAAGTTTGAATCGAGACTCAAGATCAA ATATGTATGAAGTAAGCGTAGATAGGTGTAAAAGAGATCAAAAACAGTTA TAAGCCTAATATTATTGCAAATAAATATTATAATGTATTTGGTGGTGATC CGTTCAATTTTGCATTTATCCTATATGTTACAAATTAAGAAAATACAACT AAATAATAATTTTTAGGAATGTGTGGAAATAATCTACACTATTGATTGAT GAGTATTATACATAGATTGAATAAATTCATTCCCATTGCCCCCATCAAGG TACTGACCTGACTAACAAACATGGTTACTGTAAATCATAAATATATAAAA TAATTAAGAGATAAAGGCAATGTATATCAAATTTCATAACTTGTTGGAAT TGACTTCTTTGTACTGAGTGTTATAAAACCTTGAATTATTGACAAAAATT ATACTTCGTAAAAAAAATATTTCTACATTTATTAATGTTTTCAAGGAACT AATTTTTTTTTTTGGTCAAAAGCACAGAATAGGTACCCATACGAGACCGG CATTCAGTTTCACAAAAATGATATATTTTTGGAAGACAGGTTACACGTAA AATAACTTGTACAATCTGTTTGTACAAGTTATAAATTGTATGAGAAAAGT GTATTTATTAAGATGAGTAATAAAGTCATAAAACCCATTTTACCTTGTTT AATAATTAAACACTTTTAACTAATTTATCCTATTTTTGGCACGTCCACAC AAATTCTTAAAAACTCTGAGTGGTAGTTATTTATTTTTTTCTTTTGGGTA TGATATCCACATAATAATTATCATAATATGACATGTATTAAAACGTAAGC AATGAATAAAAGTATCAATAGACCTGAATTAGTATGGATACTATTTATTA ATTAACATGTATGGAAAAAACAATATTCATATCAAATCTAAACTCTGTTA ATACAAAATAATGAAGTCTAGCGACACTATGATGGAGAAAACCAAGATTT TAGATGACATTTTCAACAATTGTTTCTACTTTTTATTGCTTNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNTTCAAGTCTTGCCTTGCAATGATTCAAGAATAATCTGGTACTC ATTGGGAGAGCCTTTCACTAGGTTGCACGCCTTATAAACTTTTTTGTGAC CTTCTTGCTTCTTTAAATAAGAATAAGCTCGATAATACACTTCCATCGAT TATTTATACTGTTCTTCCTTATTCTTTGGATTCTTTTTTAAAATGGAATC TTTTTGGAATAAGTAAGAGTATAATAGCTGATAAGGTAACAAAATAACCT GTGAATCCTTTATTCCTTGGTTTTCATAGATTTTTAGCACCAGTGTTTCC GGCTTAGAAAAGGTTTTGATATTGATCTAAGTAGTATGTATTTGTAAATA AAATATATTGATTATCCTGGAGACCGTTGATATACTTCATATTAAAAATT GATCAGTTCTAAATGTATTGGACTTTGAAATATCTAATAACTCGTCCCTT CCCCCTGTATCCTAAAAAAACTCTTTGAATCAGTAGCACCTCCTCCCCGT CAACTGAACGTCATAAATGTATAATTCCTTGGCTAAAATAATAAATAAAC TTGTTCATAAAATGTCAACTTTTCTATGTATTCCTAAGTATTATTAAGAA AATATATATTATATCAATTAATTCGAAGTCCATTCTTTGGCTATATAGAA TTAGTATAATACTATAATGTTCACTTATATTAAATTGGTACAATTCTATT GACTTATGAATTTTTTTTTAAATATGTCTTCTTTCTGTTTAATGAACCAT CGACTATAAACTTATATATGCATCTATGAAGTTTTTGAGATAAGAAACTT TTTATTCTTACTCAAATCGATCATTAGAAAACTATTGAACAAAGACTAAT CACAATATAATCAAATATCTTAAATATTGTAAATAGTTTTTTGAAACCTT TTTACTGTAGGTATAATATTCATCAATTTAATTTGAATGAGTATCATTCA TGACTTAATCTCATCTTTACTTTACATTATGGTTGTCATTTTTCTAATGT TAATGATGCAAATGAAATTACTTAAAATGGTGATGTTTTAATGTTTTCTA CTTTCTTCTGTAACGCCTCATTAATTGAGTAGAACTTATCTAAATGAAGA ACTTAACTTTAATGCACTAAAACGTTTTATATTAAGTAGAAATGTGCAAA AATATAGATTAATATACCTTTCAAAATTGATTACTCCAAAAACAGATATT AAACTATTTCATAAATAATTACGCATGAATAATTTTATCTACTGGGTTCC CGTTTACTGGGATTTTTCGAGATTTTAGACCGACGGTACAACTCCTTGGA ATTAATTTACTTAATTATTTGATTATATAAATATCGTTTATCTATATTAT TATAAAACGTTATCTAACTCTATATTGAAGAATCAATAGGGTTAAAGTTT TTACGATTCTAGTGATATGCGATTAATAAATATTTGCCTTATCTGCACAG AAGTTATGTATTTAATATATAATTTCTGTTTTTGAAGAAAAGTATGAGTT GTTAAAATTAAAATGGCCCATATTTTTATACAAAAAAGTTAAATGAGTTC TAGAGATGGGGAGGAGTAGACGTTTTTCCTAAGGGTCGCACTGTGTATTT CACAATTATACAACCTCTAGCTCCATCAAAAATTAGTTCTTTCATAAATT ACTATTTAATTTGTTTGATGTTATGTTGTTGGTAAGACAAGCTTATAATA TTCCGATATTATCTGGGAAATAAAAAGCCTTCGTATGAGCCTCTCTTGAG GAGAAAGAAACTTGTAAATTGTTTTTATTTGATAAGTTATCATTGTGATC ATTGAGAAGTTCAGTAAAACAATTGAAATAAAATTAACTAATAGTTGAAC TTCATAATCTCATATTTCCTAAAATCATAGTTTTTTATATACGTTTCAGT ACCCTTGATAAATTTGACTATACGCCATGCTTGATCTTTTTTTTCTCTTT TAATTTGAAACTGTATTAACAAAAAGTCAAAATTTAATCAACACAAACTT TTCACAATGACGAAATAACTTCAAAAGGCAAAGTGAAGCAAATGATAAAT AATAAGAGTTGGACAAGAGGGGTTTTGACATTTTTCAAATATTGGGGCAA TTAGGAATATTAAGGCAGGTAAACGTACTCGGAGTCGATCTGTGAACTGA GCGATGAGGTGAATACTCAAGAAAAAGCCGTAGTGTATTTCATTATAAGT TGTACATCTTGTAGCATCATCCCTCAGTCCACATATTGACTTCAAGTCCA CAACTCCAAACACCAAATKCTCCATAATAGACAAACTTACKCCTTCCGCC ACTCAATCATACACATTTAGTTTATTTGTATGGCCCTCTGATGTGCTAAT GTTCCGAATGTTACAAAAAAGTTGAGATCCCTCTTATTTAACTCCAAAAA TATATTGCTCACTTTGATAATTGGTTTATTAAAGGTGTAATTTTTAATTA TTTTATAAAAATTACTAAAATATAATTGTACAGACATTGCAACTTTTAAC TGCATAAATCTTCAATACATTAAATACGAATGTCTGTGTATAAGTTTTTT TGTGAATTTGTCCAGGAATCACACACAAACAAAAGAATGGATTTTGTATT TTTTCAAGGCTCAAAAGATGGTTTTGGTAACGATTTTTTTGGCTTTCAAG GCTATAGCAGCCTTTATATAGTATTTTTCTAAAAAAAAATGTTTTGACTA ATATGAAGCTTTTTAATATAAATCAAAAATCAAGAACGTATAATTTGAAG ATTTATTCTCTTTGCATATCAGTATGAATCTTTGAACACTTTTATAAAAA GAGATTCTAATGTTTAGAGAAGAAAAAAATGAATACAGAATAAATTTTTA AAAAATTAAAAGATAAGGAAGTTTTCAAATTTATGATAAAAATAAAATTA AAAGAAACATACGTTGGTAAATTTGAGGCACAACAATTGATGCTGACAGA AATAAACTAAATAAAATATAAGGAATAAATTCATTTAGAGGTATAAAAGT ATTTTTTTGTACACAAAATATTTTTTTTAAATGCATTCATTTTTTCATGG TTTTTGCTGTAACTGGTAAAATTTAATTTATTTTCTTTTTTTTATTAGTT GATATAAGTTCTTCTAAATTCAAAACTTAAGGGATAATGTTTAAAACATC ATCTTTTAGTATCATAAATAACAAAATCTTGCGAGGAAAAATTATTTGTA GACCTAAGAATCTACTTCAGCTAATTATCACTTTTGACCACTTGCTTTAT TGCATATTTCGGGTTAAAAAAAACTTTTGTGTTCAATGATCCAGAGATGG GTTGACTCAGACATCCCAATATTTAACTCAACAAAACTTCATAGGGTTAC AATTGTGTAATTATACTAAATATTATACCAGTCTGTAGTTTTTCCTATAA ATGCAATTGAATGAAAAATTTACAATATTACTTTAAAAAAATGTGGGTTT CACAAATCTATTTCTACTGCTCAAAATTAGTTTTTATCCAAAATCTCGAA GAGAAGTTGACAAAAGATATTTACATTTTTTTACAAAAACCTACATCACA TAAAACAGTTATATTGTAATTTTTGTGGCTGMAACTTTTTTTAATATTTT MCATGTTTRAACTGTCCCCTTCCTTCTGTACAATCAAAAGATCCACATTT AATAATTATATAGTATTTTGAAGTCAAATTAATCTATTAAAAAATTGATA TGGTGTTTTTTTTAATAATTCCTTTTATTTCGTGACATACACGACAAAAA AAATAGTACAAACTCAATTTGTACGCTAATTATTCATATAGGAAGTTAAA TAATTTACGATCATTTTCAGAGTAGTTTAAATACATTTTTACATTTATCA GAGATATACGCAAAATGAGCTCACTTTTTACCACATGAATAATTAAATGA AACTTAAAGAACTAGTTAGTAAGTCAATTATTTTTTGTTTATGCAAATGG TAAGGCAAGATTAATAAACAATATGTTTTTGGTTTATTCAAGAAATTATT GGAAGTACTTAACAGACAATATCTTCAACTTGATATTTATGTAAGTATTA ACAAAGACTTAAGAGTATTCTCCAGTTTGGTTCTAATTCTATATTTGGCA CAGTACTGAAAGGTGAATAATTAGATATTTTTTAGTCATTTTTTACCATT CAGATTTCAATGTAAGATATTTAATATTGTAATTTTATTACTACATAGGT AAAAAAAAATACAGTGTAAGGTGTCTGAGAAGCATCCCATACTTATTTTG CATCAAATGACGTTAAATAATATTTCTTTGCTATTATTAAATTTCACCAA ATTAGATGGTATTTTTTCTTAATCTAAATAATGAAGGAAGCTGTTTTGAA TTAATTCATCTTCAATTTCGAGAATCTGGATAATTGTGCAGTCTAGTGTT GTAACAATACAAGTATTTTGTACTAGTTTCATAGACAAAATTGTTATTAC TATTTCAATTATTTTACAACAAAAAACTAAGGGAGGATGTCGTTAATGGT ATTCCACATGCACTTACATGGACATTCGCAAAAACAGCACAGAAAAAAAA TCAACGAGTGAAAAACAAAGAAATATTTTTTGCATTTTTAACTAGTATTG AATAAATAGTAAATCTAATTTCATAAGATAATTTACAAAGATACATAGAT CATCAATAGTGTACATATTGTATTAACGGTATTTGGTCCATCAATATTAT ACGTATCTAATATTGTAGTAACCCGAAAAAGACATGAGAGAAAATATCAT ACCATTACCATGACCTACTTTATTCAGCACGATTGAGTCACGGAATGTAG TTGTACATATATGTGTATGTATTTAATCCAACTTGCACACTCCTATGTAT CAATCAATTGAAATTATCTGTTAAATTATATGACATCCATTTCAGCCAAT TGCATCTTTTTCCAGATTCTACAACGTCGTCGAAAGTTCTTTGCAATAGA AAAAATCGAATAGAGTTATCAGAAAAAATGACATCCATATTTGAAGGTGA AATAGCTTCACCCCTAGGTGTTTGGACCATTGGCCAAGGAGTTCTTGAGA GGCGTGAGTGTTGAATGTCATTTAGATAGTTTCTATTATTTTCAAATTCG TATTGAAAATAGTTTCTTAATACTCGTAAATGTCCCATTAAATATTTTCT ATTAGTTCTATAACATGTACATATTAACAACCATATCAATTTAATTCGGG AAAAAAATTTCAATTAAAAAAATATTTGTGTATATACTAATAAGAAAAAG GGGCTTTGGTGCATGTATTAAAAATAATAATGAGCTACAGAGTGCGCGGG AAAAAATTACTTCTCAAATTGTTTTTTTATCTGGCAGCAAAAATGTAACG ATGTGTCTTTATTGACAAAAAAAAAATATTGGTGTCCGAAAGTTTTATTA AAATCTCACAAAAGATGAGTGATTAGTAAATAATCATTGAAACCATGAAC GTCTTGACGTACAAAGAAATCAGAAGGCATTCCAAAGATTTTTGGTGGAA TAAACTTCCACTTCGTTTGGCAAATATTACATACCGAAAATACTGTATTA TAAATAGAAAGTGAGATGATCAAGGAAAGGGCCAGTGGCATTAGTTCAGA CTTGATCGATAGAATTCAGCCACAAAGACTTTTAAGATGGTTGCTAACTA TATTTCTGGCATAGTAATACAAAAACAAATTGCACTGATCGAGGTCGTTT TATTAGAGTAAACATTGATTTATTCAGACCAAGATCGTAAATACTACATT TTTGAAAATTCATCGATCTTTGGATGTCAAAAATCTTGGTGCACTTAACC CATTTTCTTATATGGGCTCCCACAAATAAGGTATYGGAGCCAAATCAAAC CTTTACAGTGAATTTCCCATACATTTGTGGACATGGTAGGGAAACAAGTC CTTCGTTTGAGCAGAAGTGTGAGGAAATATTCAAATTTTCAGTAATCTTT TTACCAGAAGCAAGTAGTTTATGTTACTGTAAAAAGTACAAATTAGTAAT ATTTCGTTCGAGAACATAACGGCTCTATGAGCTGGTTCTTCAAAGTGAAC TACAGGATCTGCCTCCACACCAAAAAYAYACAGAMCAGAGTGTCTMSAAG GGGGGGGGGGGGGGTGGAGGAGTAGGCTTGAGGGGATGAAGCACCCTCAT AAAGGATTTGTTGCTCCACAGGATTATATATATATATATATTTAGGAGGG GGGAGGGNNNNNNNNNNTTTTTTGGAAAAAAAAATTCAAACATTAAATAT TTAAAATTTTTTTTTTTTTCGCAATTTTCTAAAACAAAATCAATTGTTAA TTACAAAAAATCAACTTTTAGGAAAATAATTTSAAAAATGAAATTGTAAA TATAAGATATTAAAAAATCTTTTTTTTTCAAATCACAGTTATACACAAAA TATAATCCTTTTTAAAAAAATTTCAGGTAAAAAGTTTTCTGAAAAAAAAA TTCAAAAATAAATAGGTGAAATAATATTTCAAAAATAAAATTTCAAATAT TTAATTTTTTGGAAAAAAAAATCACAAATCAAAAAAATTCAATATTTGAA AATTTGTTTTTTAAACATTTTTTCAGCTATTCCAAGAAAATTTAATTTTT TAGAAAAAATGAATCAAAAATACAAAATAAAATAAGTTTTTGCAGAAATA ATTGAAATATTAAATATTTTGCATATATAATTCAAAAATACACAATGAAA TTAATTTTTTACATAAATAATTCAAGTATTAAATTTATTCGAAAAAAATA TCAACACCAATATTTATTGTCAGAATAGTTACAACCCATTCCCTGTAGAC ACCCCTTTATGGACGCCTCTGTAATTGTAATATATCTATTTTAGTAACAA AACAAACCTAAAGAAATGTTTGGAAGGCGAAAGAGGGCTCTCTAAAACTG GCCAAAATTTTCGTCAGTTGTACAAATCACGTCCAATTAAAAGAATAATC TGATTAAGATTATGTTCACAAGTATTAACCTTTCAAAAACAGAATAAGTA AAGAAAAAGGTAGTTTGTTCAAAGCCAGAAATAAAAAAATCACACCTAGT ACCAGGCTTAGGGAAAGAGATTAGCTTAGGATAACTAACGTTTTCTTTAA AGTATATCACTTTTATTCTCATTCAAATTTAAATATGATAGTCGTATTAA ATAAAAAGTTGTGTTATTAAATTAGATATTTTTTAAGAGCGCACGCTGTA TATGAACTAAAATATCTTCTTATACTAATCAATCATTAACTCACAGCTAA CGAATTGTTTTTTTTTCTGTTTTACATGTACATGTTTCATATATATTTTA AATAATTCACAAGAGTTTGAATTAAAACGTGATAAACTGTAATTTTATTT TTTTTGCTTTAACAAAACATATTAAGTATTTGATTTGCATATTAATTATT CGTGAAACTGTACATATATATAGGATTTGTATGTATTTAAGAGAAGGATA AAAATAGAGTTGTAAAAAATATGTYCAGCCGATATGTAAAAAGAGAAAAT GGAAATTTGTCATGGTAACCTCTGACAATTCAAGGGTTGTTTTTTGAGGA GAGAATCTTCGTTGTGATGAAATTTTACTTGATTAGCTACAAACACCTAC GAGAGAAGTGGCGGTTCTTTACAGATGATTAGTTTGGCTTGTTCATTTAT TATGGCCATCCTCTTCAAGAAAAATAAAACAATGATGTATTTTCATATTA TAGTAGAAATTAATATAATTCTACATGGAACATGTCGTTATTTTTATCGT GTCCCAGAACATGTTAACAAAAAGAAACCGAAAAAAGGCCAGCCATCATT TCGTAGTTAGCTTAAAAAATCAAACATATCAAATACTATTTATCTCTTAT ATACTGCCATACAATCATTGTCACATTATTTATCTACAATTTCAAAAATA AATTACATACATATCACACACACATATATATATATATTAATCCAGCATTG TATTTTACTTTATTGTAACATTGGTTTGTAATACTATATTAAAATTGTAG TCGTATTTGTATTTATATACAGGAATAACAAAATGGTCAATATAGACGAC TAGGGAAAAATAAAAAAATGTATTCCTATTTTTTTGAAAATGGTGCATAA GTATAGTATAACTTATTACATCCTTTATTTTTCAAATATAATAAATTATG AAATGCCCATGATGTATCAAGTGAGACGCAGGAAATGATAAATGACAACA AAACACACTGATTATTTTTGTATGAGTGAGGTAACGCCGTGGGAAATCAA AACTAGTAAATTCCTGAAGGGCTTTAAAAAAATATGAAAAATCAGAATAA ATGGCCCACAGAGGTATTTATTCTTCTTGAAATAAAAATATAAGTATAAT TTCACTGTATATATTATTTAATTTCGGAATTGGCTCAATGACCACTCCCC GGAATGTAAAAAATTAAAAGAAACCTTAAATGATCAAAAACAAAATGATA ATGATTTCAGGTTTCCAAAATGATAAAAACGCACTTTCTTATGTGGCCAA AATACAAAAAGTTTATCACCCGCGTATATGCTTATAATCTGCAACTCTAT TTATTAATTGATACATAGAGTTGAAAGCTTTAGATATTCTAAATTAGGTA TGAAATATTGTTTTTATTTGTTTTATCTTTTCATAACGATNATTGTTATT GTAGTATGATTTATAATGAATAGGATGTAATGCAGGTGTCAAATGCAAAT TTATGTTAGTAATTTTTTACAAGGCTATAAAAATACAATTACCATGGATA TAATCAACCATCCGATCGTGAGTATGCTACATGATTACCTCCTAAGGTTC TTCAAGCCAACCAAAAAAAAAACCTTTATCTAAGAGTAGCACTAAATATT AATAATAAAGCAATTAAGGAGGGAGTTAGAAAAAGGCAGCCTTAATACGA TCTCTGCAACATTTTAAAATAACCTATAGAAGGATCCACAAACAATATGT GAGGTCATTATTCGATCAATACCTCACGCCTAAGCAGTCCTACTTGAGAT ACCGGGTAGCCTTAGGACTGTAATATTACAATGACTGCAACAAAAATAAA ACGCTCACCCATGTTTTTCGTGACTGTGAATATCTAAATTTAATTTGGCA AAAGCCCATATTTTTATCCAACCATTTTTGAGTATTTTTTATTCGTAAGT CAAAGAGCTCCACCTTGTTGGAAATAGAGTTTTTGGGTTTCTAAAATTGT TATTCCAGTACCATTGGAAGGGGATTGTTTTGGGTTCTTAGCAATTCGTC ACGAAACTTTTGAACTTTATCATTTGTCCAAATGTAGTGAAGCGGTTCTG AAGGTTTTTACATCTCCATGTGTCATATTACCATCTAGACCGCTATTTTA GATCACAGACTGCTGTTGACCGATTTTTTTATGCCTCAATATTGAAACTA ATATAGTTGGGTCTTAACCTATGGATCGATTCTCTCATCTGTCCTGATTT ATGAGATATAAGAATGTGATGTAGTCAATAGATTTATTTATATCTTAAGT TAATGTGACAAATTTCACAATTTTATAACACACATTAAGGCATCAACAAT TAATACTTGGAATTATTCTAGACCGAATTTTTAATTCATCGATACAGACT CATTTTGTAAAGGAGAGAAGTATAGTTTTTAATAAGTTACGAGTAAGACA CAAGTAGAGGTTTTGATGTCATTTTAGTTTATATCATAAAACTCAAGTAT CAATTTACGGGTTTTAGTAGTGACACATCAATAACCTTAATAAATTGCAC TTCCATGCAATAAGAAAGTAAAATGAAACTTTTTAATTTTAATAAATTGA AATTTACTATGAATGAGCATTATTACAATGCAAATGAACATTTGAACTGT CAAACTTGATTTAAAATTTTTTTAAGTTAGTACTTGATTGTTGTTATGTA TTGATATTGTACTAATAAGATATAGAATCTCATAGGAGAAATGTTCCAAC CTCAATTTCCAATACTGTAGGTTGGATAAAGGGCGGGAAACACCTTCTTG CCCATGATATTTTATATTCATTAGCCTTCCAGGTTTCTTTTATCCACTTT GGTGAAAATGCCGTACCGCCTGAACCAATGACACTGAGCATCATGGCATT GGTTGGGTGTTTCAAAACCCCGGTGAATTTTACGTTGGGAGGGGAGGGGC GTCTTTGGAGTTTTTGCCAATGTACCAAAAGCTGTGTGAGTGGCTGRCTT GGTCGACCATCAAAATTTTCCTATTGGGTTTTCTTCAATTTATTATAGAG GATCTGCAATCGTTCCAGCCTCTTTTGTAAGTGTAAATCCAGCAAACCCT AAACCCAAAAAAGATGCATGAGATAGCCCTTTTGTGAACTCTTAGATCCC TGGACTTTTGACAGACGTTGTCACAAAGGTTCGTCTCCTTGTTTGCCTTC ACACTCCATATGAGACTTTATGTGGGGACCAATTTTTATCTTCCGGACCT GTGATAATCGACAAAGGATTCAGTTTCGTTGTAGAGCTTCTTGGCGTTGT TTACAGTGGTCCTACCGATCCCAAAGTTATGTGCAGTCACGTAGGGTTTG TTACCAGCTTTGAACACAGGGAAAGGAGTGTAGAAATTGTCGGCATAATA ATTACGGTAGATTTCACGAAGTTGAATACATTTGTTAGAAGGCCAATACA TGCAATGGCGAGTTTAAAAGGTTGTCGATTTGATTGATCGCAACCAGAGA TGTTTTCTATTATATGATGGACTTTGTCTATGGTGGTCTTAACAAAATGA AGAAACTAGTACAGGATATCTTGATAAATGACAAAAATCTCAAGGATTAT GTAACGACAGTAGAAACAATGTAAAGTCTTTGTATACAATTTGGAAATTC ATGGGAGAGGGAAAAGTTTGAATTTGTCAAAAGAGGAGTCGAATATATTG GATATATTGTTAAGCTTTCGATTAGTTCCCCAAATCTACTGTGAATCCAA CAAGGACTTATAATTATAACTCTGCAAAAAATCCTTAGGGTTACTCTCCG TCTTTTATGAACACATACAATGTTCAATCAGGTTTTCAATTTAGTTGATT CTTATAGGAAAGTCAGTTCACTACTCAAAAATTAAATAATAATGACAACT GCTAAGGAAAAGAAAATTCTTTTTTTGCATAACCAATTTTTTTTAAAACG GGCACGCAAAAAAATTCAGACGATTTACATCACTATCTCTTAAAAAGTCT TCTCAACAAAACATCAGCATAACTCTACGCTATTTCTGAGTGGACAACTT TGTAGTTATACTTAATACTTTATTGTTAGCACCTTAGAAATTAAAAAAAT AACATTTAAAGACAATAAAAAAGACTGTTCAGGTTGCCAATAACAAAAAA AACTCCAATATTTAAAAATGCTTATGTTTGACTAACTTTTAAAAATCCCA ACTTTGCCTTATTAATAAAGAAAAGTTTATAATTTAATATATGGAATATA AATGAAAATGATACGTTATAGAATGATTTCCATGTCCAACTCTTTTCCTT GAGTCCATGAGGCAAATCGAATGGACTAAAAATTAATTAGCAACACATAA ACTTTAATGTTTTTACTAAATAAACTCCTATTAATTGATTTCAGAATAAA CAAACATCTGAAATGATATTTAGTTATTTAGTTTATTTTTTGACTAAAAG TTATAAATAGAAAGTTTGGTGCATTTAACTTGTTGTTGTGGAGTTCAAAC AATTTTTCACTATCATAACACGGTAATTTAAGTGAGTAATGAGTTTTATA CAAGATTATCTTTTAGCTTTCTATAACTTAAATCCATATATGTATGTATT TATTAAACTAATTAATGTATCACTTTATTTCAACGAAGTAAAATAACTTA TGTCTATACATAAATTATTCCATTTTTAAGACCTGCAGAAAAAAAAATTG TTTATATAATTCAAGTGTCAATTTGAAATAATTTACGAAAGCCAATTACA TTTAACAAGGGAATTTTTAACAGGTGTCATTTTTTTGACATCAAGTTGTA CCGAGTGGTCCAATAAAAAAGCACTTTAAATTTTAAACTTCAACAAAATA TAATTTAGTTATTAAAAATAAAATGCCATCAAAATTTATACTATAAANNN NNNNNNNATGTCTGAGCTCTCTTCATCATTAATGTAGCCTTTCAGAGTTA AGGGTTGGCTTTTAGGCTGAAGAGGGGGCCAAGAGGATCAAAAAAGAGGT CAAAATAACTATAAAACTTATTTTAAACTCATAAAAAGGAGTCTTGCAAC GGAGGAGATGGGGTTATGTCATTGCTGGAGTCAAAAGTGGCCTCTTCTCC AAACATGTTTCTTTTCATCCACATTTTTGATAGCTCTCTAAACAGTCTTG TGTGGAATCCCGAGATATCTTGCATTAGACCTCATTTTCAACTCATGCGG GTCCATTTTGGGCTATTTCACATAGCCCATCTTCCTCTCTATTGTTTCAG ACTTGTCGATGGCGTAGACGGTAGTCCAGGAGACGCCCAACTACTGGGAG GGTGCGAATCAAAATTGTCGATCATGTTCAAGTGTCCTTTTCTTGACTTG TACGTAAGTTAAAGAGCACAGATTTGTTTTGTATTGTCACTAATTGTTTA TATTGTACCATATCCAAATACGAATTGATTTCAATCACTCAACCTTCATC AATTATTATCTACTACTGCACACCGTCTACTGGGTCAGAAAACTCATGAA AGAGGGAAACCCCCTTAAAATCGAGCCCAGTAGTGAAAAGGCGGCCAAAA TGACCCCAGAAGTTACCAAGAAGGCGATTGGGGACAAGCCCACCATGTCC ATGGTCTAATTTGCAAAAAAAATAAATAAGTGGCTCTCTCTACCGTATCC AAGGCGTACAAAGCCACCGGGGAAATTCCTAGAAGTACGTGGAAAGACCA TTAATTACTCGACAGCAGCATGAGCATTGTTTATTTGTTTACAAAAAGGA TGGAGGGAGGCAAAAAAACAAAACTCTCTGAATTCATGAGCCCATTGATC TCAATTCTTCAGAAATATCATACTTTCTTAAAAAACTTTTTGCTGATTTT GAGATAAAACATAATTCCATATATGAAATATATACAAAGTACGACAGGAA AATTTTCCACGATTATGTAGCAAAACCTTTTTATTAGAAAAGTATAATGA AAAGTTTTATTAAAAAACTTTTAGCAATAAATCTTGGTAATAATTATTCA ATCAGGCGCCTCCAGCCTTTATCAAAGCCTCCACATGGGGTAATAACTTA GCACAGGTTTCTACATTATAATCGTTGGACATGTTAGCACATTGCTTCTT GATGCTATCCTTGAGCTACTGCCATTTCTCTGCGATGTCTTACCAACCTT CCTCTTTAAGACACTCCATACACTGAAGTCGAGGGAATTTAGATTAGAAA TGGAGGAGGGAAATAATTTCTTGTACCAGAAGTTAGCTAAGTATTTTATT ATTCGGCTTGAAGAAGAAGCAATCCATTTTCTTTATATCAGAGGCCATGA CTCCCAAACACATTTTTTGGACCGGATATTTTGTCCTTAAGGTGCATTGG ACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNAGATCTTCACAGTCGACGGAGGRCTC CTCAAGCCTTAAGCCTTATCTTGTCGGTAAGAAGATGTCTTGGAATCCTG ATAAAGCTCTTAAGGTCAAGGTAATCATGAACTGTTCTCCAGATGGTGAT TTCATCCATGTTGGCCTTGTCAGCCTAGCGATACATTGATGTTTATGGAT CTTCCTTGATCTTGGCCTCTAGGGAATTCATAAATGTTTCATTTCACTTC AAACCATTTCCTCCAATTTCTGGCTTCCTTTTGACTCTTTCCCCATTCTT CTTGGCCACACTGATGTTCCGGACTGTCGTCACCATCATGCCCACAATAT CTGAAATTATTTTTGGATCAACATCCATGTCAAAAAATTTCAAAACTCTT TGCCTTTTTGATTCTAGTTCACTCATATATTGCCAATTTTGATCAAATTA AAACAATTCACAAGAGAAGCAACAAATTTATCGGAACATTAAGATATCAC CTGAACCCTTAATTTGTGCATAAAAAAAAATTATCACACGGAAAATTTCT TTTTGCACTTTGTAAAAAAACCATACCANTATGTGATTTCACTATCCTTA TAATCTAATTTCCTCTCATTGAATCTTAAATACCCTTAATTAAAAAAACT AAACCAATGTAATAAATATCTACTATATACATTCTCTTTTATAGAATGAG TAGATTAGAGATAAATCAAAACCCTTGCCAACTAATTACAATCCAGAGAT TCCCTCTTACAAAATATAAATTTTTCCCAAAAAGAATTTACAGTCAAAAT GAGAAGGATATTAGATAAATAATGATTTTTTTTTTTGAGAAATGTTGGAA TTATTTATATAGATACTTTTTAGAAAGAATCAATGCTTTGAAGCTGTGCA GTGCTCATGGAATAGTAAATTACGCAATTTTATTTATTAAAAAAATAGAT TTTTTTTATGAAAAATACTTTTCTGGGCCGGTACTTTAGCTTAAGGAGTA AATTCAGCCATGCCTATCTAATACACAATGTTAGATGGATATCATAAGGA AGATGTGAGATAAAAATATGTACTTATTTACTATAAATAACGTTCTAAAT TTTTTTGTTGATCTTTAATAATAGATGAAGGACAAAAAACGTGGTGTGAA AATACTTTATTTGTCTTTTTGTACAAAAAATAAAAAATTTGGAGGAAAAC TTTGTACATTATCATTTCTGAGAAATTGTTAATAGTATAATTAAAAAAGG GATTTATTATAAATGCTTTATTTTGACAAATATTATCCATATTTTAGATA AGAAGTTTATATTTCTATAAAACTTTGAAATTTACAACTTTGTACCCTCT ATGTAATCCATTCACATTAGTTATTAAGGCTTTAACTTTTTATCCTTTCT TTCTTTTGACAGAGTAAACATTTTTAAGCCATAACATCTCAACATTTAGA AARGAAAAAGACTCTAATATACCAATACAAAATGTGTAGTATAAAAAGAA AAAACTTATTTTTTCCATTGTAATGTGTATCATAGATTGTCAAAGTGCAA TCAATTCATGCTTGATGGCGTTAGTAAGATTAGATTTTGTACTAACAAAT CTTATGATACAGTTTCTTGATTAATTTAACTCAGTATTGTTTGAGTGAGC ATTAAAGATATATAGCAATAAGGACAAAATACGCCATATTTTACAGTTTT TCCTCGATAAAGAGTCAAACAGAAGCTAGATGGCCGTAAATGTGAATAGT GTTGTTGGTCCTGATATTGTAACAGATAACTTCAGGTAACTTTAGTTTCA TCAATTCTGTTCTGGTAATTTTGATTTCAAAGATCCGTGACGCTGTTGAA GGCCAATAGCTGCAAATGTGAAAATAAGAACGAAAAAATCTAGTCTGACC CTCATGTAAGCAGTGCTTTAATTGCCAAAAAGATAAACATTAATTGTAAA AAGTAAATTAAAGATGATTTATTTTTACTACACCTATAAGCAGAAATAAT AAAGACTTATTTATTTTTCATCACATAGAACAAAGTGAAATATTTTTTTC TCCATTTAAGAAAAACCCTACAGGCTTTTTACTTAGCAAGCAATTTATGT TGAAAAAAATATCGTTTAATGAATCACTACTACATGAATAGAAACTTTTA TTATTTACATACGTGTACCTACGAAGTAAATGTAGGTATTTTAAATAGTT TTTAACCTAAAAAACATATTATCAATTAAAATTTGTGTTTATATCGAATT TAAAAATTTATGTTTCTTTGAAAGAAACAAAAAAGTGTTTACACATTTTC TTCTGTACAAAAAACTTTATTCATTAGGTAACGAAAAATTAGTTTTTTTA ATTTATTCGTAAAAGTATTAATCGTGTTGGTGTTTTTGTTAACTTAAGCC GAGTAAATAATGGTTGTCAAAAAAAAGAAAAGAAGGAAAATATGAAGCAA CCAAACATACTTCGTAATTATGTTTGCTTAAAAAAACCCGGAACTCGACA GTAATTAGTTCCAAAAATAATGCAATCAAATACATTTTTCCCATWAAGAA ATGACTAAAACGAATTNATTCGTAAAGTATTTATTTTTAACCTAACGTTG ACAAATTTATACAAAGATTTCAAAAAAATATGTTGAGATGTAAATAATAT AAAAAAACACATAATTAAAACAGTAAATGTAACCACTACAGTACACCAAC ATTTATTAATTTTGTKTWGGCTGTAGAATACATTGAAACCTTTAACCAAA ATAGATTTGGTTTTCAGAGGTGACTTTTATTTAAAAATCAATTTTGTAGA GTACAATTACGATTCAGAACCCTATTTTGACGTGATATAACAATATAAAT GATAACACAGGTCAACATAGAATTATCATCAGAAATCCTTTTGTGGGTAT CTTACAACAATTTTGACGTTGATTCCAAAACTGTTCTTTTTTATTTCTTC TATTGCTTACAGTTTTTAAGATTAATATAGTTTTGTCTTTTATAAATTTG CTAATTTATTCTTAGTACATCAATAATTTTGATAAAACGTACTTATATTT AAATTATATATTTCTAAATAACAATGGATCTGCAAGTCTTAAAATTTTCT CACATATGCCCTTGGTATTATTTTAACGTATATTTTATTATAAAATATAT TGTAGTACTCCTTAAACGTCTGTGGATTTCTCAAAGTTAAAGGAATACTT ATGGGTATACAATCAGGATTAACAAAATTTCCTTCCCACTATGGATCATT ACACAAAAAATGTTTACCAGAGACAAGCAGAGTCCAGTCTATCCCTTTAG TGGCTTTSAAAAGAATATTTCTACCACCTCTCCACATTAAACTTTGTTTA ACGAAAAAATTTGTAAAAACAATGGGTAAAGTCAATTAATTTAAGATTTT TTTTGGTAAGTCACTGTTTTTAGGAACTGCATTCAAGATAAGTTAAGAAA TAAAGGTTAACAGCCCTCACATTTTTTTTTTTTTTAAAAAAACAAAAATG GTTTGAGTATCGACAATTTCTTTATTTGCCGTTAAAATACGTTCAAGTTA ATTTATGAATAAAATTCGATGTTGTTTGAATGATCACCACGTGCACGTTT TACGAAGTCCAATCGTTGAATCCGATTTTCGACTACTTTTCCGCATAAAT TGGCTGAAACTGCAGCAATTTCGCGTTGAATATTTGTTCTGAGCTCTTCT AACGTCGATGGATTATTGGTGTAGACCAGGGCTCTCACGTGACCCCAAAG AAAATAGTATAGAGGTGTTAAATCGCACGAGTGAGGCTGCCAAATAAAAC GGGTCCATTTTTGGAGATAAGATGCTCACCAAACTTACTCTTCAATAAAT CGATTGTAACATTTGCTGTGTGTGAAGTGTTGCTGGGTTGAAACCACATA TCGTCCAAGTCCATATATACCAATTCAGGCCAAAAAAATCGGTTTTCATG GCGCAGTAACAATTTCCATTCACAGTAACGTGGCGATTGGTATCGTCAAC GAAAAAGTACGGCCCAATGACACTGCCAGCATGCAATCCACGCCAAACAG TAATTGTTTGGGGATGTAATGGCATCTCATGAGTCCCGTGTGGGGGTTTT CCGGCCCAATAGCGCATATTCTGCTTGTTAACAAAGCCATTGAGCCAAAA ATGTGCCTTATCGCTGAAGATGATTTTACGTTGAAAATCAGGATAATTTT CGAATTTTCGTTCACCCCATTTTACAAATTTCCGACGTTTGAAGGGGTCA AGCAGCTTTAATTCTTGTGTCAACTTGATCTTATACGGGTGTAGGCCAAA ATCTTTTCGCAAAATTCGCCACAACGATGTCACAGATATGTCCAACGATT GAGAACGGCGCGTAAGAGACAAATTTGGGTCATCTTGAATTGATGCGCTT GCGGTAGCAATATTTTTTACACTTCGTGCATTTCGTTGTCTCACTGGCAC AGGAACATTATGTAGCGTGTATGTGGACTCAAATTTTTTCACCAAATGTT GAATTGTTGATTTTGTAGGTCGATTACGTTGACCATAAATTGGCGTTAAC GCTCTTAATGTTTGGATCAAAAACTCACCACTATAAATTTTAATAGTTTG CAAGTGTTGCTCGAGTGTGTACTACTCCATGATGAAACTACAACTATTTT TGAGCACAGCTGTCAATGAAACAATAACAAATATGACGTTGTTTTCGAAA CCTATCAACGTAAAATGTGAGCGTCCCTATTAAAACCCCCTTTATATAAA CTTATTAATAGTAGAATATTTATTTTTTATTCATTAATATTACCTTTAAT TTTTAACTATTTAGTTATTTTAGTTCAACTTATGGCTCTGAATTGAAATT ATACTCTTATACATGATTTAAAAATAGCTTTTTAGGCCAAATCAACTTAA ATTTAATATTTTTATGCTCATTTTTATATTTTATGGCTTAAACAACAATG AAACAAAATTCTGCTAAGTCACGTGAATTGGTTCCATTTCTAAAAATTTA TTCGTCCTTTTTTGTCGAACTCCGAGTATGACTAGATGCTCTCTGCCATT TTGAAAAATAATATGTGTAAATATTTTAATTCCAAATATGGATTATGTTT GGTTTCAACTAAGTATTCGAGTATTAAATTATTAATAATATGCATGCTTC TAAAGCTTAGGATCATAAAATGATTATCTGGTCAGTAGATGAACTAGTAC CTAGTTTTGTTACATTTATATCGAATTGAATGCCCAAGAATACTTTTTTC AGTTCCTATAATATTGCCAATACAGTCACATTAAGGGAAACATATATTTG CATTGATGTTAATATTCTGAAGTATCAAAAGTAAAATGGTGATAGGATGT TGAAGTCATAATGTTAAATCTGAGACATGTAAATTTAATTTTGCTCTATT AAAAATCAAAAACTACAAAAAAAATTTATACAATCATAAACTTTTTTAGA GGTTCAAATTAAGTAATATCATATTTTTCTTTCTTTCTACATTTAAGCTT TAATACAATATTCTACCATTTTGTAATGATTAATCTGAACTGACTCAAAA ACAGTGAATTGACTCCTATTTTTGTCAAATTATTTTTTTTATGCCGTTAT TTATTGCACAAAAATATCAAAAATAAAAGTTAATGAATACATTAATAATG AACAAATACAATAAATTTATTAAAGTTTGTTATGATAAATAAAAAACTAT ACCTGGATTTAAAAAAAAAAGTAGTACTACTCGTGTGAACCGTTCACATA ATACAATGCATATACTTGAGGTTGTGTCAATTTATAAAAATATTCCGAGA AATTAATTATTAAAATTATATCAGAATAATAGTTTAAATAAAGAATAGCA AACGGACAAAACAAATAGGAATCTTAAAACATGTTCCGGAAAAGTAATAT GCCTCATTCTGACTTGGGCCACATTCCTTGAGAAATGTCATCCTAATGAT GTCTTCTTCACCATCATCGTTTGGAACATTGCCACTGCTTTGGAGGCTAT CCTCAAATCATTTTTTGCCTTTCAGCCAAGAAGCCGTGCAATAGTTGTTG TGTTGGTGCCATCTTAATATTTTGTATAAAACACTAATTAATCTACAAAA TCTCTACAAAAAATAATAATATTTTTAGAAATTTAATTCAAAAGAACTCT TGCAGTAAAATTTTATCTTTACAAGAAAAAAAAACATTTTATTTGATATA GATGAGAAAGGATTATTATCAAAACTTTTCAATACTATAAATAACTATCA CAATAACCAATATACAATTACGTATATATTTTTTTTTTTATCTATAGAAA AAAAAAGTATAAAGGAATATTTAATTTTCTTGTGAATATCATTAGATTAT CATTTCATTATCAATGCANAAACTATAATTTTATTTCCTAATAAAATATG AATATTGAAAACTTGTTTTATAAATAATACTATTTTTTTTAAATTTTACA AATAACAGTTTATACATATTTAGATGATAGTGAGGTCGGTCCTGTAAAAA ATTCCCAAATTTTTAACTTTTTTTTATACAAACTTTTGGCCTTACTTTAA TAAATATATTAATATTTAGCGTGAGCCAATAAAGTTTTTGTAAAAAGTAG AGGAAACTATAAGAAACACATTTTTGAATTTTGAATTTTTCTCTTTTATG ATATACTTGTATATATGTATTTTGAATTAATTGTTAAATATATAATGATG AAAAATATTTATAAATATATATTTTTTAAATATCCCTACATATTAAATAA ATATTAACGTTCTTTTTAAATATCAGTCACTTTTCTGATAATAAGTGGTC GTTTTTATATTCTAACTGATTTATTTTACAATACCTTAGAAAAATTTAAG ATTTTTCAACTTATTTGGAACATAAGTTTTGCCCTAATATAGGTAATATA TATAAGGTTTTTCTTCAAACTGTGCACCACTATTGCCCCAGAGAATAGCA ATTTGAGCAATGCTTTATTTTTGTCTTTGTTCAATAAAGATTTATTTCTT TTGTAATTTCCCGAGTATCTTTTGAATTTCAATATGACAAAAATTAAAAA CTTATCTAAATACTGTAGTTAATTAATTTTCATTTTACATTTAATCGAGA CTAAACTAAAGGTTAACACAGCTGAGTACTTGAAGATCCTGCAAGACGTC CTGTTACCCTAGATGGATGAAAATTTTGCCCTAAATATTTAGGTAATTGT GCAGGTCTGTCGAAAATAAATACTGCCGAAAAATAAAAAAACTAATTATA ATGTAGCTGATATTGTTTTGTTTTTTTTGCAATTTATGAAAGTCAAATGA TAATGTTACTCTATAATTTTTCCTTGTGACTGATATATTATTTTCTTAGT TTCGTAGAATTTACCTCGATAACTCAATCAAAAGGTTGAATTCATTAAGG GTTCGTAAGACGTCATAGAGTAATATTCGTGCTTAGACTGACGACCTTGG CGGGCAATAAAGTTGTGGGTACGTCTTTAGACATGGAACATTTTGGACTT TGTTAAGAAAATACATTTTTTGAAAAATAATTAATGGTKCTCTTCCCTTA GACTCAATGCCAGCCTCTCCTCGATGGCAGGACACCTTGTAGGATTTTTC AATCGTGGACTCATTCATTCTCATGAATGCCTTCTGGAAAGATCTTTTAG GCTTGAAATATTGCTTTACCTGCTCCTACTAGTCTCCTGTTCTATTTGAA TCCATTCGTTTTAGTCGAGTTGGTTTAGGTTAAGAGATGTCAGTGGCCAT ATTTCCTTATTCTAAAATATACTAGACTTTGAATTTTTGATAATGTACGT TTAATTGGGGTCACACTGTTATAGGGAGCATGTCATGAGTTATTATGTAT TTGGCTTTACTTTCATGTGCCCACACTCATTATACATCTTCTTGATATTA TAAATGAGAGACTTAGAGATACAAAAGTAGCTGACAATACCAAAAAAAGT TGTTCTCTACTTAAAATACGCGAAACAATCTTTCTCATTGTTCAATCAAT TCAAAATTGTGTCTTTATTGTATATTTTTGGGAAACGCTTTATTAAAAAA AAATACAATTAAAATAATTATATAATGTTGGAATAGTTAATATCAATTAA ACATAACATACTTTCAACATTTCGTGTATAACTTTGGCCGAGCTTTCGAA AAGTAGTTTACTAATGTATACTTTTTGTCTTAATACACTGAGCAAAAAAA CTACCATATGGTTTCCAAAAATTTAATGTCAATATAAAAATTAAATAGTA TCATAATGCTAGCTTATACCAGTAAAAACGCTCTACAAAACAGCCAGATA TATCAACTCTGTACTTTCATATGTCTATCTATATACCAACGAAATGTAAG TATTTACAAATTAAATTTTTATTTAATGGTGAAACTTTCTTCATTAATCA ATTAGGCCATTGATAAAAAAGATAATAGGTGGGTCATTCTACGTCAAGGG TACACACTTTTTTATAATTTGCGGCATGATCATCCCCGATTTTAATGATT TTGGGTGAGCTGGCTTTTCTAGATAAAATAAGAGACTGTATGAAATATTA GGGGTCTATGACTCACTTGGGCCATTCTTGACCCGTTGGGCCGATTTGTT GGACCAGTGTTGTTCAGACGGCCATAATTAAGCTTCTGATTTACTCGATT TAATAAAAAATACGTCAAAAGATGTACAAGAACGAAACTTTAGCTTATAT TCAATCATAATTATTTTATTATTACAAGTAAAAGTTTGGGACTCTGGGGT GGCCTTCAATATGGTTTCCCTGCCAAGCAGCAAATCTGATTTTATTTTAA TTGTAAAAGAACTTATCTCTGTATTTGTTTTCAAATATATCCCAAATTCA ACGTGAGATCTTAACGGGATCACTTCCAACGAGAGCATTAAAGAGTATTA ATGTAGAGCCACTTTTATATTATTAATATTATTGTTCTATATTTAAACTC ATAATTTATATAATATACATATTTGCTGATGATTAATAACATAAATTAGG ATTCTTATTTAAACGTTAATTAATTAAATATTTATGTATTTTATAAGATA ACAATAAAAATATGACTTAATGGTTATGCTGTGAGGGAATGTACACTTGA CGTGGACCAGCTACTGAACTAGACTAAAAAAATTGTTTCCTTAATTTGTC TACAAATAATATTAAATAATATTATNAGTTTAATAGTTTTGTTTGCTTTA ACATATTGTACCATGGAAATAGAAAACCAATTAATCGATATAAAAACTAT AAATATCCAACAGAAAACATAATTGGAGGAAAAATCATTATTACCTAAGT ATTTTCTAATGTCTTTCAAGACGTAAGTAATAACATGGATTAGATATAAA AATAATTGTACTCTTGTGTATAACTAACTAGCCATTATTATAATATATGT ATACCTAACAAGGAATAAAAATTGTTAACGTCTCTTGTGAAGGTCCGAAT ATTAATTTTAATTACATTTGTCACATTTTAACGATATTTCAACTTTATTT TTCAACTGTCTTAAAAAATATTTATATATTTTAGTCCTGCTTTGTAAAAA CACAATTTTTGTACAGCTTAATAAATAAATAATTTTATTAACTTTGTTAA ACAAATATATTAATACTTCGGGAATATAACAGTAAATTAATGGGTCTTTG TACGATGAATCATTCAATACTTTATTTATTAGTGTACTTGTACATAGATT TGATACCCAAAAATAAAAAATGTACATTGTGCACCTTTAACGTACATTAT GAACATATCATAACTAAAACTGTAAATCAATTTCTTACAGGTCTGAAGGA AAGAAATCGAAATTATTCATCCTGGAGAAAAGAACATAAAGCTTTTGTGA CATTGGGGATTGTAATGGGTGCTTTCCTTCTATGCTGGGTCCCATTTTTT ACATGGTAAGTATGAAAAATAAATATAAAGATTTAAATTATTTCTAGAGT TGTATTGGTACTTGATATAACCCTTAACATTGGTCTCTGAAAAACGTTCC AAATTTTAAAACAAATGGCTTCGCCTTACATATATTACAGTATATTATTT CAGTTCAGCATTTAAATTAGTTAAAGAAACCCTTAATAATTTTTCATGAA TGAGAATAGTTTGTTAATTTTTTTTTCAGTGAGGCCAAATTAAAGAACTT GTTGTTCTTATAAAAGTTTATATGAAAATCGATAGCTTGATGTTGACATC ACTGATTGATACTGTTTTATGTGAGGGCATGTGCGTCTTATATAACACGT CCATAAAATTTAACAACAAATTTGAACCGATTTCAAAAATTTTGGGACCT ATACATCCATAATGAGATCTATTATTTTAATTTGTCAAATATTTTGATGT TATTTCAAAATCATAACAACGATAAATGAGTATTTTTAATATCATTGATT TTTGAACAAGTTTTTTTAAATATATACGTANNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTATATAGTACATATTATATTGATTAGTTATTT TATTTGCATCAAAGTCTTTTATTAAGTTGTTCAAACTAACAAATACAGTA ATAATTTGTTTTGTTATATCTTATTCTTAATAATATAGCTTATTGTTTCA TATTTTAAAACCAAGAATTACGAAATGAAAACTTTTCTATAAATGATAAA ATACACATTTTTAATGCAATTTAGTTAGTTTGATAGCCATACATAGTGTC GTGATTGTAAAACCTCAGCTTTAGTCTTGGTATGATCAAGTTAAGTCCTA AAACTTATAAAATTCAGTTATAGACGACGTCACTAATCTTTATTTCTTGT TTTAAATATCAGTTATATTACTGACACTCCGTGGGACTGATGGTCTTAAA GACAGGTCCCAAGGACTGACAGAATCGGCCCTAATACTGAATTAGAACAA CAAGAACTGGCACAATACTAATCACAATAGATTCAATTTATATGAAATGC GTGCATGTGAAAAAAATAAAAGATAAAAAATTGGTAACCCTGACAAATTT TTCACAGCTGTCTTTTATTGGTTAGTACTAACTAAAAAACAAGTGAATTA AAAAAAATGTACTCAGCTCTCTTCTCTATGAATTCTTGTAATAAACAGCT TAATTCCTCATAATTATATTCTATTATNGATTAATATCTTGCATCAATTC TATTATATTTTTTGTCAGTGTGAATTTTCCAAATATTTATCTAGATACAA TGAACAAATGTACATACAAGTACATATTTTAAATATATTCTAATTGTATA TAAGTATAGTAATTCAAATGTAATACATGGGTGTGTTCATAATAAGTGTA TTTTTTTTTTCACATATGCAACATATCAGAAAAACACCTTTTTTTATATC ATTCAACAAAAATGTGTTAACTTTCAAGCTAATTTTTTTTTACATCAGGA ACAACTCTGTTAGTAAGTGTCATAAGATATTAATATGCATTTGCATCAGC AAACACGCTAAGTAGGTACCGTTTTTCACAAGATAAAATCATTTTCAAAC CAAAAACAAAAGCATTCATGGGTTAAATGGAGCATTATTTTATCTAAATA TATATATTTTATAAATAAGTTTATGGGCTGGAAATTAAAATGGTCCTTAC ATTACCCACATGCAAACATTTTCAATCGTGGAATTTTTGTTGATGAACAT ATAGGGTAAACTTTTTCAACGATGAGAAGGATGAAATCATTATTAAATGT ATTACTAAATTCTCTATAGATTTATCGTTCTATTTTTCAAATAATTCCCT TTGGCTGCTACCATGACCTCAAACTGGTACCTAATCGCACTGCAGTACAT GTAGTAGAATATCCCAGACACTGCGCCTCTTGCTGCTCGACGGAGGTCTT GAAGCCTTCCATATTTTGGCAAAGGGTAGCACAGGCTCTATTCTCAACTA CAGTTTAAATGGCAGGGTCGAGAAGGGAACAGCAAGGGAGAAGGGGGGCA CAACGGACGATTTTGGTCTTTCTTTACCAGGTTGGCCTTGACTTCTGTTG AAAAAACTTGCCCAGTTCGTCGGATAAGCCTGCCCAAACCGTGCACGTAT TTCAACACTGTCCAATGACTTACATTGAGAGCATTGGAATGTTGTTTCAT CGACTTAGCCGGACTTATGGTGACCACGGTGCCTATGTTCAACATGATCC CGATTTTACGGCATTTACTGCCAGGGGACATCTCAAGACTGTGATCTGAA TTAACCATGATTTTAATCTTGTACACAAGAATCTTGGTGTATCCTATGAC ATTCATAATCTTCTTGACACTCACCTGGGTGTAGTGAAAGTCAGAAACCA TTCTCTTTTTGGCCTCCATTCTGACAAATGTAGATTTTTAAAAGTTTTTT TTTAACCTAATAAAACTAACTTATGAGCACTAAGATTAAATAATGAGGAT TTCTACATGCAGTCTGGAGGCAAACTTTGAAAAGAAAGCTAAGAATTCAG GAGCAAATTTAGGTCATTAAAGTATAGTAAAAAAAATTATGTTGAAAATT CATTCACTTTTATCATGTTTGTATCTTCTTCTATCAAATTAAAATTTAAC CCAATTTTAAATTTGTGTTGTCAACGAGATTATCTCCTTATCTCAACTAG GCTCACATCCAAAACCTGTTGATAACCCCTTTTGTAGACTGTTGATGATA TATTAATTATAAATTACAATTAATCAAGACTTAGTCCATTTGTTCATACA TAGTACCATCGCTAATCTCTTTTTTTATATATTATTCCTTATTTGGAGTA GATATATAAATCATTAAAAACATTCCTTTAAATCTCAATGATTAATTAAG ACTATATATTCATTAATATCTTAGGAACTAATTAAGTATCTCAAAAGAAA AATTAGTTACAGGAAGTATATAATAATTTATATATTTACATAGAAGGTAG AGCAAAAAATAGGATACACACATGATAATACAAGAATATTTCGGGATGGG ATTTGTGTAAGAAGGTGGGGGCTAGAAATATAGTAATACTGAATTAAGAC CATTGTTAATATCAGCTGNNNNNNNNNNNNNNNNNNNNNNNGGTTTCAAA CAGGAGAACCTTCTACATTTAAAATATTCTTAGTGCAAGGAAAATATTAT AATCATGTATAAATTTATTTGAATATATGTATATATTATTCATTATTTAA TCAATTTACACTAAAGAAAGGCAAAAATTATTTTTTTAGTGGTAGATGTG AATACCCAACGACTTATTACATAATGAACAAAACAAAAAGAAAGGGGATA TGCATCAACTTTTTTTCGTTTTATCATCGCTATATTTAGCATTTATTTAC ACATATTCCTTCTTTAGTAATATTTTTGTTTCTCTGATTCATAAATACCC CCAGGGAAGTAATGGAGTTTTCAAAAAAGCTATTTTTAATTACTAGCAAG AACTTTCTTCTTCTTGTAATTTTTCACCAATAATTTCTCAACTACCCCCT TGTTTTAAAATATACCAATCTCTGATACATGTAAAAATACGACTCTTTTC TTCAATTCCTACCAAGCCCTCACTGATGCAAAAATCAATACTGGGGGCTC AGATATCAATCAAATATATTTTTCTCTTTCAGTTACTTTTATTTTTATAT GATGAAAGTTTTTTTCTTATTTTTTACATAAATACAAATATATTTTCGCC ATTAATAAAAGCCATAAAATAATCTTATATTTCCCATATATACATATTCT CATTTATAATATAATTTTTTTTTTGTAAATGTATACCAAAAAAAAAGTTC ATTTTCTTTTTGTGAAAGAATGGAAATTTTAATTATAACCCATAATTTAA AATATTTTTACAAGAAGTGTTTTCTGCTTTGTTTTTTGTTTTTTTTAAAT AAATGGCTAGATAACATTGTTTTAAAAATATATCTTAAGTAATTAAATTA GGAACTACTAGTCACAATTAGTACACGGAGTAATTTTAAATTGGTTAACT AATTTGTGAGATATTAGGATTGATAAAAATAAAATTTTGATTAAATAGGG CCATTAATTTTTTTGCCCAAATTGTAAAATATATTTTTTAACAAAACTTT TGAACGGAAAATCAATTGTTATAATGCTTTAAAAGTATCTTCATTTAGAA GGCAGCTTCCCTACCGTGAAATTTGAATCAAATAAAGCGGAAAAAATCAA AAGTGTTATCATTTTACCTACGACTAAAATATTATAGACCGCTGAATTTT AAAAAATAATATCAAAGTGTTCCAATGTTTTTTGTTTTTTTTTCAATTGA TTGTAACTTTTAATTTTTATCTACATCGTTCCTTTATGTCGATGCATGGG TCTGAATTGAAACTACACTCTCAAATCCTGATTCTTTTTTGAATACTCTA GAGTTTTAAAATCAAATTCAATTTACCACTACTTGTATTTTAAGCACTTA AGAAAAAAATATAACTTAATGACGAGGCAAAATTTGTCAATAAAGAAGAC GTAATTATACAATGGATAATACAAAAGAATTTGATTAATTGAGCTTCTTT TTTTTTTGTACGTATTAACATTTTTCAAATTTTATAGTTTTTGTTGTATT CAACATATTTATTAAAAATATATATTTTTTTGCATTCCTGACTTTGAGCC AACACTATGGCAGACAGTAATAGTTTAAATATTGTGTCACCAATATTTTA GTCCTGATTTGAATTATAATCATGGAATTAATTTATATAAATTTGAACAG ATGAGATGCAGCTAAATATCACATGTTTGCACAGCCTTCCGTTCCCGTTT CGAGGCTGTCATTACTGCTAATACTGGCCCAGCTCTTAAAATAAATTGAT ATAAACATTTAATATTTATCTCTGTTTATGTCTAACACGTCCGAGTACAT TTAACTTCATTCGGATTTCACCAGTTCCCCTTATTTTTNCGCAATTTTAA GCACTAAAATTGCTTGGATTTCCTGATATAAAACCAACACAAATAGTTTT TTACCATAATTATATATATTATCAAAAATTGATCCGATTCGTCTAACATT ATAATAAATTATAATGTTAGACACATACTTCATTATTAATAACTTTATTC CTAAAATTAAAAAGATAATGACGAACTTTTATTGTATTTTTCAGGTACCT AACAGTAGCTATTTGTGGGGATGAGCAGTGCCCGTGCCCTCGAATAGTTG TGAGTATCCTATTTTGGATTGGATATTTTAATTCGACTCTTAATCCAGTG ATCTACGTGATGACAAACCGAGATTTCAAAGACGCTTTTTCGGACATATT ACGCAAAACCTTTTGCTGGTTTCGATCGAGGGTTGAACATTCTCAAAAGG AATGGTCCGGTATTAATACCCATTCTAATGTTGAATATGTTTGATAATAA GCACTCGCCCTCATACTTAAAGGAAATTACTTTTAGGAGTGGATGCGAGT GGTTAAAGTAGTCTTTTTATTCGTATTCATATAGTCTAATGGGKATTAAT GTAACTCTAATTATGTATTTTAACAAACTTTTAATATGTCATCCTCATAG AATTATGTTCATGGTGTAAAATATGAATTGATTCTACAAATAGCAGTTCA TTAAAAACTTAATTCCTTGTGTATTAAGCTCAAACTAAGTTGATAATTTT GTTTGTTTTTTCTTCTTTAAAAGTACTCATGTTTGATGGGATTTGTTCCT TGGATCTTCTAACATTGTCATTCGTAATTAATTGAAAAAGGAGCAGATGC AAAAATCTATGACAAAAATAGAGACTTACGTGCATTCATTAATATATTTA AAGCACATTGTTTGACACACTGATATAATTAACGATTTGCTMCMCCTTTG TGTCCTTTTTTTTTTTTTTTTGATTGGCACAAGGGATTCCTATATAGAAT TCAATGCATTTCATTTCCTTGCTTAACTACATTTTTACATAGTAAGTTTT ATTTGAGATGTGATTTATATAGAATAATTTTATATGATGTACTTTTTTTT TGTAGCATAAAATTTACTTTTTGAAAGCCTCAAATTTGTTTTTAAACTAC GATATTTAA
back to top
Add to Basket