EMLSAG00000008020, EMLSAG00000008020-690786 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000008020 vs. C. finmarchicus
Match: gi|592862879|gb|GAXK01094683.1| (TSA: Calanus finmarchicus comp49884_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.967e+0 Identity = 12/25 (48.00%), Postives = 16/25 (64.00%), Query Frame = 0 Query: 12 LQWETEKVYMWSDSKTALNWIRNGP 36 + W T K+ MW S+TALNW+ P Sbjct: 566 ILWLTLKLPMWFTSRTALNWLLLSP 640
BLAST of EMLSAG00000008020 vs. L. salmonis peptides
Match: EMLSAP00000008020 (pep:novel supercontig:LSalAtl2s:LSalAtl2s477:465728:466070:-1 gene:EMLSAG00000008020 transcript:EMLSAT00000008020 description:"snap_masked-LSalAtl2s477-processed-gene-3.22") HSP 1 Score: 131.339 bits (329), Expect = 1.715e-41 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 0 Query: 1 MTRLMKSTINALQWETEKVYMWSDSKTALNWIRNGPSFLYSEDWAGDPQDIYMNVRNDLFGF 62 MTRLMKSTINALQWETEKVYMWSDSKTALNWIRNGPSFLYSEDWAGDPQDIYMNVRNDLFGF Sbjct: 1 MTRLMKSTINALQWETEKVYMWSDSKTALNWIRNGPSFLYSEDWAGDPQDIYMNVRNDLFGF 62
BLAST of EMLSAG00000008020 vs. L. salmonis peptides
Match: EMLSAP00000004933 (pep:novel supercontig:LSalAtl2s:LSalAtl2s259:868481:870317:1 gene:EMLSAG00000004933 transcript:EMLSAT00000004933 description:"snap_masked-LSalAtl2s259-processed-gene-9.18") HSP 1 Score: 67.781 bits (164), Expect = 2.897e-16 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0 Query: 1 MTRLMKSTINALQWETEKVYMWSDSKTALNWIRN 34 MT LMKS INALQWETEKVYMWSDSKTALNWIRN Sbjct: 45 MTGLMKSIINALQWETEKVYMWSDSKTALNWIRN 78
BLAST of EMLSAG00000008020 vs. L. salmonis peptides
Match: EMLSAP00000002171 (pep:novel supercontig:LSalAtl2s:LSalAtl2s13:1011691:1012373:-1 gene:EMLSAG00000002171 transcript:EMLSAT00000002171 description:"snap_masked-LSalAtl2s13-processed-gene-10.1") HSP 1 Score: 66.6254 bits (161), Expect = 2.090e-15 Identity = 30/34 (88.24%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 1 MTRLMKSTINALQWETEKVYMWSDSKTALNWIRN 34 MTRLMKS INAL WET+KVYMWSDS TALNWIRN Sbjct: 131 MTRLMKSIINALHWETKKVYMWSDSMTALNWIRN 164
BLAST of EMLSAG00000008020 vs. L. salmonis peptides
Match: EMLSAP00000006685 (pep:novel supercontig:LSalAtl2s:LSalAtl2s371:275346:276006:1 gene:EMLSAG00000006685 transcript:EMLSAT00000006685 description:"maker-LSalAtl2s371-snap-gene-2.16") HSP 1 Score: 55.8398 bits (133), Expect = 1.231e-11 Identity = 25/30 (83.33%), Postives = 28/30 (93.33%), Query Frame = 0 Query: 1 MTRLMKSTINALQWETEKVYMWSDSKTALN 30 MTRL+KS INALQWETEK+Y+WSDSKT LN Sbjct: 156 MTRLIKSIINALQWETEKLYIWSDSKTELN 185 The following BLAST results are available for this feature:
BLAST of EMLSAG00000008020 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000008020 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 1
BLAST of EMLSAG00000008020 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 4
BLAST of EMLSAG00000008020 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000008020 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000008020 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000008020 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s477:465728..466070- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000008020-690786 ID=EMLSAG00000008020-690786|Name=EMLSAG00000008020|organism=Lepeophtheirus salmonis|type=gene|length=343bp|location=Sequence derived from alignment at LSalAtl2s477:465728..466070- (Lepeophtheirus salmonis)back to top Add to Basket
|