EMLSAG00000009301, EMLSAG00000009301-692067 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000009301
Unique NameEMLSAG00000009301-692067
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
K F93 UN14_g1154 female
  1. PreAdult2
  2. Adult
No visible phenotype
no visible phenotype
03.04.2013 - 14:51
13.05.2013 (All day)
Homology
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:nnt-1 "Protein NNT-1" species:6239 "Caenorhabditis elegans" [GO:0005739 "mitochondrion" evidence=IDA] [GO:0008746 "NAD(P)+ transhydrogenase activity" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 GO:GO:0016021 GO:GO:0005739 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0015992 EMBL:FO080555 eggNOG:COG1282 GeneTree:ENSGT00390000004624 HOGENOM:HOG000160623 KO:K00323 OMA:KPGIPYK OrthoDB:EOG722J7T GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 PIR:T15521 RefSeq:NP_509028.1 UniGene:Cel.30607 ProteinModelPortal:Q18031 SMR:Q18031 STRING:6239.C15H9.1 PaxDb:Q18031 PRIDE:Q18031 EnsemblMetazoa:C15H9.1 GeneID:180884 KEGG:cel:CELE_C15H9.1 UCSC:C15H9.1 CTD:180884 WormBase:C15H9.1 InParanoid:Q18031 NextBio:911404 PRO:PR:Q18031 Uniprot:Q18031)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 287/513 (55.95%), Postives = 367/513 (71.54%), Query Frame = 0
Query:    1 MVVLNRTSFKNVFLLLGKRSFSDGKKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLK---DSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGG 510
            MV+L R+    ++     R FS+G+K I Y+ +++ VPKE +  EKRV++ P+ V  L K G  V +E  AG L+ + N +Y   GA++    E F+ DI+LK+R P+  E    +    L SFI+P QNQ L+  L+K + TVF MDCVPRISRAQVFDALSSM+NI+GYRAV+EA+N+FGRFFTGQITAAGKVPPAKVLVIGGGVAGL+A+G ++ MGA+VR FD R +VKE +ES+G +FLTVN+ EDG   GGYAKEMSKEF+DAEMKLF +QCKD+DI+I+TALIPGKKAPILI + M+  MKPGSV+VDLA+E+GGN+ TT PGE+ V +GVTHIGFTDLPSRL TQ+S LY NNI+K LL +  G    F+V+  D+V RG++V+  G + WPP P         K+     S+ T  +P  L  + K    ++L T+GLG +  LG+   NP   +M+ TF L+ +VGY TVW V PALHSPLMSVTNAISG TA G L LMGGG
Sbjct:    1 MVIL-RSKITRLYWF---RLFSNGQKKIEYSKLKVAVPKEIFPGEKRVSLSPNGVALLKKNGISVLIEENAGVLAGYSNEEYVRSGADVGKHNEVFNTDIMLKVRPPTENEVSKLKSGCTLISFIHPGQNQALLDSLTKTDKTVFAMDCVPRISRAQVFDALSSMANIAGYRAVIEAANHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLSAIGTSRGMGAVVRGFDTRAAVKEHVESLGAQFLTVNVKEDGEGGGGYAKEMSKEFIDAEMKLFADQCKDVDIIITTALIPGKKAPILITEEMIKSMKPGSVVVDLAAESGGNIATTRPGEVYVKHGVTHIGFTDLPSRLPTQSSELYSNNIAKFLLHL--GKDKTFFVNEEDEVARGALVVRDGQMKWPPPPINFPPPAAPKSDKP--SENTALVP--LTPFRKTANQTLLLTSGLGSVSLLGIAGTNPQISSMSTTFALAGLVGYHTVWGVTPALHSPLMSVTNAISGTTAAGALCLMGGG 503          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:NNT "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA] [GO:0072593 "reactive oxygen species metabolic process" evidence=IEA] InterPro:IPR008142 InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 PROSITE:PS00837 InterPro:IPR016040 GO:GO:0016021 Gene3D:3.40.50.720 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0015992 CTD:23530 GeneTree:ENSGT00390000004624 KO:K00323 OrthoDB:EOG722J7T TreeFam:TF300636 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:AC186351 RefSeq:XP_004937277.1 RefSeq:XP_004937278.1 RefSeq:XP_004937279.1 Ensembl:ENSGALT00000023990 GeneID:427196 KEGG:gga:427196 PRO:PR:E1C6A1 Uniprot:E1C6A1)

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 286/504 (56.75%), Postives = 362/504 (71.83%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQP------SLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISV---AAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y  VGA I   KE  ++D+++K+R P       + EA LF+    L SFIYPAQN  L+++L++   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+N+FGRFFTGQITAAGKVPPAKVL+IGGGVAGLA+ G AKSMGA+VR FD R +  EQ +S+G E L V+I E G   GGYAKEMSKEF++AEMKLF  QC+D+DI+I+TALIPGKKAP+L KK M++ MK GSV+VDLA+EAGGN+ETT PGEL V+ GVTHIG+TDLPSR++TQASTLY NNI KLL +++   K +FY D  D         V+RG++V+  G + +P  PP ++   A V  K      ++K   +  +       SV YTTGL  ++ LG+VSPN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TAVGGL+LMGG Y
Sbjct:   49 KPGIPYKQLTVGVPKEIFENEKRVALSPAGVQALVKQGFNVVVESGAGEASKFSDDHYREVGAKIQGTKEVLASDVIVKVRAPMHNPALGVHEADLFKTAPTLISFIYPAQNPDLLKKLAEKRTTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKVLIIGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDIKESGEGQGGYAKEMSKEFIEAEMKLFAKQCQDVDIIITTALIPGKKAPVLFKKDMIESMKEGSVVVDLAAEAGGNIETTKPGELYVHKGVTHIGYTDLPSRMATQASTLYSNNIIKLLKAISP-DKENFYFDPKDQFDYGTLDHVIRGTVVMKDGKVIFPAPPPNNIPQGAPVKPKTVAELEAEKAATITPFRKTMTSASV-YTTGLASMLGLGIVSPNTAFTQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLVLMGGTY 550          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:NNT "NAD(P) transhydrogenase, mitochondrial" species:9913 "Bos taurus" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA] [GO:0072593 "reactive oxygen species metabolic process" evidence=IEA] InterPro:IPR008142 InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 PROSITE:PS00837 GO:GO:0016021 GO:GO:0005743 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0072593 GO:GO:0015992 EMBL:BC114660 EMBL:J03534 EMBL:M22754 EMBL:L02543 PIR:A31670 RefSeq:NP_776368.1 RefSeq:XP_005221585.1 RefSeq:XP_005221586.1 RefSeq:XP_005221587.1 UniGene:Bt.5120 PDB:1D4O PDBsum:1D4O ProteinModelPortal:P11024 SMR:P11024 STRING:9913.ENSBTAP00000049955 TCDB:3.D.2.3.1 PaxDb:P11024 PRIDE:P11024 Ensembl:ENSBTAT00000015769 GeneID:280878 KEGG:bta:280878 CTD:23530 eggNOG:COG1282 GeneTree:ENSGT00390000004624 HOGENOM:HOG000160623 HOVERGEN:HBG006511 InParanoid:P11024 KO:K00323 OMA:KPGIPYK OrthoDB:EOG722J7T TreeFam:TF300636 EvolutionaryTrace:P11024 NextBio:20805016 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 Uniprot:P11024)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 284/502 (56.57%), Postives = 358/502 (71.31%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSL------KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISV---AAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGG 509
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y + GA I   KE  ++D+V+K+R P L       EA L +    L SFIYPAQN  L+ +LSK   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGAIVR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAPIL  K M++ MK GSV+VDLA+EAGGN ETT PGEL V+ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +FY +V DD        V+RG++V+  G + +P   P ++   A V  K      ++K   +  +       SV YT GL G++ LG+ +PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TAVGGL+LMGG
Sbjct:   49 KPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFSDDHYRAAGAQIQGAKEVLASDLVVKVRAPMLNPTLGVHEADLLKTSGTLISFIYPAQNPDLLNKLSKRKTTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPILFNKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFYFEVKDDFDFGTMGHVIRGTVVMKDGQVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMTSASV-YTAGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLVLMGG 548          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:Nnt "Nicotinamide nucleotide transhydrogenase" species:10116 "Rattus norvegicus" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA] [GO:0072593 "reactive oxygen species metabolic process" evidence=IEA] InterPro:IPR008142 InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 PROSITE:PS00837 RGD:1587346 GO:GO:0016021 GO:GO:0005743 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0072593 GO:GO:0015992 CTD:23530 eggNOG:COG1282 GeneTree:ENSGT00390000004624 HOGENOM:HOG000160623 HOVERGEN:HBG006511 KO:K00323 OMA:KPGIPYK OrthoDB:EOG722J7T TreeFam:TF300636 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:AABR06013123 EMBL:AABR06013124 EMBL:AABR06013125 EMBL:AABR06013126 EMBL:AABR06013127 EMBL:AABR06013128 EMBL:AABR06013129 EMBL:AABR06013130 EMBL:BC091271 RefSeq:NP_001013175.1 RefSeq:XP_006232030.1 RefSeq:XP_006232031.1 RefSeq:XP_006232032.1 RefSeq:XP_006232033.1 RefSeq:XP_006232034.1 UniGene:Rn.3128 STRING:10116.ENSRNOP00000029578 Ensembl:ENSRNOT00000033627 GeneID:310378 KEGG:rno:310378 InParanoid:Q5BJZ3 NextBio:661925 PRO:PR:Q5BJZ3 Genevestigator:Q5BJZ3 Uniprot:Q5BJZ3)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 279/507 (55.03%), Postives = 361/507 (71.20%), Query Frame = 0
Query:   22 SDGKKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSL------KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMY---LKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            S  K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y + GA I   KE  ++D+V+K+R P +       EA   +    L SFIYPAQN  L+ +LS+   TV  MD VPR++ AQ +DALSSM+NISGY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGA+VR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAP+L  K M++ MK GSV+VDLA+EAGGN ETT PGEL V+ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +F+ +V DD        V+RG++V+  G + +P   P ++         T    + EK    ++MY   L+ + +Y+ GL G++ LG+V+PN AF  M  TFGL+ ++GY TVW V PALHSPLMSVTNAISG+TAVGGL LMGG +
Sbjct:   46 SPAKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFPDDLYRAAGAQIQGTKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNPDLLNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFHFEVKDDFDFGTMSHVIRGTVVMKDGNVIFPAPTPKNIPKEAPAKQKTVAELEAEK-AGTVSMYTKTLRTASVYSAGLTGMLGLGIVAPNLAFSQMVTTFGLAGIIGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGGHF 550          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:Nnt "nicotinamide nucleotide transhydrogenase" species:10116 "Rattus norvegicus" [GO:0005739 "mitochondrion" evidence=ISO] [GO:0005743 "mitochondrial inner membrane" evidence=IEA;ISO] [GO:0008746 "NAD(P)+ transhydrogenase activity" evidence=ISO] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA;ISO] [GO:0072593 "reactive oxygen species metabolic process" evidence=IEA;ISO] InterPro:IPR008142 InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 PROSITE:PS00837 RGD:1587346 GO:GO:0016021 GO:GO:0005743 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0072593 GO:GO:0015992 CTD:23530 eggNOG:COG1282 GeneTree:ENSGT00390000004624 HOGENOM:HOG000160623 HOVERGEN:HBG006511 KO:K00323 OMA:KPGIPYK OrthoDB:EOG722J7T TreeFam:TF300636 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:AABR06013123 EMBL:AABR06013124 EMBL:AABR06013125 EMBL:AABR06013126 EMBL:AABR06013127 EMBL:AABR06013128 EMBL:AABR06013129 EMBL:AABR06013130 EMBL:BC091271 RefSeq:NP_001013175.1 RefSeq:XP_006232030.1 RefSeq:XP_006232031.1 RefSeq:XP_006232032.1 RefSeq:XP_006232033.1 RefSeq:XP_006232034.1 UniGene:Rn.3128 STRING:10116.ENSRNOP00000029578 Ensembl:ENSRNOT00000033627 GeneID:310378 KEGG:rno:310378 InParanoid:Q5BJZ3 NextBio:661925 PRO:PR:Q5BJZ3 Genevestigator:Q5BJZ3 Uniprot:Q5BJZ3)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 279/507 (55.03%), Postives = 361/507 (71.20%), Query Frame = 0
Query:   22 SDGKKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSL------KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMY---LKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            S  K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y + GA I   KE  ++D+V+K+R P +       EA   +    L SFIYPAQN  L+ +LS+   TV  MD VPR++ AQ +DALSSM+NISGY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGA+VR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAP+L  K M++ MK GSV+VDLA+EAGGN ETT PGEL V+ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +F+ +V DD        V+RG++V+  G + +P   P ++         T    + EK    ++MY   L+ + +Y+ GL G++ LG+V+PN AF  M  TFGL+ ++GY TVW V PALHSPLMSVTNAISG+TAVGGL LMGG +
Sbjct:   46 SPAKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFPDDLYRAAGAQIQGTKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNPDLLNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFHFEVKDDFDFGTMSHVIRGTVVMKDGNVIFPAPTPKNIPKEAPAKQKTVAELEAEK-AGTVSMYTKTLRTASVYSAGLTGMLGLGIVAPNLAFSQMVTTFGLAGIIGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGGHF 550          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:NNT "NAD(P) transhydrogenase, mitochondrial" species:9606 "Homo sapiens" [GO:0003957 "NAD(P)+ transhydrogenase (B-specific) activity" evidence=TAS] [GO:0005739 "mitochondrion" evidence=IDA] [GO:0005743 "mitochondrial inner membrane" evidence=TAS] [GO:0005746 "mitochondrial respiratory chain" evidence=TAS] [GO:0006099 "tricarboxylic acid cycle" evidence=TAS] [GO:0008746 "NAD(P)+ transhydrogenase activity" evidence=EXP] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=TAS] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0044237 "cellular metabolic process" evidence=TAS] [GO:0044281 "small molecule metabolic process" evidence=TAS] [GO:0050661 "NADP binding" evidence=IDA] [GO:0051287 "NAD binding" evidence=TAS] [GO:0055114 "oxidation-reduction process" evidence=TAS] [GO:0072593 "reactive oxygen species metabolic process" evidence=IMP] [GO:1902600 "hydrogen ion transmembrane transport" evidence=TAS] Reactome:REACT_111217 InterPro:IPR008142 InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 PROSITE:PS00837 GO:GO:0016021 GO:GO:0044281 DrugBank:DB00157 GO:GO:0051287 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0006099 Orphanet:361 GO:GO:0072593 GO:GO:0005746 CTD:23530 eggNOG:COG1282 HOGENOM:HOG000160623 HOVERGEN:HBG006511 KO:K00323 OMA:KPGIPYK OrthoDB:EOG722J7T TreeFam:TF300636 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:U40490 EMBL:Z50101 EMBL:AL831822 EMBL:BC110543 PIR:G02257 RefSeq:NP_036475.3 RefSeq:NP_892022.2 RefSeq:XP_005248331.1 UniGene:Hs.482043 PDB:1DJL PDB:1PT9 PDB:1U31 PDBsum:1DJL PDBsum:1PT9 PDBsum:1U31 ProteinModelPortal:Q13423 SMR:Q13423 BioGrid:117076 IntAct:Q13423 MINT:MINT-3027647 STRING:9606.ENSP00000264663 PhosphoSite:Q13423 DMDM:51338801 PaxDb:Q13423 PeptideAtlas:Q13423 PRIDE:Q13423 DNASU:23530 Ensembl:ENST00000264663 Ensembl:ENST00000344920 GeneID:23530 KEGG:hsa:23530 UCSC:uc003joe.3 GeneCards:GC05P043638 H-InvDB:HIX0032203 HGNC:HGNC:7863 HPA:CAB004975 HPA:HPA004829 MIM:607878 MIM:614736 neXtProt:NX_Q13423 PharmGKB:PA31667 InParanoid:Q13423 PhylomeDB:Q13423 EvolutionaryTrace:Q13423 GeneWiki:NNT_(gene) GenomeRNAi:23530 NextBio:46004 PRO:PR:Q13423 ArrayExpress:Q13423 Bgee:Q13423 CleanEx:HS_NNT Genevestigator:Q13423 GO:GO:0003957 Uniprot:Q13423)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 278/501 (55.49%), Postives = 352/501 (70.26%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQP------SLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNY--LNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGG 509
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y   GA I   KE  ++D+V+K+R P       + EA L +    L SFIYPAQN  L+ +LS+   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGAIVR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAP+L  K M++ MK GSV+VDLA+EAGGN ETT PGEL ++ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +FY DV DD        V+RG++V+  G + +P   P ++         T    + EK          +  +  YT GL G++ LG+ +PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TAVGGL LMGG
Sbjct:   49 KPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGTLISFIYPAQNPELLNKLSQRKTTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFNKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYIHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFYFDVKDDFDFGTMGHVIRGTVVMKDGKVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMSTASAYTAGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGG 548          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:Nnt "nicotinamide nucleotide transhydrogenase" species:10090 "Mus musculus" [GO:0005739 "mitochondrion" evidence=IDA] [GO:0005743 "mitochondrial inner membrane" evidence=IDA] [GO:0008746 "NAD(P)+ transhydrogenase activity" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR008142 InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 PROSITE:PS00837 MGI:MGI:109279 GO:GO:0016021 GO:GO:0005743 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0072593 GO:GO:0015992 HOVERGEN:HBG006511 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:Z49204 EMBL:AF257157 EMBL:AF257137 EMBL:AF257138 EMBL:AF257139 EMBL:AF257140 EMBL:AF257141 EMBL:AF257142 EMBL:AF257143 EMBL:AF257144 EMBL:AF257145 EMBL:AF257146 EMBL:AF257147 EMBL:AF257148 EMBL:AF257149 EMBL:AF257150 EMBL:AF257151 EMBL:AF257152 EMBL:AF257153 EMBL:AF257154 EMBL:AF257155 EMBL:AF257156 PIR:S54876 UniGene:Mm.132584 ProteinModelPortal:Q61941 SMR:Q61941 MINT:MINT-1841613 PhosphoSite:Q61941 PRIDE:Q61941 ChiTaRS:NNT PRO:PR:Q61941 CleanEx:MM_NNT Genevestigator:Q61941 Uniprot:Q61941)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 278/504 (55.16%), Postives = 359/504 (71.23%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSL------KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMY---LKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y + GA I   KE  ++D+V+K+R P +       EA   +    L SFIYPAQN  L+ +LS+   TV  MD VPR++ AQ +DALSSM+NISGY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGA+VR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAP+L  K M++ MK GSV+VDLA+EAGGN ETT PGEL V+ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +F+ +V DD        V+RG++V+  G + +P   P ++         T    + EK    ++MY   L  + +Y+ GL G++ LG+V+PN AF  M  TFGL+ ++GY TVW V PALHSPLMSVTNAISG+TAVGGL LMGG +
Sbjct:   49 KPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFPDDLYRAAGAQIQGMKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNPDLLNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFHFEVKDDFDFGTMSHVIRGTVVMKDGKVIFPAPTPKNIPEEAPVKPKTVAELEAEK-AGTVSMYTKTLTTASVYSAGLTGMLGLGIVAPNVAFSQMVTTFGLAGIIGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGGHF 550          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:nnt "nicotinamide nucleotide transhydrogenase" species:7955 "Danio rerio" [GO:0050661 "NADP binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0008746 "NAD(P)+ transhydrogenase activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] InterPro:IPR008142 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 InterPro:IPR016040 ZFIN:ZDB-GENE-040426-2592 GO:GO:0016021 Gene3D:3.40.50.720 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0015992 CTD:23530 GeneTree:ENSGT00390000004624 HOGENOM:HOG000160623 HOVERGEN:HBG006511 KO:K00323 OMA:KPGIPYK OrthoDB:EOG722J7T TreeFam:TF300636 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:BX927162 EMBL:CR387923 EMBL:BC066499 EMBL:BC155745 RefSeq:NP_999921.1 UniGene:Dr.17927 Ensembl:ENSDART00000037664 GeneID:406619 KEGG:dre:406619 InParanoid:Q6NYQ7 NextBio:20818163 PRO:PR:Q6NYQ7 Uniprot:Q6NYQ7)

HSP 1 Score: 535.413 bits (1378), Expect = 1.522e-177
Identity = 288/501 (57.49%), Postives = 361/501 (72.06%), Query Frame = 0
Query:   27 GIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSL------KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVN--------DDVVRGSIVLNQGVISWP-PKPP-ISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            GIPY  + +GVPKE +  E+RVA+ P+ VE L+K+GF V VE+ AG  + F +  Y   GA I D K+ FS+D++LK+R P L       EA L  + A L SFIYPAQN  L+  LS+   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+NNFGRFFTGQITAAGKVPPAKVL+IGGGVAGLAA G A++MGAIVR FD R +  EQ +S+G E L V+I E G   GGYAKEMSKEF++AEMKLF  QC D+DI+I+TALIPG+KAP+LI K MV+ MK GSV+VDLA+EAGGN+ETTVPGELSV+ GV H+G+TD+PSRL TQASTLY NNI+KL+ +++   K  FY DV         D V+RGS+V+  G + +P P+P  + VAA P + +   + K+     +     L  + +YT GLG  + LG+ +PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TAVGGL LMGGGY
Sbjct:   47 GIPYKQLTVGVPKEIFQNERRVAISPAGVEALIKQGFNVVVESGAGESAKFSDDMYTKAGATIRDVKDVFSSDVLLKVRAPMLNPTLGVHEASLMSEGATLVSFIYPAQNPELMDTLSQRKATVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANNFGRFFTGQITAAGKVPPAKVLIIGGGVAGLAAAGSARAMGAIVRGFDTRAAALEQFKSLGAEPLEVDIKESGEGQGGYAKEMSKEFIEAEMKLFAKQCLDVDIIITTALIPGRKAPVLITKEMVETMKDGSVVVDLAAEAGGNIETTVPGELSVHKGVIHVGYTDIPSRLPTQASTLYSNNITKLIRAISP-DKETFYFDVKNEFDFGTMDHVIRGSVVMQDGKVLFPAPQPQNVPVAAPPKQKTVQELQKEKASAVSPFRATLTTAGVYTGGLGTAIGLGLCAPNAAFTQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLSLMGGGY 546          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:NNT "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0005743 "mitochondrial inner membrane" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA] [GO:0072593 "reactive oxygen species metabolic process" evidence=IEA] InterPro:IPR008142 InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00836 PROSITE:PS00837 GO:GO:0016021 GO:GO:0005743 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0072593 GO:GO:0015992 CTD:23530 GeneTree:ENSGT00390000004624 KO:K00323 OMA:KPGIPYK OrthoDB:EOG722J7T TreeFam:TF300636 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:AAEX03003134 RefSeq:XP_536481.3 Ensembl:ENSCAFT00000029455 GeneID:479342 KEGG:cfa:479342 Uniprot:F1PLG2)

HSP 1 Score: 533.102 bits (1372), Expect = 1.584e-176
Identity = 284/503 (56.46%), Postives = 353/503 (70.18%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQP------SLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWP-PKP---PISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGG 509
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y + GA I   KE  ++D+V+K+R P       + EA L +    L SFIYPAQN  L+ +LSK   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGAIVR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAP+L  K M++ MK GSV+VDLA+EAGGN ETT PGEL V+ GVTHIG+TDLPSR++TQASTLY NNI+KLL +++   K +FY +V DD        V+RG++V+  G + +P P P   P      P   +     K     P    M       YT GL G++ LG+V+PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TAVGGL LMGG
Sbjct:   51 KPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFSVVVESGAGEASKFSDDHYRAAGAQIQGVKEVMASDLVVKVRAPMVNPTLGVHEADLLKTSGTLISFIYPAQNPDLLNKLSKRKTTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYVHKGVTHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFYFEVKDDFDFGTMGHVIRGTVVMKDGEVIFPAPTPKNIPQGAPVKPKTVAELEAEKAATVTPFRKTMSTASG--YTAGLTGILGLGLVAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGG 550          
BLAST of EMLSAG00000009301 vs. GO
Match: - (symbol:si:ch1073-139a18.1 "si:ch1073-139a18.1" species:7955 "Danio rerio" [GO:0055114 "oxidation-reduction process" evidence=IEA] [GO:0008746 "NAD(P)+ transhydrogenase activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0008750 "NAD(P)+ transhydrogenase (AB-specific) activity" evidence=IEA] [GO:0050661 "NADP binding" evidence=IEA] [GO:0015992 "proton transport" evidence=IEA] InterPro:IPR008143 InterPro:IPR012136 InterPro:IPR026255 Pfam:PF02233 PROSITE:PS00837 InterPro:IPR016040 ZFIN:ZDB-GENE-091204-5 GO:GO:0016021 Gene3D:3.40.50.720 GO:GO:0050661 InterPro:IPR007886 InterPro:IPR007698 Pfam:PF01262 Pfam:PF05222 SMART:SM01002 SMART:SM01003 GO:GO:0015992 GeneTree:ENSGT00390000004624 OrthoDB:EOG722J7T TreeFam:TF300636 GO:GO:0008750 InterPro:IPR024605 Pfam:PF12769 TIGRFAMs:TIGR00561 EMBL:CU929075 Ensembl:ENSDART00000136189 OMA:XGITHIG Bgee:E9QDE7 Uniprot:E9QDE7)

HSP 1 Score: 495.352 bits (1274), Expect = 3.618e-165
Identity = 274/507 (54.04%), Postives = 349/507 (68.84%), Query Frame = 0
Query:   17 GKRSFSDGK--------KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQP------SLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSK-------GHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEK--LPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITA 500
            GKR F  G+        +G+ Y  + +GVPKE +  E+RV+V P+ VE LVK+GF V VE+ AG  + F +  Y + GA I D   A ++ +VLK+R P       + EA+L    + L SFIYPAQN  L+Q LS+   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+N+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAA G AKSMGAIVR FD RP+  EQ +S G E L V+I+E G   GGYAKEMSKEFL+AEM LF  QC+D+DI+ISTALIPGK+AP+LIK+ MV+ M+ GSV+VDLA+EAGGN+ETT PGEL V+ GVTHIG+TDLPSR++TQAS+LY NNI KLL +++   +         F     D V+RG++V+ QG   +P   P +    P     +    + EK  + +     +  + +YT GL  ++ LG+ SPN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TA
Sbjct:   17 GKRFFQTGRIVCDQQTQRGVRYKDVVVGVPKEIFPSERRVSVSPAGVELLVKQGFSVCVESGAGAAAQFSDEQYRAAGAKITDTHTALASHLVLKVRAPVFNDALRVHEAELLSPGSTLVSFIYPAQNPELLQMLSQKQSTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAAGAAKSMGAIVRGFDTRPAALEQFKSFGAEPLEVHIAESGEGVGGYAKEMSKEFLEAEMSLFAKQCRDVDIIISTALIPGKRAPVLIKREMVESMRDGSVVVDLAAEAGGNIETTKPGELYVHQGVTHIGYTDLPSRMATQASSLYSNNIIKLLKAISPDKEFFNFEPTDEFDYGTLDHVIRGTMVMKQGQNLFPAPLPKTTPPPPPAKQKSVAELEAEKRAVISPFRRTMTSAGVYTAGLSTVLGLGIASPNAAFTQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTA 523          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592892707|gb|GAXK01065668.1| (TSA: Calanus finmarchicus comp5644_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 337/477 (70.65%), Postives = 389/477 (81.55%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPXXXXXXXXXXXXXXXXXXXXSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPIS-VAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAV 501
            KG PY+ + +GVP ETW  E+RVA  P+    L K+GF V+V+  AG LSNFR+ D+ + GANI+ K+ AF  DI LKLRQPS++E KLFRDE ILYSF+YP QN  LIQ L+   +T FGMDCVPRISRAQVFDALSSM NISGYRAVVEASN+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRP+VKEQ+ESMG EFL V+I EDGS+ GGYAKEMSKEF++AEMKLFH+QCKD+DI+I+TALIPG+ APILIKKYMVDDMKPGSV+VDLA+EAGGN+ET  PGEL+VYN VTHIG+TDLPSRL TQASTLY NN+SKLLLSM  G+K H+++D+ DDVVRGSIVL++GV +WPP PPIS  A         A +    K PN  N  LK ++ YT GL  + ALG+ SPN AF  M+ T  L C+VGY TVW+VVPALHSPLMSVTNAISGITAV
Sbjct:  513 KGTPYSKLNIGVPAETWTNERRVACTPAVTAMLTKKGFTVNVQEGAGRLSNFRDEDFAAAGANIIGKEAAFQQDITLKLRQPSMEEVKLFRDEGILYSFLYPGQNPELIQALADRKLTAFGMDCVPRISRAQVFDALSSMGNISGYRAVVEASNHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPAVKEQVESMGAEFLEVDIQEDGSTVGGYAKEMSKEFIEAEMKLFHDQCKDVDIVITTALIPGRTAPILIKKYMVDDMKPGSVVVDLAAEAGGNIETITPGELTVYNNVTHIGYTDLPSRLPTQASTLYSNNLSKLLLSM-QGTKDHYFLDMADDVVRGSIVLDKGVGTWPPNPPISVAAVAAPAKGAAAAAAAVVKEPNPFNDRLKQALSYTGGLATINALGVGSPNGAFTNMSTTMSLGCIVGYHTVWSVVPALHSPLMSVTNAISGITAV 1940          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592932733|gb|GAXK01025820.1| (TSA: Calanus finmarchicus comp8533089_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 54.299 bits (129), Expect = 5.284e-8
Identity = 25/40 (62.50%), Postives = 29/40 (72.50%), Query Frame = 0
Query:  466 FGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLL 505
            F L+  VGY  VW V PALH+PLM+VTNAIS I  VG +L
Sbjct:  198 FVLAIYVGYHVVWTVTPALHTPLMAVTNAISAIVIVGAML 317          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592853131|gb|GAXK01104413.1| (TSA: Calanus finmarchicus comp2313382_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 46.9802 bits (110), Expect = 1.312e-5
Identity = 42/93 (45.16%), Postives = 53/93 (56.99%), Query Frame = 0
Query:  183 RFFTGQITAAGKVPPX---XXXXXXXXXXXXXXXXXXXSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMK 272
            RFFTGQI++ GKV PA    ++    G  G   +  AK+MGA  R FDVR SVKEQ+ES             GS+ GGYA    KEF+ A++K
Sbjct:    3 RFFTGQISSVGKVLPA*VLVIVTWQSGWTGSC*LS*AKNMGASARGFDVRLSVKEQVESR------------GSTVGGYA----KEFIVAKIK 233          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592834016|gb|GAXK01123528.1| (TSA: Calanus finmarchicus comp7787016_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 34.2686 bits (77), Expect = 2.028e-1
Identity = 19/56 (33.93%), Postives = 31/56 (55.36%), Query Frame = 0
Query:  229 RPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKL-FHNQCKDIDI 283
            R  V  + E+ GG  L      DG++DG     +  EF++ E+K+  HN+CK+ D+
Sbjct:    1 REEVVSEEENRGGNVLP---QLDGNADGNADDNVVNEFVEYELKIKAHNKCKNYDV 159          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592957644|gb|GAXK01000912.1| (TSA: Calanus finmarchicus comp638978_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 32.7278 bits (73), Expect = 2.838e+0
Identity = 20/49 (40.82%), Postives = 27/49 (55.10%), Query Frame = 0
Query:   29 PYTSIRLGVPKETWIQ--EKRVAVPPSAVETLVKRGFKVSVENEAGTLS 75
            PYT +R+G PKE  I   E +   PPS     +K+  KV   N+ GT+S
Sbjct:  247 PYTRMRVGAPKEDNIYPIESKYWYPPSDYLKTIKKDVKVYANND-GTVS 390          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592957642|gb|GAXK01000914.1| (TSA: Calanus finmarchicus comp638978_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 32.7278 bits (73), Expect = 3.152e+0
Identity = 20/49 (40.82%), Postives = 27/49 (55.10%), Query Frame = 0
Query:   29 PYTSIRLGVPKETWIQ--EKRVAVPPSAVETLVKRGFKVSVENEAGTLS 75
            PYT +R+G PKE  I   E +   PPS     +K+  KV   N+ GT+S
Sbjct:  247 PYTRMRVGAPKEDNIYPIESKYWYPPSDYLKTIKKDVKVYANND-GTVS 390          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592870771|gb|GAXK01086791.1| (TSA: Calanus finmarchicus comp328196_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 31.9574 bits (71), Expect = 6.140e+0
Identity = 16/46 (34.78%), Postives = 25/46 (54.35%), Query Frame = 0
Query:   43 IQEKRVAVPPSAVETLVKRGFKVSVENE-AGTLSNFRNVDYESVGA 87
            +Q K+++ PPS ++T  K G K   ENE   TL +  + D+   G 
Sbjct: 1220 LQPKKLSTPPSPIDTEEKTGSKFEAENEDDSTLDSLYHTDHSDEGQ 1357          
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Match: gi|592870772|gb|GAXK01086790.1| (TSA: Calanus finmarchicus comp328196_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 31.9574 bits (71), Expect = 6.166e+0
Identity = 16/46 (34.78%), Postives = 25/46 (54.35%), Query Frame = 0
Query:   43 IQEKRVAVPPSAVETLVKRGFKVSVENE-AGTLSNFRNVDYESVGA 87
            +Q K+++ PPS ++T  K G K   ENE   TL +  + D+   G 
Sbjct: 1220 LQPKKLSTPPSPIDTEEKTGSKFEAENEDDSTLDSLYHTDHSDEGQ 1357          
BLAST of EMLSAG00000009301 vs. L. salmonis peptides
Match: EMLSAP00000009301 (pep:novel supercontig:LSalAtl2s:LSalAtl2s595:215822:221204:1 gene:EMLSAG00000009301 transcript:EMLSAT00000009301 description:"augustus_masked-LSalAtl2s595-processed-gene-2.0")

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 511/511 (100.00%), Postives = 511/511 (100.00%), Query Frame = 0
Query:    1 MVVLNRTSFKNVFLLLGKRSFSDGKKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            MVVLNRTSFKNVFLLLGKRSFSDGKKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY
Sbjct:    1 MVVLNRTSFKNVFLLLGKRSFSDGKKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|172045566|sp|P11024.3|NNTM_BOVIN (RecName: Full=NAD(P) transhydrogenase, mitochondrial; AltName: Full=Nicotinamide nucleotide transhydrogenase; AltName: Full=Pyridine nucleotide transhydrogenase; Flags: Precursor)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 284/502 (56.57%), Postives = 358/502 (71.31%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSL------KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISV---AAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGG 509
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y + GA I   KE  ++D+V+K+R P L       EA L +    L SFIYPAQN  L+ +LSK   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGAIVR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAPIL  K M++ MK GSV+VDLA+EAGGN ETT PGEL V+ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +FY +V DD        V+RG++V+  G + +P   P ++   A V  K      ++K   +  +       SV YT GL G++ LG+ +PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TAVGGL+LMGG
Sbjct:   49 KPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFSDDHYRAAGAQIQGAKEVLASDLVVKVRAPMLNPTLGVHEADLLKTSGTLISFIYPAQNPDLLNKLSKRKTTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPILFNKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFYFEVKDDFDFGTMGHVIRGTVVMKDGQVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMTSASV-YTAGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLVLMGG 548          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|51338801|sp|Q13423.3|NNTM_HUMAN (RecName: Full=NAD(P) transhydrogenase, mitochondrial; AltName: Full=Nicotinamide nucleotide transhydrogenase; AltName: Full=Pyridine nucleotide transhydrogenase; Flags: Precursor)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 278/501 (55.49%), Postives = 352/501 (70.26%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQP------SLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNY--LNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGG 509
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y   GA I   KE  ++D+V+K+R P       + EA L +    L SFIYPAQN  L+ +LS+   TV  MD VPR++ AQ +DALSSM+NI+GY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGAIVR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAP+L  K M++ MK GSV+VDLA+EAGGN ETT PGEL ++ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +FY DV DD        V+RG++V+  G + +P   P ++         T    + EK          +  +  YT GL G++ LG+ +PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISG+TAVGGL LMGG
Sbjct:   49 KPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGTLISFIYPAQNPELLNKLSQRKTTVLAMDQVPRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFNKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYIHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFYFDVKDDFDFGTMGHVIRGTVVMKDGKVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMSTASAYTAGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGG 548          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|51338804|sp|Q61941.2|NNTM_MOUSE (RecName: Full=NAD(P) transhydrogenase, mitochondrial; AltName: Full=Nicotinamide nucleotide transhydrogenase; AltName: Full=Pyridine nucleotide transhydrogenase; Flags: Precursor)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 278/504 (55.16%), Postives = 359/504 (71.23%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSL------KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDD--------VVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMY---LKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            K GIPY  + +GVPKE +  EKRVA+ P+ V+ LVK+GF V VE+ AG  S F +  Y + GA I   KE  ++D+V+K+R P +       EA   +    L SFIYPAQN  L+ +LS+   TV  MD VPR++ AQ +DALSSM+NISGY+AVV A+N+FGRFFTGQITAAGKVPPAK+L++GGGVAGLA+ G AKSMGA+VR FD R +  EQ +S+G E L V++ E G   GGYAKEMSKEF++AEMKLF  QCK++DILISTALIPGKKAP+L  K M++ MK GSV+VDLA+EAGGN ETT PGEL V+ G+THIG+TDLPSR++TQASTLY NNI+KLL +++   K +F+ +V DD        V+RG++V+  G + +P   P ++         T    + EK    ++MY   L  + +Y+ GL G++ LG+V+PN AF  M  TFGL+ ++GY TVW V PALHSPLMSVTNAISG+TAVGGL LMGG +
Sbjct:   49 KPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQALVKQGFNVVVESGAGEASKFPDDLYRAAGAQIQGMKEVLASDLVVKVRAPMVNPTLGAHEADFLKPSGTLISFIYPAQNPDLLNKLSERKTTVLAMDQVPRVTIAQGYDALSSMANISGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGLASAGAAKSMGAVVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEMKLFAQQCKEVDILISTALIPGKKAPVLFSKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYVHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISP-DKDNFHFEVKDDFDFGTMSHVIRGTVVMKDGKVIFPAPTPKNIPEEAPVKPKTVAELEAEK-AGTVSMYTKTLTTASVYSAGLTGMLGLGIVAPNVAFSQMVTTFGLAGIIGYHTVWGVTPALHSPLMSVTNAISGLTAVGGLALMGGHF 550          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|266809|sp|P07001.2|PNTA_ECOLI (RecName: Full=NAD(P) transhydrogenase subunit alpha; AltName: Full=Nicotinamide nucleotide transhydrogenase subunit alpha; AltName: Full=Pyridine nucleotide transhydrogenase subunit alpha)

HSP 1 Score: 474.167 bits (1219), Expect = 8.918e-163
Identity = 256/480 (53.33%), Postives = 325/480 (67.71%), Query Frame = 0
Query:   33 IRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGEL-SVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNP-AFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGG 510
            +R+G+P+E    E RVA  P  VE L+K GF V+VE+ AG L++F +  +   GA IV+    + ++I+LK+  P   E  L      L SFI+PAQN  L+Q+L++ N+TV  MD VPRISRAQ  DALSSM+NI+GYRA+VEA++ FGRFFTGQITAAGKVPPAKV+VIG GVAGLAA+G A S+GAIVRAFD RP VKEQ++SMG EFL ++  E+  S  GYAK MS  F+ AEM+LF  Q K++DI+++TALIPGK AP LI + MVD MK GSVIVDLA++ GGN E TVPGE+ +  NGV  IG+TDLP RL TQ+S LYG N+  LL  +     G+  VD +D V+RG  V+  G I+W P PPI V+A P  A   A   KTE+     + + K +++    L  ++   M S  P  F      F L+CVVGY  VWNV  ALH+PLMSVTNAISGI  VG LL +G G
Sbjct:    1 MRIGIPRERLTNETRVAATPKTVEQLLKLGFTVAVESGAGQLASFDDKAFVQAGAEIVEGNSVWQSEIILKVNAPLDDEIALLNPGTTLVSFIWPAQNPELMQKLAERNVTVMAMDSVPRISRAQSLDALSSMANIAGYRAIVEAAHEFGRFFTGQITAAGKVPPAKVMVIGAGVAGLAAIGAANSLGAIVRAFDTRPEVKEQVQSMGAEFLELDFKEEAGSGDGYAKVMSDAFIKAEMELFAAQAKEVDIIVTTALIPGKPAPKLITREMVDSMKAGSVIVDLAAQNGGNCEYTVPGEIFTTENGVKVIGYTDLPGRLPTQSSQLYGTNLVNLLKLLCKEKDGNITVDFDDVVIRGVTVIRAGEITW-PAPPIQVSAQPQAAQKAAPEVKTEE-KCTCSPWRKYALM---ALAIILFGWMASVAPKEFLGHFTVFALACVVGYYVVWNVSHALHTPLMSVTNAISGIIVVGALLQIGQG 475          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|75463223|sp|Q9ALA2.1|PNTA_RHOSH (RecName: Full=NAD(P) transhydrogenase subunit alpha; AltName: Full=Nicotinamide nucleotide transhydrogenase subunit alpha; AltName: Full=Pyridine nucleotide transhydrogenase subunit alpha)

HSP 1 Score: 439.499 bits (1129), Expect = 6.616e-149
Identity = 237/489 (48.47%), Postives = 313/489 (64.01%), Query Frame = 0
Query:   33 IRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAF--SADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISE--DGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVY-NGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKT--EKLPNYLNMYLKDSV----LYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGG 510
            +++G P+E +  E RVA+ P +   L K G    +E  AG  + F +  Y + G  ++    A   +ADIV+K+R P   EA+  R    L SF +PAQN  L++   +   TV  MD VPRISRAQ  DALSSM+NI+GYRAV+EA NNFGRFFTGQ+TAAGKVPPAKVLV+G GVAGLAA+G A S+GAI  AFDVRP V EQIESMG EF+ +   E  DG++ GGYA   S EF + ++  F     ++DI+I+TALIPG+ AP L  + MV  MK GSVIVDLASE GGN + TVP +  V  NGVT +G+TD PSR++ QASTLY  NI  +L  +T    G  + ++ DDV+RG+ V + G I++PP PP  VAA+ A      + + T  EK    +  + K +V    +   G   L+ +GM +P P+F A    F L+C VG+Q +WNV  +LH+PLM+VTNAISGI  +G LL +G G
Sbjct:    1 MKIGAPREIFEGEARVAMTPDSALQLQKLGHHCVIETGAGMKAGFSDEAYAAAGVEVLPSAAALFEAADIVVKVRGPERAEAERLRRGQTLISFFWPAQNAELLELCKEKGATVVAMDMVPRISRAQKMDALSSMANIAGYRAVIEAGNNFGRFFTGQVTAAGKVPPAKVLVVGAGVAGLAAIGTATSLGAITYAFDVRPEVAEQIESMGAEFVYLEFEEAQDGAATGGYAAPSSPEFREKQLAKFRELAPEMDIVITTALIPGRPAPKLWTEDMVSAMKRGSVIVDLASERGGNCDLTVPDQKIVTPNGVTIVGYTDFPSRMAAQASTLYSTNIRHMLTDLTPKKDGVIHHNMEDDVIRGATVTHDGAITFPPPPP-KVAAIAAAKPREKVKELTPEEKRAAEIATFRKQTVSQVAMLAVGTALLLFVGMYAP-PSFMAHFIVFALACFVGFQVIWNVSHSLHTPLMAVTNAISGIVILGALLQIGSG 487          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|1172547|sp|P43842.1|PNTA_HAEIN (RecName: Full=NAD(P) transhydrogenase subunit alpha; AltName: Full=Nicotinamide nucleotide transhydrogenase subunit alpha; AltName: Full=Pyridine nucleotide transhydrogenase subunit alpha)

HSP 1 Score: 432.18 bits (1110), Expect = 2.955e-146
Identity = 240/474 (50.63%), Postives = 311/474 (65.61%), Query Frame = 0
Query:   35 LGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGE-LSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTA-ISKKTEKLPNYLNMYLKDSVLYTTGLGGL-VALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLL 505
            +GVP+E    E RVA  P  V+ ++K GF V VE++AG  ++F +  +   GA I    E + +DI+ K+  P+ +E    ++ A L SFI+  QN  L+++L+   + V  MD VPRISRAQ  DALSSM+NISGYRAV+EA++ FG FFTGQITAAGKVPPAKVLVIG GVAGLAA+G A S+GAIVRAFD RP VKEQ++SMG  FL ++  E+G S  GYAK MS+EF    M+L+  Q K++DI+I+TA IPGK AP LI K MVD MKPGSVIVDLA+  GGN E T  G+ ++  N V  IG+TD PSRL TQ+S LYG N+  LL  +     G+  +D  D V+RG  V+  G     P   I V+A P + +  A +++K E  P   +  +K  V+   G+G L + L  V+P  AF +    F L+CVVGY  VWNV  ALH+PLM+VTNAISGI  VG LL
Sbjct:    3 IGVPRELLENESRVAATPKTVQQILKLGFDVIVEHDAGFKASFEDQAFLEAGAKIGTSAEIWQSDIIFKVNAPTDEEIAQMKEGAALVSFIWRMQNPELMKKLTAKKINVLAMDAVPRISRAQALDALSSMANISGYRAVIEAAHEFGSFFTGQITAAGKVPPAKVLVIGAGVAGLAAIGAANSLGAIVRAFDSRPEVKEQVQSMGASFLEIDFKEEGGSGDGYAKVMSEEFNRRAMELYAEQAKEVDIIITTAAIPGKPAPRLITKEMVDSMKPGSVIVDLAAATGGNCEYTQAGKVVTTENQVKVIGYTDFPSRLPTQSSQLYGTNLVNLLKLLCKEKDGNINIDFEDVVLRGVTVVRDG--EEIPPAQIQVSAQPKQETKAAPVAEKKESKPT--DPRVKYGVM--AGVGVLFLWLASVAP-AAFLSHFTVFVLACVVGYYVVWNVSHALHTPLMAVTNAISGIIIVGALL 469          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|91207607|sp|Q2RSB2.1|PNTAA_RHORT (RecName: Full=NAD(P) transhydrogenase subunit alpha part 1; AltName: Full=Nicotinamide nucleotide transhydrogenase subunit alpha 1; AltName: Full=Proton-translocating transhydrogenase component 1; AltName: Full=Pyridine nucleotide transhydrogenase subunit alpha 1; AltName: Full=dI >gi|91207608|sp|P0C186.1|PNTAA_RHORU RecName: Full=NAD(P) transhydrogenase subunit alpha part 1; AltName: Full=Nicotinamide nucleotide transhydrogenase subunit alpha 1; AltName: Full=Proton-translocating transhydrogenase component 1; AltName: Full=Pyridine nucleotide transhydrogenase subunit alpha 1; AltName: Full=dI)

HSP 1 Score: 287.73 bits (735), Expect = 1.126e-91
Identity = 158/377 (41.91%), Postives = 228/377 (60.48%), Query Frame = 0
Query:   33 IRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKK-EAFS-ADIVLKLRQP-----SLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVN--ISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWP 400
            +++ +PKE    E RVA+ P  V+ LV  GF+V VE  AG  ++  +    + GA I     +A S AD+V K+++P        E  L ++ A+L   +    N+ +++ L+K  +T + M+ +PRISRAQ  D LSS SN++GYRAV++ +  F R F   +TAAG VPPA+VLV G GVAGL A+  AK +GA+V A DVR + KEQ+ES+GG+F+TV+    +   + GGYAKEM +EF   + +    +    DI I+TALIPGK AP+LI + MV  MKPGSVI+DLA EAGGN   + PG++ V +GV  +G T++PSR++  AS L+  N+   L    D       + + D+ V G+ V   G I  P
Sbjct:    1 MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIASTAAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAYAMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMGEEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGNCPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLEDETVSGTCVTRDGAIVHP 377          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|6226674|sp|P41077.2|PNTAA_RICPR (RecName: Full=NAD(P) transhydrogenase subunit alpha part 1; AltName: Full=Nicotinamide nucleotide transhydrogenase subunit alpha 1; AltName: Full=Pyridine nucleotide transhydrogenase subunit alpha 1)

HSP 1 Score: 253.447 bits (646), Expect = 1.972e-78
Identity = 144/367 (39.24%), Postives = 219/367 (59.67%), Query Frame = 0
Query:   39 KETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANI--VDKKEAFSADIVLKLRQPS-----LKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLL-LSMTDGSKGHFYVDVNDDVVRGSIVLNQGVI 397
            KE    E R A+ P     L+K+G+ V+VE + G  + F + +Y +VG  I  V  +    ADI+LK+ QPS       E +  +  AI+   + P  N   I+  +K N+T F M+ VPRI++AQ  DALSS SN+ GYRAV+EAS ++ + F   ITAAG +   K LV+G GVAGL A+  AK +G+IV  +DVR + KEQ+ES+G +F++  + ED   + GYA E S ++   + K      K  +I+I+TA IPGKKAP+L+   M++ M  GSVIVD+++  GGNVE + P ++   +GVT IG  +L S++++ +S LY  N+   L  ++ DG       +++D++VR  ++   G I
Sbjct:    7 KEKVKNETRTAITPEVAGLLIKKGYAVTVEKDIGLYAGFLDEEYVAVGTKISSVPLEIISDADIILKV-QPSSVTDKYSELEFAKQGAIVVGLLSPYLNHEYIKAAAKKNLTTFAMEFVPRITKAQNMDALSSQSNLVGYRAVIEASYHYTKAFPMMITAAGTISACKTLVLGVGVAGLQAIATAKRLGSIVAGYDVRIATKEQVESLGAKFVSPELQEDLEEESGYASESSADYKAKQEKFLAKIIKGYNIVITTAQIPGKKAPMLVTDKMIESMMYGSVIVDISTSTGGNVEGSEPDKIVTRHGVTIIGLLNLASKIASDSSKLYSKNLYNFLTYALQDGQ-----FNMDDELVRDMLITKDGKI 367          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|38604654|sp|Q8CNW8.1|DHA_STAES (RecName: Full=Alanine dehydrogenase >gi|81674216|sp|Q5HNJ6.1|DHA_STAEQ RecName: Full=Alanine dehydrogenase)

HSP 1 Score: 148.673 bits (374), Expect = 5.507e-39
Identity = 115/344 (33.43%), Postives = 174/344 (50.58%), Query Frame = 0
Query:   33 IRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKK-EAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDA----LSSMSNISGYRAVVEASNNFGRFFTGQITAAGK---VPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYN-------GVTHIGFTDLPSRLSTQASTLYGNN 361
            +++G+PKE    E RV + PS V  LV +G +V VE  AG  S F + DY+  GA IVD++ +A+  D+V+K+++P   E K F++E IL+++++ A  Q L Q L  + +     + V      Q+ D     L+ MS ++G  +    +    RF  G     G    VP  KV +IGGG AG  A   A  +GA V   DV P   E++E +               DG     MS   L+ EM       K+ D++I   LIPG KAP L+ + M+ +MK GSVIVD+A + GG  ETT   +++ ++       GV H    ++P  +  + ST+  NN
Sbjct:    1 MKIGIPKEIKNNENRVGLSPSGVHALVDQGHEVLVETNAGLGSYFEDGDYQEAGAKIVDEQSKAWDVDMVIKVKEPLESEYKFFKEELILFTYLHLANEQKLTQALVDNKVISIAYETV------QLPDGSLPLLTPMSEVAGRMSTQVGAEFLQRFNGGMGILLGGIPGVPKGKVTIIGGGQAGTNAAKIALGLGAEVTILDVNPKRLEELEDL--------------FDGRVRTIMSNP-LNIEM-----YVKESDLVIGAVLIPGAKAPNLVTEDMIKEMKDGSVIVDIAIDQGGIFETT--DKITTHDNPTYTKHGVVHYAVANMPGAVP-RTSTIGLNN 315          
BLAST of EMLSAG00000009301 vs. SwissProt
Match: gi|123642815|sp|Q49YD9.1|DHA_STAS1 (RecName: Full=Alanine dehydrogenase)

HSP 1 Score: 141.739 bits (356), Expect = 2.154e-36
Identity = 111/355 (31.27%), Postives = 178/355 (50.14%), Query Frame = 0
Query:   35 LGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKK-EAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVP---PAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQC-KDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYN-------GVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHF 377
            +G+PKE    E RV++ PS V  LV++G  V VE  AG  S F +VDY   GA+IV+++ E ++ D+V+K+++P  +E + F++  IL+++++ A  + L + L ++ +     + V    R      L+ MS ++G  +    +    ++  G     G VP     +V +IGGG AG  A   A  +GA V   DV P   +++E +               DG     MS         L   QC KD D++I   LIPG KAP L+ + MV +M+ G+VIVD+A + GG  ETT    +S ++       GV H    ++P  +  + ST+  NN + L  +    SKG+ 
Sbjct:    3 IGIPKEIKNNENRVSLSPSGVHALVEQGHTVIVEKSAGLGSYFEDVDYTEAGASIVNEQAEVWNVDMVMKVKEPLEEEFQYFKEGLILFTYLHLANEEKLTRALLENKVVGIAYETVQLPDR--TLPLLTPMSEVAGRMSAQIGAEFLQKYKGGMGILLGGVPGVSKGRVSIIGGGQAGTNAAKIALGLGADVTILDVNPKRLQELEDL--------------FDGRVHTIMSN-------PLNIEQCVKDSDLVIGAVLIPGAKAPNLVTEDMVKEMRDGAVIVDIAIDQGGIFETT--DRISTHDDPTYKKHGVVHYAVANMPGAVP-RTSTIALNN-ATLPYAQQLASKGYL 330          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: gb|KFM75081.1| (NAD(P) transhydrogenase, mitochondrial, partial [Stegodyphus mimosarum])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 316/476 (66.39%), Postives = 378/476 (79.41%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAA-VPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITA 500
            +GIPY+ + +GVPKE+W  E+RVA+ P+A  TL+K+GF+V+VE +AG+ S F N DYESVGA I D   +F +DIVLK+R PS  E   FR+ +   SF+YP QNQ L++ L   +MTVF MDC+PRISRAQVFDALSSM+NI+GY+AVVEA+NNFGRFFTGQITAAGKVPPAKVLVIGGGVAGL+A+G AK+MGA+VRAFD R +VKEQ+ES G EFL +N+ E G   GGYAKEMSKEF +AEM LF  QCK+IDILI+TALIPGK AP LI K MV+ MKPGSVIVDLA+EAGGNVETT PGEL ++NGV HIG+TDLPSRL TQ+STLY NNISK LLS+  GSK HF +D++D+VVRGSIVL++G + WPP  P   AA VP K +  A++K     PNY N+  KDS++YTTGL  L+  GMVSPNPAF  M   FGLS +VGY TVW V PALHSPLMSVTNA+SGITA
Sbjct:   54 QGIPYSKLVIGVPKESWKNERRVALSPAAAATLIKKGFQVNVEKDAGSESKFSNADYESVGAKITDLSSSFQSDIVLKVRAPSATEVGKFREGSTSISFLYPGQNQDLVKSLGDRHMTVFAMDCIPRISRAQVFDALSSMANIAGYKAVVEAANNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLSAIGTAKNMGAVVRAFDTRAAVKEQVESFGAEFLELNVKESGEGVGGYAKEMSKEFYEAEMALFAKQCKEIDILITTALIPGKPAPRLISKAMVESMKPGSVIVDLAAEAGGNVETTRPGELYIHNGVIHIGYTDLPSRLPTQSSTLYANNISKFLLSI--GSKDHFNIDLSDEVVRGSIVLHEGRLLWPPPVPKETAAPVPEKPA--AVAKIQPLEPNYFNLTFKDSLMYTTGLSTLLGFGMVSPNPAFTTMMTIFGLSGIVGYHTVWGVTPALHSPLMSVTNAVSGITA 525          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: EFX83224.1 (hypothetical protein DAPPUDRAFT_315656 [Daphnia pulex])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 307/487 (63.04%), Postives = 376/487 (77.21%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLP-NYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            KGIPY ++ +GVPKE W  E+RVA+ P+    LVK+GF V++E+ AG  + FRN DY + G  + DK  AF +DIVLK+RQP   E  L ++   + SF+YPA N+ L+ ++++  +T F MD VPRISRAQVFDALSSM+NI+GYRAVVEA+N+FGRFFTGQITAAGKVPPAK+LVIGGGVAGLAA+GQAK+MGAIVRAFD R +VKEQ+ESMG EFL VNI E G   GGYAK MSKEF++AEM LF  Q K++D++I+TALIPG+KAP LI K M+D MKPGSV+VDLA+EAGGN+ETT PGE+  YN V HIG TD PSRL TQASTLY NNISK  LS+  G K H+ +++ D+VVRGSIVL  G + W P PP++V+A P  A    +++K    P +Y N+ LKD++ YT GLG L+ LG+ +PNPAF  MT T GL C+VGY TVW V PALHSPLMSVTNAISGITAVGGLL MGGGY
Sbjct:   47 KGIPYKNLSIGVPKEIWTNERRVALTPTVTAALVKKGFTVNIESGAGIEARFRNDDYAAAGGKLTDKNTAFKSDIVLKVRQPVESEIGLLKEHGNIISFLYPALNKPLVSKMAERKLTAFAMDSVPRISRAQVFDALSSMANIAGYRAVVEAANHFGRFFTGQITAAGKVPPAKILVIGGGVAGLAAIGQAKNMGAIVRAFDTRAAVKEQVESMGAEFLEVNIKESGDGAGGYAKVMSKEFIEAEMALFAKQAKEVDVIITTALIPGQKAPTLITKAMIDSMKPGSVVVDLAAEAGGNIETTKPGEIYTYNDVVHIGLTDFPSRLPTQASTLYANNISKFFLSI--GEKDHYNINLEDEVVRGSIVLKDGQLLW-PAPPVAVSAQPQAA--VKVAEKVAPPPLDYFNLTLKDALAYTGGLGTLMTLGINAPNPAFTTMTTTLGLGCIVGYHTVWGVTPALHSPLMSVTNAISGITAVGGLLQMGGGY 528          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: EAA08455.4 (AGAP003167-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 308/485 (63.51%), Postives = 374/485 (77.11%), Query Frame = 0
Query:   23 DGK-----KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKP-PISVAAVPAKASNTAISKKTEKLP-NYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITA 500
            DGK     KG+PY ++ +GVPKE W  EKRV+V P    TLVK+GFKV VE+ AG  + FR+ DYE+ GA+IVD ++AF  DIVLK+RQP   E    RD + L SF+YPAQN+ LI +L++  +  F MD +PRISRAQVFDALSSM+NISGYRAV+EA+N+F RFFTGQITAAGKVPPAK+LVIGGGVAGLAA+GQA+ MGAIVRAFD RP VKEQ+ESMG EFLT+NISEDGS+ GGY+KEMSKEF++AEM LF  QCK++D++I+TALIPGKKAP+LI + MV  MKPGSVIVDLA+E GGNV+TTVPGE+ V + V H+G TD PSRL TQ+STLY NNISK LLSM  G K HF+++  D+VVRGS+VL  G + WPP   P+S    PA A++   + K E LP +     L+ S++YT GLG L+ LG V+PN AF  M  TF +S +VGY TVW V PALHSPLMSVTNAISGITA
Sbjct:   40 DGKPATAVKGVPYQNLVIGVPKERWANEKRVSVTPVVAGTLVKKGFKVQVESGAGLNAKFRDADYEAAGASIVDGRKAFETDIVLKVRQPIEPEIPQLRDASTLISFLYPAQNKELIDKLAQRKINAFAMDAIPRISRAQVFDALSSMANISGYRAVIEAANHFPRFFTGQITAAGKVPPAKILVIGGGVAGLAAIGQARGMGAIVRAFDTRPVVKEQVESMGAEFLTINISEDGSTAGGYSKEMSKEFIEAEMALFAKQCKEVDVIITTALIPGKKAPLLITEEMVKSMKPGSVIVDLAAETGGNVQTTVPGEIKVVHDVVHVGLTDFPSRLPTQSSTLYANNISKFLLSM--GEKDHFHINPEDEVVRGSMVLQGGNLMWPPPVIPVSAKPPPAVAASKPAAIKAEALPADPFKETLRSSLMYTGGLGTLLGLGAVAPNAAFTTMMTTFAMSGIVGYHTVWGVTPALHSPLMSVTNAISGITA 522          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: gb|EFA03278.1| (NAD(P) transhydrogenase, mitochondrial-like Protein [Tribolium castaneum])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 300/486 (61.73%), Postives = 373/486 (76.75%), Query Frame = 0
Query:   19 RSFSDGK--KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPA-KASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAV 501
            R FS     +GIP+  + +GVPKE W  EKRVA+ P+  +TL K+GF V+VE  AG  + FRN DYE  G  IVDKK  F +DI+LK+RQP   E   FR+ + L SF+YPAQN++L+ +L++  +  F MDC+PRI+RAQVFDALSSM+N+SGYRAV+EA+N+F RFF+GQITAAGKVPPAK+LV+GGGVAGLAA+GQAKSMGAIVRAFD R  VKEQ+ESMG EFLT+NI E+G + GGY+KEMSKEF++AE  LF  QCK++D++I+TALIPGKKAP+LI K  V  MKPGSVIVDLA+EAGGNVETT PGE+   N +THIG TDL SRL TQ+STLY NN+SK LLSM  G K HF +++ D+VVRGSI+L +G + WPP  P+     P  K + T + +   + P  L   +KDS+L TTG+G ++ LG++SPNPAF +M  TFGLS +VGY TVW V PALHSPLMSVTNAISGITAV
Sbjct:   37 RKFSSQAVVEGIPFEKLSIGVPKELWQNEKRVALTPAVAQTLSKKGFTVNVEENAGLGAKFRNEDYEQAGGVIVDKKRTFDSDIILKVRQPLDTELGNFREGSTLISFLYPAQNKSLVDKLAERKINAFAMDCIPRITRAQVFDALSSMANVSGYRAVIEAANHFPRFFSGQITAAGKVPPAKILVVGGGVAGLAAIGQAKSMGAIVRAFDTRSVVKEQVESMGAEFLTINIEEEGGTSGGYSKEMSKEFIEAEHALFAKQCKEVDVVITTALIPGKKAPLLILKEHVLSMKPGSVIVDLAAEAGGNVETTKPGEVYSLNDITHIGLTDLSSRLPTQSSTLYANNVSKFLLSM--GEKNHFRINLADEVVRGSIILQEGKLLWPPPAPVGPPPPPPVKKTETKVQETVAESP--LMATVKDSLLCTTGIGTILGLGVLSPNPAFTSMLTTFGLSGIVGYHTVWGVTPALHSPLMSVTNAISGITAV 518          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: EEB15892.1 (NAD(P) transhydrogenase, putative [Pediculus humanus corporis])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 304/485 (62.68%), Postives = 370/485 (76.29%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGG 509
            + GIPY ++ +GVPKE W  EKRVA+ PSAV  LVK+G KV VE  AG  + FRN +YE  GA +  K   F +D++LKLRQP   E    ++   L SF+YP+QN+ L+ +LS   + VFGMDC+PRISRAQVFDALSSM+N++GYRAVVEAS++FGRFF+GQITAAGKVPPAKVLVIGGGVAGLAA+GQAK+MGAIVRAFD R  VKEQ+ES+G EFL +NI E+G + GGY+KEMSKEF+DAEM LF  Q K++D++I+TALIPGKKAP LI K  ++ MKPGSV+VDLA+EAGGN+ETT PGE+  +NGV H+G TDLPSRL TQ+STLY NNISK  LSM  G K  F +++ND+V+RGSIVL++G + WPP  P + A V          K++  +PNY    LK++   T GLG L+ALG  SPNPAF  M  TFGLS + GY TVW V PALHSPLMSVTNAISGITAVGGLLLM G
Sbjct:   42 RNGIPYENLIVGVPKEIWKNEKRVAITPSAVSVLVKKGLKVQVEENAGLEAQFRNEEYEKAGAVVTGKDGVFKSDVILKLRQPLDSEVDSLKNGTTLISFLYPSQNKDLLDKLSAKELNVFGMDCIPRISRAQVFDALSSMANVAGYRAVVEASHHFGRFFSGQITAAGKVPPAKVLVIGGGVAGLAAIGQAKNMGAIVRAFDTRSVVKEQVESLGAEFLEINIKEEGGTAGGYSKEMSKEFIDAEMALFAKQAKEVDVIITTALIPGKKAPKLILKEHIESMKPGSVVVDLAAEAGGNIETTKPGEVYNHNGVIHVGLTDLPSRLPTQSSTLYANNISKFFLSM--GEKNCFDINLNDEVIRGSIVLHKGKLMWPPPAPPAAAPVATPPKVAEEKKESLPVPNYFFNTLKEASFLTGGLGSLLALGAASPNPAFTTMMTTFGLSTIAGYYTVWGVTPALHSPLMSVTNAISGITAVGGLLLMRG 524          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: gb|EEC04253.1| (NAD(P) transhydrogenase, putative [Ixodes scapularis])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 277/461 (60.09%), Postives = 344/461 (74.62%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMT----------DGSKGHFYVDVNDDVVRGSIVLNQGVISW----PPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVV 472
            KGIPY+++ +GVPKE +  E+RVA+ P AV  L K+GF V+VE +AG  + F+N +YE+ GA I D K  + +DI+LK+R P   +    RD + L SF+YPAQN+ L+ EL+K  MTVF MD +PRISRAQVFDALSSM+NI+GY+AV+EA+N+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVG  K+MGAIVRAFD R +V+EQ+ES G EFLTVN++E G   GGYAKEMSKEF++AEM LF  QCK++DI+I+TALIPGKKAP+LI + MV+ MKPGSVIVD+A+EAGGNVETT PGEL V+NGV HIG+TDLPSR+ TQ+STLY NNISK LL                KGH+++D+ND+V+RGSI+L  G + W    P             A+ T  +KK   +P+Y    LKDS LYT GL G+V LG+VSPNPAF  MT  FGLS +V
Sbjct:   48 KGIPYSNLSVGVPKELFKNEQRVALTPIAVANLTKKGFTVNVEEQAGLAAKFKNEEYEASGARITDCKSTYQSDILLKVRAPVELDKGHLRDGSTLISFLYPAQNRALLDELAKKRMTVFAMDAIPRISRAQVFDALSSMANIAGYKAVIEAANHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGCCKNMGAIVRAFDTREAVREQVESFGAEFLTVNVAESGDGVGGYAKEMSKEFIEAEMALFAEQCKEVDIIITTALIPGKKAPLLITRQMVESMKPGSVIVDMAAEAGGNVETTRPGELHVHNGVVHIGYTDLPSRMPTQSSTLYANNISKFLLGHCYDPTFKLLWFSWPKGHYHIDLNDEVIRGSIILKDGELLWPPPPPKVVAAPPPPPTPLAAETKAAKKEVAVPDYFKATLKDSFLYTAGLAGIVGLGVVSPNPAFTTMTTIFGLSGIV 508          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: gb|KPM02534.1| (NAD(P) transhydrogenase-like protein, partial [Sarcoptes scabiei])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 281/472 (59.53%), Postives = 353/472 (74.79%), Query Frame = 0
Query:   35 LGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFS-ADIVLKLRQPSL-KEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSV--YNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLP-NYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAV 501
            +GVPKE +  E+RVA+ PS V  L K+ F V VE+ AG  S F N  YES GA I D+K  F+ +DI+LK+R P +  E +LFRD++ L S ++PAQN+ L+ EL++  M VF MDC+PRISRAQ FD LSSM+NI+GY+AV+EA+N+FGRFFTGQITAAGK+PPAKVLVIGGGVAGL+A+G AK+MGAIVR FD R +VKEQIES+G EFL ++I E G   GGYAKEMS EFL+AE +LFH QCKD+DI++STALIPGKKAP+LI K M+  MKPGSV+VDLA+E GGN+ETT P ++ +   +GV HIG TDLPSRL TQ+STLY NNISK L+SM++ S G+F++++ D+VVRGSI+   G + WPP P  +      K     +S   E LP +Y    L  +++YT GLG L+ LG V+PN AF  M  TF  + + GY TVW V PALHSPLMSVTNAISGITAV
Sbjct:   11 IGVPKEIFPNEQRVAIVPSTVIQLKKKNFTVLVEDNAGLGSKFLNDQYESSGAVITDRKNLFAESDIILKVRPPKIGDETRLFRDDSTLISLLFPAQNKDLMNELAERKMNVFAMDCIPRISRAQTFDVLSSMANIAGYKAVIEAANHFGRFFTGQITAAGKIPPAKVLVIGGGVAGLSAIGTAKNMGAIVRGFDTRSAVKEQIESLGAEFLELDIKESGEGAGGYAKEMSPEFLEAERRLFHQQCKDVDIIVSTALIPGKKAPLLISKEMIMSMKPGSVVVDLAAENGGNIETTKPNQIYIDSTSGVVHIGLTDLPSRLPTQSSTLYSNNISKFLMSMSNES-GNFHINLEDEVVRGSIIFQNGELLWPPPPSKTTVESITKEKKIIVSPPKELLPKDYFKQTLNSALIYTGGLGSLIGLGAVAPNAAFTTMATTFSFAGIAGYHTVWGVTPALHSPLMSVTNAISGITAV 481          
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Match: EFX69700.1 (hypothetical protein DAPPUDRAFT_328858 [Daphnia pulex])

HSP 1 Score: 56.6102 bits (135), Expect = 4.208e-9
Identity = 40/130 (30.77%), Postives = 60/130 (46.15%), Query Frame = 0
Query:  222 IVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVY-NGVTHIGFTDLPSRL 350
            +V     RP+V+EQ+ES+  E + V   +     G + +  S                 ID+++ TALIPGK A   +       +K GSV++DLA+ AGGN   +   E  V   GVT +   + P  L
Sbjct:    1 MVSTLGFRPAVREQVESLDAESMIVEAQQSHEDKGRFLQPFST----------------IDVVMRTALIPGKHALQSLSAKHTYLLKSGSVVIDLAAHAGGNCALSRLAETIVTPQGVTIVEEGNAPRHL 114          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|675382182|gb|KFM75081.1| (NAD(P) transhydrogenase, mitochondrial, partial [Stegodyphus mimosarum])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 316/476 (66.39%), Postives = 378/476 (79.41%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAA-VPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITA 500
            +GIPY+ + +GVPKE+W  E+RVA+ P+A  TL+K+GF+V+VE +AG+ S F N DYESVGA I D   +F +DIVLK+R PS  E   FR+ +   SF+YP QNQ L++ L   +MTVF MDC+PRISRAQVFDALSSM+NI+GY+AVVEA+NNFGRFFTGQITAAGKVPPAKVLVIGGGVAGL+A+G AK+MGA+VRAFD R +VKEQ+ES G EFL +N+ E G   GGYAKEMSKEF +AEM LF  QCK+IDILI+TALIPGK AP LI K MV+ MKPGSVIVDLA+EAGGNVETT PGEL ++NGV HIG+TDLPSRL TQ+STLY NNISK LLS+  GSK HF +D++D+VVRGSIVL++G + WPP  P   AA VP K +  A++K     PNY N+  KDS++YTTGL  L+  GMVSPNPAF  M   FGLS +VGY TVW V PALHSPLMSVTNA+SGITA
Sbjct:   54 QGIPYSKLVIGVPKESWKNERRVALSPAAAATLIKKGFQVNVEKDAGSESKFSNADYESVGAKITDLSSSFQSDIVLKVRAPSATEVGKFREGSTSISFLYPGQNQDLVKSLGDRHMTVFAMDCIPRISRAQVFDALSSMANIAGYKAVVEAANNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLSAIGTAKNMGAVVRAFDTRAAVKEQVESFGAEFLELNVKESGEGVGGYAKEMSKEFYEAEMALFAKQCKEIDILITTALIPGKPAPRLISKAMVESMKPGSVIVDLAAEAGGNVETTRPGELYIHNGVIHIGYTDLPSRLPTQSSTLYANNISKFLLSI--GSKDHFNIDLSDEVVRGSIVLHEGRLLWPPPVPKETAAPVPEKPA--AVAKIQPLEPNYFNLTFKDSLMYTTGLSTLLGFGMVSPNPAFTTMMTIFGLSGIVGYHTVWGVTPALHSPLMSVTNAVSGITA 525          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|340374316|ref|XP_003385684.1| (PREDICTED: NAD(P) transhydrogenase, mitochondrial-like [Amphimedon queenslandica])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 307/488 (62.91%), Postives = 381/488 (78.07%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPP--ISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            KGIPY  + +GVPKE++  E+RVA+ P+ V+ L K GF V VE+ AG  + F N DY++ GA+I  KKEAF++DIVLK+R PSL E  L R+ + L SF+YPAQN+ L+ +LS+  +T  GMDCVPRISRAQVFDALSSM+NI+GY+AVVEA+NNFGRFFTGQITAAGKVPPAKVLVIGGGVAGL+A+G AKSMGA+VR FD R +V+EQ++S+G EFL VN+ E G   GGYAKEMSKEF++AEM LF  QCK+IDILISTALIPGK AP LI K M++ MK GSV+VDLA+EAGGN+ TT PGEL  Y+GVTHIG+TDLPSRL TQ+STLY NN+SK LLSM +G KGHF +++ D+VVRG+IVL +G + WP  PP  +++ + P   +   +    E  P   N+ ++ S++YT GLG ++ L ++SPNPAF  M  TF LS +VGY TVW V PALHSPLMSVTNAISGITAVGGLL M GG+
Sbjct:   50 KGIPYNQLTIGVPKESFPNERRVAISPAVVQALTKVGFNVVVEDGAGEEAKFSNSDYQTSGASIKSKKEAFASDIVLKVRAPSLDEVGLLRERSNLISFLYPAQNKDLLDKLSERKITALGMDCVPRISRAQVFDALSSMANIAGYKAVVEAANNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLSAIGTAKSMGAVVRGFDTREAVREQVQSLGAEFLEVNVKEKGEGTGGYAKEMSKEFIEAEMALFAKQCKEIDILISTALIPGKPAPKLISKEMIESMKDGSVVVDLAAEAGGNIATTKPGELYRYSGVTHIGYTDLPSRLPTQSSTLYANNLSKFLLSM-EGDKGHFAINLEDEVVRGAIVLQEGKLLWPAPPPKELTMPSSPVPMAKAEVVPAAELNP--FNLTMRKSLVYTAGLGTILGLSLISPNPAFNTMVTTFTLSVIVGYHTVWGVTPALHSPLMSVTNAISGITAVGGLLCMSGGF 534          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|942412283|gb|JAN88071.1| (NAD(P) transhydrogenase, mitochondrial [Daphnia magna])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 308/486 (63.37%), Postives = 373/486 (76.75%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            KGIPY ++ +GVPKE W  E+RVA+ P+   TLVK+GF V+VE+ AG  + FRN DY + G  + DK  A  +DIVLK+RQP   E  L ++   + SF+YPA N+ L+ ++++  +T F MD +PRISRAQVFDALSSM+NI+GYRAVVEA+N+FGRFFTGQITAAGKVPPAK+LVIGGGVAGLAA+GQAK+MGAIVRAFD R +VKEQ+ESMG EFL VNI E G   GGYAK MSKEF++AEM LF  Q K++D++I+TALIPG+KAP LI K M++ MKPGSV+VDLA+EAGGN+ET  PGE+  Y  V HIG TD PSRL TQASTLY NNISK  LSM  G K HF +++ D+VVRG+IVL  G + W P PP++V+A P   +     K     P+Y NM LKDS++YT GLG L+ALGM +PNPAF  MT T GL C+VGY TVW V PALHSPLMSVTNAISGITAVGGLL MGGGY
Sbjct:  102 KGIPYKNLTIGVPKEIWSNERRVALTPAVTATLVKKGFTVNVESGAGIEARFRNDDYAAAGGKLTDKNTALKSDIVLKVRQPLETEIGLLKEHGNIISFLYPALNKPLVGKMAERKLTAFAMDAIPRISRAQVFDALSSMANIAGYRAVVEAANHFGRFFTGQITAAGKVPPAKILVIGGGVAGLAAIGQAKNMGAIVRAFDTRAAVKEQVESMGAEFLEVNIKESGDGAGGYAKVMSKEFIEAEMALFAKQAKEVDVIITTALIPGQKAPTLITKAMIESMKPGSVVVDLAAEAGGNIETIKPGEIYTYKDVVHIGLTDFPSRLPTQASTLYANNISKFFLSM--GEKDHFNINLEDEVVRGAIVLKDGQLLW-PAPPVAVSAQPQAQAAKPAEKVAPPPPDYFNMTLKDSLMYTGGLGSLMALGMNAPNPAFTTMTTTLGLGCIVGYHTVWGVTPALHSPLMSVTNAISGITAVGGLLQMGGGY 584          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|1022769340|gb|KZS13829.1| (NAD(P) transhydrogenase, mitochondrial [Daphnia magna])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 308/486 (63.37%), Postives = 373/486 (76.75%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            KGIPY ++ +GVPKE W  E+RVA+ P+   TLVK+GF V+VE+ AG  + FRN DY + G  + DK  A  +DIVLK+RQP   E  L ++   + SF+YPA N+ L+ ++++  +T F MD +PRISRAQVFDALSSM+NI+GYRAVVEA+N+FGRFFTGQITAAGKVPPAK+LVIGGGVAGLAA+GQAK+MGAIVRAFD R +VKEQ+ESMG EFL VNI E G   GGYAK MSKEF++AEM LF  Q K++D++I+TALIPG+KAP LI K M++ MKPGSV+VDLA+EAGGN+ET  PGE+  Y  V HIG TD PSRL TQASTLY NNISK  LSM  G K HF +++ D+VVRG+IVL  G + W P PP++V+A P   +     K     P+Y NM LKDS++YT GLG L+ALGM +PNPAF  MT T GL C+VGY TVW V PALHSPLMSVTNAISGITAVGGLL MGGGY
Sbjct:   44 KGIPYKNLTIGVPKEIWSNERRVALTPAVTATLVKKGFTVNVESGAGIEARFRNDDYAAAGGKLTDKNTALKSDIVLKVRQPLETEIGLLKEHGNIISFLYPALNKPLVGKMAERKLTAFAMDAIPRISRAQVFDALSSMANIAGYRAVVEAANHFGRFFTGQITAAGKVPPAKILVIGGGVAGLAAIGQAKNMGAIVRAFDTRAAVKEQVESMGAEFLEVNIKESGDGAGGYAKVMSKEFIEAEMALFAKQAKEVDVIITTALIPGQKAPTLITKAMIESMKPGSVVVDLAAEAGGNIETIKPGEIYTYKDVVHIGLTDFPSRLPTQASTLYANNISKFFLSM--GEKDHFNINLEDEVVRGAIVLKDGQLLW-PAPPVAVSAQPQAQAAKPAEKVAPPPPDYFNMTLKDSLMYTGGLGSLMALGMNAPNPAFTTMTTTLGLGCIVGYHTVWGVTPALHSPLMSVTNAISGITAVGGLLQMGGGY 526          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|1059387066|ref|XP_017768736.1| (PREDICTED: NAD(P) transhydrogenase, mitochondrial-like [Nicrophorus vespilloides] >gi|1059387068|ref|XP_017768737.1| PREDICTED: NAD(P) transhydrogenase, mitochondrial-like [Nicrophorus vespilloides] >gi|1059387070|ref|XP_017768738.1| PREDICTED: NAD(P) transhydrogenase, mitochondrial-like [Nicrophorus vespilloides])

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 311/487 (63.86%), Postives = 378/487 (77.62%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLP-NYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            KGIPY  I +GVPKE W  E+RVA+ P+   TL+K+GF V+VE  AG  + FRN DYESVG  +VD + AF+ DI+LK+RQP+  E   F+D + L SF+YPAQN+TL+ +L+   +  F MDC+PRI+RAQVFDALSSM+NISGYRAV+EA+N+F RFF+GQITAAGKVPPAK+LVIGGGVAGLAA+GQAKSMGAIVRAFD R  VKEQ+ESMG EFLT+NI+E+G S GGY+KEMSKEF+DAE  LF  QCK++DI+ISTALIPGKKAP+LI K  V  MKPGSV+VDLA+EAGGN ETT PGE+   N +THIG TDLPSRL TQ+STLY NNISK L SM  G + HF +++ D+V+RGSI+L +G + WPP  P+      A    T  + K EK   + L   +KDS+L +TG+G +++LG +SPNPAF  M  T GLS +VGY TVW V PALHSPLMSVTNAISGITAVGGLLLM GGY
Sbjct:   69 KGIPYKDITIGVPKEIWKNERRVALTPAVASTLIKKGFNVNVEAGAGAEAKFRNEDYESVGVKLVDNEGAFNTDIILKVRQPTENEVPKFKDNSTLISFLYPAQNKTLVDQLASRKINAFAMDCIPRITRAQVFDALSSMANISGYRAVIEAANHFPRFFSGQITAAGKVPPAKILVIGGGVAGLAAIGQAKSMGAIVRAFDTRSVVKEQVESMGAEFLTINITEEGGSAGGYSKEMSKEFIDAEHALFAKQCKEVDIIISTALIPGKKAPVLILKDHVLGMKPGSVVVDLAAEAGGNFETTKPGEVYQLNDITHIGLTDLPSRLPTQSSTLYANNISKFLFSM--GEENHFNINLQDEVIRGSIILEKGNLMWPPPKPVGPPPAAAAPKQTVAAVKEEKKEISPLMATVKDSLLCSTGVGTILSLGYISPNPAFTGMLTTLGLSGIVGYHTVWGVTPALHSPLMSVTNAISGITAVGGLLLMNGGY 553          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|321472254|gb|EFX83224.1| (hypothetical protein DAPPUDRAFT_315656 [Daphnia pulex])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 307/487 (63.04%), Postives = 376/487 (77.21%), Query Frame = 0
Query:   26 KGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLP-NYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            KGIPY ++ +GVPKE W  E+RVA+ P+    LVK+GF V++E+ AG  + FRN DY + G  + DK  AF +DIVLK+RQP   E  L ++   + SF+YPA N+ L+ ++++  +T F MD VPRISRAQVFDALSSM+NI+GYRAVVEA+N+FGRFFTGQITAAGKVPPAK+LVIGGGVAGLAA+GQAK+MGAIVRAFD R +VKEQ+ESMG EFL VNI E G   GGYAK MSKEF++AEM LF  Q K++D++I+TALIPG+KAP LI K M+D MKPGSV+VDLA+EAGGN+ETT PGE+  YN V HIG TD PSRL TQASTLY NNISK  LS+  G K H+ +++ D+VVRGSIVL  G + W P PP++V+A P  A    +++K    P +Y N+ LKD++ YT GLG L+ LG+ +PNPAF  MT T GL C+VGY TVW V PALHSPLMSVTNAISGITAVGGLL MGGGY
Sbjct:   47 KGIPYKNLSIGVPKEIWTNERRVALTPTVTAALVKKGFTVNIESGAGIEARFRNDDYAAAGGKLTDKNTAFKSDIVLKVRQPVESEIGLLKEHGNIISFLYPALNKPLVSKMAERKLTAFAMDSVPRISRAQVFDALSSMANIAGYRAVVEAANHFGRFFTGQITAAGKVPPAKILVIGGGVAGLAAIGQAKNMGAIVRAFDTRAAVKEQVESMGAEFLEVNIKESGDGAGGYAKVMSKEFIEAEMALFAKQAKEVDVIITTALIPGQKAPTLITKAMIDSMKPGSVVVDLAAEAGGNIETTKPGEIYTYNDVVHIGLTDFPSRLPTQASTLYANNISKFFLSI--GEKDHYNINLEDEVVRGSIVLKDGQLLW-PAPPVAVSAQPQAA--VKVAEKVAPPPLDYFNLTLKDALAYTGGLGTLMTLGINAPNPAFTTMTTTLGLGCIVGYHTVWGVTPALHSPLMSVTNAISGITAVGGLLQMGGGY 528          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|954416806|gb|KRY68635.1| (NAD(P) transhydrogenase, mitochondrial [Trichinella pseudospiralis] >gi|954497123|gb|KRZ25938.1| NAD(P) transhydrogenase, mitochondrial, partial [Trichinella pseudospiralis] >gi|954508904|gb|KRZ37220.1| NAD(P) transhydrogenase, mitochondrial [Trichinella pseudospiralis])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 311/488 (63.73%), Postives = 378/488 (77.46%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVY-NGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            K GI Y  + +GVPKE   +E+RVAV P+  +TLVK+GF+V++E +AG L+ F N DY +VGA I  K+EAF +DIVLK+R P   E + F+  + L SF+YPAQN+ +++ L+K  MTVF MDC+PRISRAQVFDALSSM+NI+GY+AV+EA+N+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAA+G AK+MGAIVR FD R +VKEQ++S+G EFL +NI E G   GGYAKEMSKE+++AEM+LF  QCKDIDILI+TALIPGK AP L  K M+  MKPGSV+VDLASEAGGNVETT PGEL V  NGV HIG+TD PSRL T +S LY NNISK LLS+  G K HF+VD+NDDV RG+I+L++G + WPP P I   + PA        K+  K PNY    LK++ LYT+G G +V LG+++PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISGITA GGLLLMGG Y
Sbjct:   47 KNGILYNELSIGVPKEIS-KEQRVAVTPNVAQTLVKKGFQVNMEKDAGLLAKFSNDDYLNVGAKIASKEEAFGSDIVLKVRAPLENEVEKFKSNSTLISFLYPAQNEHILKLLAKKKMTVFAMDCIPRISRAQVFDALSSMANIAGYKAVIEAANHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAIGTAKNMGAIVRGFDTRSAVKEQVQSLGAEFLEINIKESGEGVGGYAKEMSKEYIEAEMQLFAKQCKDIDILITTALIPGKPAPKLFTKQMIQSMKPGSVVVDLASEAGGNVETTHPGELYVSDNGVIHIGYTDFPSRLPTTSSMLYANNISKFLLSL--GDKEHFFVDLNDDVTRGAIILDKGSMMWPP-PKIEDPS-PAVQQPKVEVKELPKEPNYFMETLKNAGLYTSGFGSIVGLGLIAPNAAFSTMCTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGITAAGGLLLMGGNY 529          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|954416809|gb|KRY68638.1| (NAD(P) transhydrogenase, mitochondrial [Trichinella pseudospiralis] >gi|954497122|gb|KRZ25937.1| NAD(P) transhydrogenase, mitochondrial, partial [Trichinella pseudospiralis] >gi|954508905|gb|KRZ37221.1| NAD(P) transhydrogenase, mitochondrial [Trichinella pseudospiralis])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 311/488 (63.73%), Postives = 378/488 (77.46%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVY-NGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            K GI Y  + +GVPKE   +E+RVAV P+  +TLVK+GF+V++E +AG L+ F N DY +VGA I  K+EAF +DIVLK+R P   E + F+  + L SF+YPAQN+ +++ L+K  MTVF MDC+PRISRAQVFDALSSM+NI+GY+AV+EA+N+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAA+G AK+MGAIVR FD R +VKEQ++S+G EFL +NI E G   GGYAKEMSKE+++AEM+LF  QCKDIDILI+TALIPGK AP L  K M+  MKPGSV+VDLASEAGGNVETT PGEL V  NGV HIG+TD PSRL T +S LY NNISK LLS+  G K HF+VD+NDDV RG+I+L++G + WPP P I   + PA        K+  K PNY    LK++ LYT+G G +V LG+++PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISGITA GGLLLMGG Y
Sbjct:   47 KNGILYNELSIGVPKEIS-KEQRVAVTPNVAQTLVKKGFQVNMEKDAGLLAKFSNDDYLNVGAKIASKEEAFGSDIVLKVRAPLENEVEKFKSNSTLISFLYPAQNEHILKLLAKKKMTVFAMDCIPRISRAQVFDALSSMANIAGYKAVIEAANHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAIGTAKNMGAIVRGFDTRSAVKEQVQSLGAEFLEINIKESGEGVGGYAKEMSKEYIEAEMQLFAKQCKDIDILITTALIPGKPAPKLFTKQMIQSMKPGSVVVDLASEAGGNVETTHPGELYVSDNGVIHIGYTDFPSRLPTTSSMLYANNISKFLLSL--GDKEHFFVDLNDDVTRGAIILDKGSMMWPP-PKIEDPS-PAVQQPKVEVKELPKEPNYFMETLKNAGLYTSGFGSIVGLGLIAPNAAFSTMCTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGITAAGGLLLMGGNY 529          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|954395398|gb|KRY57620.1| (NAD(P) transhydrogenase, mitochondrial [Trichinella britovi] >gi|954610463|gb|KRZ86243.1| NAD(P) transhydrogenase, mitochondrial [Trichinella sp. T8])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 311/488 (63.73%), Postives = 376/488 (77.05%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVY-NGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            K GI Y+ + +GVPKE   +E+RVAV PS  +TL K+GF V+VE +AG L+ F N DY +VGA I  K+EAF +DIVLK+R P   E + F+  A L SF+YPAQN+ +++ L+K  +TVF MDC+PRISRAQVFDALSSM+NI+GY+AV+EA+N+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAA+G A++MGAIVR FD R +VKEQ++S+G EFL +NI E G   GGYAKEMSKE+++AEM+LF  QCKDIDILI+TALIPGK AP L  K M+  MKPGSV+VDLASEAGGNVETT PGEL V  NGV HIG+TD PSRL T +S LY NNISK LLS+  G K HF+VD+NDDV RG+I+L++G + WPP P I   + PA        K+  K PNY    LK++ LYT+G G +V LG ++PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISGITA GGLLLMGG Y
Sbjct:   47 KSGILYSELSIGVPKEIS-KEQRVAVTPSVAQTLAKKGFHVNVEKDAGLLAKFSNDDYLNVGAKIASKEEAFGSDIVLKVRAPVENEVEKFKSNATLISFLYPAQNEHIVKLLAKKKLTVFAMDCIPRISRAQVFDALSSMANIAGYKAVIEAANHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAIGTARNMGAIVRGFDTRSAVKEQVQSLGAEFLEINIKESGEGVGGYAKEMSKEYIEAEMQLFAKQCKDIDILITTALIPGKPAPKLFTKQMIQSMKPGSVVVDLASEAGGNVETTHPGELYVSDNGVVHIGYTDFPSRLPTTSSMLYANNISKFLLSL--GDKEHFFVDLNDDVTRGAIILDKGSMMWPP-PKIEDPS-PAVQQPKVEVKELPKEPNYFMETLKNAGLYTSGFGSIVGLGFIAPNAAFSTMCTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGITAAGGLLLMGGNY 529          
BLAST of EMLSAG00000009301 vs. nr
Match: gi|954395397|gb|KRY57619.1| (NAD(P) transhydrogenase, mitochondrial [Trichinella britovi] >gi|954395399|gb|KRY57621.1| NAD(P) transhydrogenase, mitochondrial [Trichinella britovi] >gi|954395400|gb|KRY57622.1| NAD(P) transhydrogenase, mitochondrial [Trichinella britovi] >gi|954610462|gb|KRZ86242.1| NAD(P) transhydrogenase, mitochondrial [Trichinella sp. T8])

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 311/488 (63.73%), Postives = 376/488 (77.05%), Query Frame = 0
Query:   25 KKGIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVY-NGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGGY 511
            K GI Y+ + +GVPKE   +E+RVAV PS  +TL K+GF V+VE +AG L+ F N DY +VGA I  K+EAF +DIVLK+R P   E + F+  A L SF+YPAQN+ +++ L+K  +TVF MDC+PRISRAQVFDALSSM+NI+GY+AV+EA+N+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAA+G A++MGAIVR FD R +VKEQ++S+G EFL +NI E G   GGYAKEMSKE+++AEM+LF  QCKDIDILI+TALIPGK AP L  K M+  MKPGSV+VDLASEAGGNVETT PGEL V  NGV HIG+TD PSRL T +S LY NNISK LLS+  G K HF+VD+NDDV RG+I+L++G + WPP P I   + PA        K+  K PNY    LK++ LYT+G G +V LG ++PN AF  M  TFGL+ +VGY TVW V PALHSPLMSVTNAISGITA GGLLLMGG Y
Sbjct:   47 KSGILYSELSIGVPKEIS-KEQRVAVTPSVAQTLAKKGFHVNVEKDAGLLAKFSNDDYLNVGAKIASKEEAFGSDIVLKVRAPVENEVEKFKSNATLISFLYPAQNEHIVKLLAKKKLTVFAMDCIPRISRAQVFDALSSMANIAGYKAVIEAANHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAIGTARNMGAIVRGFDTRSAVKEQVQSLGAEFLEINIKESGEGVGGYAKEMSKEYIEAEMQLFAKQCKDIDILITTALIPGKPAPKLFTKQMIQSMKPGSVVVDLASEAGGNVETTHPGELYVSDNGVVHIGYTDFPSRLPTTSSMLYANNISKFLLSL--GDKEHFFVDLNDDVTRGAIILDKGSMMWPP-PKIEDPS-PAVQQPKVEVKELPKEPNYFMETLKNAGLYTSGFGSIVGLGFIAPNAAFSTMCTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGITAAGGLLLMGGNY 529          
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold336_size202805-snap-gene-1.43 (protein:Tk02911 transcript:maker-scaffold336_size202805-snap-gene-1.43-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_315656")

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 351/478 (73.43%), Postives = 402/478 (84.10%), Query Frame = 0
Query:   27 GIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVP---AKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAV 501
            G PYTS+ +GVPKE+W  E+RVA  P+    LVK+GF V +E+ AG  + FR+ DYE  GA +V K + F +DIVLKLRQPS+ EAKLFR+E ILYSF+YP QNQ L+  L++  +T FGMDCVPRISRAQVFDALSSM NISGYRAVVEASN+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAA+GQAKSMGAIVRAFDVRP+VKEQ+ESMG EFL V++ EDGS+ GGYAKEMS+ FLDAEMKLFH+QCKD+DI+I+TALIPGKKAPILIKKYM+DDMKPGSV+VDLASEAGGN+ETT PGE+  YN V H+G TDLPSRL TQASTLY NNISKLLLSMT GSK H+++++ DDVVRGSIVLN+GV+SWPP PPI+VAA     A  +  A SK     PNY    LKDS++YT+GLG L ALG+ SPNPAF AMT TFGLSC+VGY TVWNVVPALHSPLMSVTNAISGITAV
Sbjct:   58 GTPYTSLTIGVPKESWTNEQRVACSPAVTGNLVKKGFSVQIESGAGLKARFRDKDYEMAGAKLVSKDQIFQSDIVLKLRQPSMNEAKLFREEGILYSFLYPNQNQDLMNALAQRRITAFGMDCVPRISRAQVFDALSSMGNISGYRAVVEASNHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAIGQAKSMGAIVRAFDVRPAVKEQVESMGAEFLEVDMKEDGSTVGGYAKEMSQAFLDAEMKLFHDQCKDVDIVITTALIPGKKAPILIKKYMIDDMKPGSVVVDLASEAGGNIETTKPGEIYTYNDVVHVGLTDLPSRLPTQASTLYANNISKLLLSMT-GSKDHYHINLEDDVVRGSIVLNKGVVSWPPNPPIAVAAPQSPGAAKAGDAKSKAELAPPNYFQAQLKDSLMYTSGLGSLTALGVGSPNPAFTAMTTTFGLSCIVGYHTVWNVVPALHSPLMSVTNAISGITAV 534          
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold168_size293125-snap-gene-1.70 (protein:Tk04468 transcript:maker-scaffold168_size293125-snap-gene-1.70-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_315656")

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 351/478 (73.43%), Postives = 402/478 (84.10%), Query Frame = 0
Query:   27 GIPYTSIRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVP---AKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAV 501
            G PYTS+ +GVPKE+W  E+RVA  P+    LVK+GF V +E+ AG  + FR+ DYE  GA +V K + F +DIVLKLRQPS+ EAKLFR+E ILYSF+YP QNQ L+  L++  +T FGMDCVPRISRAQVFDALSSM NISGYRAVVEASN+FGRFFTGQITAAGKVPPAKVLVIGGGVAGLAA+GQAKSMGAIVRAFDVRP+VKEQ+ESMG EFL V++ EDGS+ GGYAKEMS+ FLDAEMKLFH+QCKD+DI+I+TALIPGKKAPILIKKYM+DDMKPGSV+VDLASEAGGN+ETT PGE+  YN V H+G TDLPSRL TQASTLY NNISKLLLSMT GSK H+++++ DDVVRGSIVLN+GV+SWPP PPI+VAA     A  +  A SK     PNY    LKDS++YT+GLG L ALG+ SPNPAF AMT TFGLSC+VGY TVWNVVPALHSPLMSVTNAISGITAV
Sbjct:   58 GTPYTSLTIGVPKESWTNEQRVACSPAVTGNLVKKGFSVQIESGAGLKARFRDKDYEMAGAKLVSKDQIFQSDIVLKLRQPSMNEAKLFREEGILYSFLYPNQNQDLMNALAQRRITAFGMDCVPRISRAQVFDALSSMGNISGYRAVVEASNHFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAIGQAKSMGAIVRAFDVRPAVKEQVESMGAEFLEVDMKEDGSTVGGYAKEMSQAFLDAEMKLFHDQCKDVDIVITTALIPGKKAPILIKKYMIDDMKPGSVVVDLASEAGGNIETTKPGEIYTYNDVVHVGLTDLPSRLPTQASTLYANNISKLLLSMT-GSKDHYHINLEDDVVRGSIVLNKGVVSWPPNPPIAVAAPQSPGAAKAGDAKSKAELAPPNYFQAQLKDSLMYTSGLGSLTALGVGSPNPAFTAMTTTFGLSCIVGYHTVWNVVPALHSPLMSVTNAISGITAV 534          
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold2149_size19838-processed-gene-0.1 (protein:Tk06913 transcript:snap_masked-scaffold2149_size19838-processed-gene-0.1-mRNA-1 annotation:"nad transhydrogenase subunit alpha")

HSP 1 Score: 419.468 bits (1077), Expect = 1.001e-142
Identity = 224/471 (47.56%), Postives = 299/471 (63.48%), Query Frame = 0
Query:   52 PSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAF--SADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISE---DGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGE-LSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAV------PAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMGGG 510
            P++ + L K G++  +E+ AG  + F +  Y   G  +V        +ADI+ K+R PSL E KL R    L SF YPAQN+ L+   +    TV  MD VPRISRAQ  DALSSM+NI+GYRAV+EA NNFGRFFTGQ+TAAGKVPPAKVLV+G GVAGLAA+G A S+GAI  AFDVRP V EQ+ESMG EF+ ++  E   DG++ GGYA   S EF  A++  F     +IDI+I+TALIPG+ AP L  K MV+ MKPGSVI+DLA+E GGN + TV  E ++  NGV  +G+TD PSR++ Q+STLY  NI  ++  +T    G    ++ DDV+RG+  ++QG I++PP PP  VAA+      PA    T   K+  +   +        +L   G   L+A+G+V+P  +F      F LS  +G+Q +W V  +LH+PLM+VTNAIS I  +G L  +G G
Sbjct:    3 PASAKDLQKLGYECLIESGAGVSAGFSDTAYADAGVTVVKTAAEMWKTADIIAKVRPPSLDETKLMRTGQTLISFFYPAQNKALMDAANAQGSTVIAMDMVPRISRAQKMDALSSMANIAGYRAVIEAGNNFGRFFTGQVTAAGKVPPAKVLVVGAGVAGLAAIGTATSLGAITYAFDVRPEVAEQVESMGAEFVFLDFEEDQQDGAATGGYAAVSSPEFAAAQLAKFREIAPEIDIVITTALIPGRDAPELWTKDMVESMKPGSVIIDLAAERGGNCKLTVMDEKITTENGVIIVGYTDFPSRMAAQSSTLYATNIRHMMSDLTPEKDGVPQHNMEDDVIRGATAVHQGAITFPPPPP-KVAAIAAQPKKPAPKELTPAEKRAAETAAFKAQTKNQVILIGVGAALLLAIGLVAPA-SFMQHFIVFVLSVFIGFQVIWGVAHSLHTPLMAVTNAISSIIILGALTQIGSG 471          
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold1_size3401120-processed-gene-7.14 (protein:Tk04869 transcript:snap_masked-scaffold1_size3401120-processed-gene-7.14-mRNA-1 annotation:"nad mitochondrial-like")

HSP 1 Score: 397.897 bits (1021), Expect = 2.249e-129
Identity = 226/479 (47.18%), Postives = 296/479 (61.80%), Query Frame = 0
Query:   33 IRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSA--DIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGE-LSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATFGLSCVVGYQTVWNVVPALHSPLMSVTNAISGITAVGGLLLMG 508
            +++G P+E +  E RVA+ P +   L K G+   +E+ AG  + F +  Y + G  +V    A  A  DI+ ++R PSL E     D   L SF+ PA +  L++ L   N++  GM+ VPRISRAQ  DALSSM+NI+GYRAV+EA NNFGRFFTGQITAAGKVPPAKVLVIG GVAGLAA+G A+S+GAIVRAFDVRP V EQIESMG  F+ ++ SEDG+ DGGYA   S EF + +++ F  Q K++DI+I+TALIPG+ AP L  + MV  MKPGSV+VDLA+E GGN + TV  E +   NGV  IG+TD PSR++TQAS LY  NI  ++  +T    G    ++ DDV+R S V ++G I++PP PP+ VAA    A  T      EK P  +      ++                   A    T             +WNV  ALH+PLM+VTNAISGI  +G LL +G
Sbjct:    1 MKIGAPRELFEGECRVALTPDSAVQLQKLGYDCVIESGAGDAARFSDDTYRNAGVEVVADAAALYATADIIARVRAPSLDEVAAMPDGKKLISFLNPAGSPELLEALRAKNISAMGMEMVPRISRAQKMDALSSMANIAGYRAVIEAGNNFGRFFTGQITAAGKVPPAKVLVIGAGVAGLAAIGTAQSLGAIVRAFDVRPEVAEQIESMGASFVYLDFSEDGAGDGGYAAVSSPEFREKQLECFREQAKEVDIVITTALIPGRDAPKLWLEDMVLAMKPGSVVVDLAAEKGGNCDLTVMDEIIESSNGVRVIGYTDFPSRMATQASNLYSTNIRHMMTDLTPDKDGQPNWNMEDDVIRTSTVTHEGEITFPP-PPLKVAAQAKPAVKT-----VEKTPEEIKAEEAAAI-----------------QKANKQQTMLL---------VIWNVSHALHTPLMAVTNAISGIVILGALLQVG 447          
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold3444_size8628-processed-gene-0.3 (protein:Tk02003 transcript:snap_masked-scaffold3444_size8628-processed-gene-0.3-mRNA-1 annotation:"nad transhydrogenase subunit alpha")

HSP 1 Score: 380.563 bits (976), Expect = 3.296e-128
Identity = 210/437 (48.05%), Postives = 280/437 (64.07%), Query Frame = 0
Query:   33 IRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSA--DIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGEL-SVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQGVISWPPKPPISVAAVPAKASNTAISKKTEKLPNYLNMYLKDSVLYTTGLGGLVALGMVSPNPAFXAMTATF 466
            +++G P+E +  E RVA+ P +   L K G++  +E+ AG  + F +  Y   G  +V    AF A  DI+ ++R PSL E     +   L SF+ PA N  L++ L   N++  GM+ VPRISRAQ  DALSSM+NI+GYRAV+EA NNFGRFFTGQITAAGKVPPAKVLVIG GVAGLAA+G A+S+GAIVRAFDVRP V EQIESMG  F+ ++  EDG+ DGGYA   S EF + +++ F  Q K++DI+I+TALIPG+ AP L  + MV  MKPGSV+VDLA+E GGN + TV  ++    NGV  IG+TD PSR++TQAS LY  NI  ++  +T    G    ++ DDV+R S V + G I++PP P + VAA    A+ T I   +  L   L M + +++     LG L+ +G  S    F A  A  
Sbjct:    1 MKIGAPRELFEGECRVALTPDSAAQLQKLGYECVIESGAGAAARFSDDAYREAGVEVVADAAAFYATADIIARVRAPSLDEVAAMPEGKKLISFLNPAGNPELLEALKAKNISAMGMEMVPRISRAQKMDALSSMANIAGYRAVIEAGNNFGRFFTGQITAAGKVPPAKVLVIGAGVAGLAAIGTAQSLGAIVRAFDVRPEVAEQIESMGASFVYLDFEEDGAGDGGYAAPSSPEFREKQLECFREQAKEVDIVITTALIPGRDAPKLWLEDMVLSMKPGSVVVDLAAERGGNCDLTVADQIVESSNGVRIIGYTDFPSRMATQASNLYATNIRHMMSDLTPEKDGQPVWNMEDDVIRTSTVTHAGEITFPP-PALKVAAQAKPAAKTVIWNVSHALHTPL-MAVTNAISGIVILGALLQVGSSSGLVTFLAAIAVL 435          
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1839_size26660-snap-gene-0.0 (protein:Tk04306 transcript:maker-scaffold1839_size26660-snap-gene-0.0-mRNA-1 annotation:"nad transhydrogenase subunit beta")

HSP 1 Score: 309.686 bits (792), Expect = 3.628e-96
Identity = 160/360 (44.44%), Postives = 236/360 (65.56%), Query Frame = 0
Query:   33 IRLGVPKETWIQEKRVAVPPSAVETLVKRGFKVSVENEAGTLSNFRNVDYESVGANIVDKKEAFSADIVLKLRQPSLKEAKLFRDEAILYSFIYPAQNQTLIQELSKHNMTVFGMDCVPRISRAQVFDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSDGGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVL 392
            +++GV +ET   E RVA+ P  V+ L+K+ F+V +E  AG LS++ +  Y +VGA I    E F  D++ K+  PS+ EA+  R+ + L SF+Y      +++EL K  ++ F MD VPRISRAQ  DALSS +N++GY+AV+  +    + F   +TAAG + PAKVL+ G GVAGL A+  AK +GA+V   DVR   KEQ+ES+GG F+TV   +   + GGYAKE+S +FL+ +  L  ++ KD D++I+TAL+ GKKAP+LI K MV  MK G+VIVD+A+E+GGN E     ++   NGVT IG ++LPS L+T AS LY  N+S LLL +   +   F  ++ +++ +GS++L
Sbjct:    1 MQIGVLRETKPLENRVALSPDIVKQLIKKEFQVKIEKGAGLLSSYTDEAYIAVGATIGSASEVFQCDVLCKVNAPSIPEAEQVREGSQLISFLYAYTIPEVLKELEKRKVSAFAMDAVPRISRAQKMDALSSQANLAGYKAVITGAEAMTKIFPLMMTAAGTITPAKVLIFGAGVAGLQAIATAKRLGAVVEVTDVRIETKEQVESLGGRFITVEGMDKVETAGGYAKEVSADFLNKQKALVADKIKDADLVITTALVMGKKAPVLITKAMVASMKQGAVIVDMATESGGNCELAQKDKIVNENGVTIIGHSNLPSLLATNASQLYATNVSTLLLHL--ATPEGFKWEMEEEITKGSLIL 358          
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold8814_size2600-processed-gene-0.1 (protein:Tk07300 transcript:snap_masked-scaffold8814_size2600-processed-gene-0.1-mRNA-1 annotation:"nad transhydrogenase subunit alpha")

HSP 1 Score: 201.83 bits (512), Expect = 9.256e-62
Identity = 107/239 (44.77%), Postives = 153/239 (64.02%), Query Frame = 0
Query:  159 FDALSSMSNISGYRAVVEASNNFGRFFTGQITAAGKVPPAKVLVIGGGVAGLAAVGQAKSMGAIVRAFDVRPSVKEQIESMGGEFLTVNISEDGSSD--GGYAKEMSKEFLDAEMKLFHNQCKDIDILISTALIPGKKAPILIKKYMVDDMKPGSVIVDLASEAGGNVETTVPGELSVYNGVTHIGFTDLPSRLSTQASTLYGNNISKLLLSMTDGSKGHFYVDVNDDVVRGSIVLNQG 395
             DALSS SN++GYRAV+EA+N +G+     +TAAG + PAKV V+G GVAGL A+  A+ +GA+V A DVRP+ KEQ+ S+G +F+ V   E  +++  GGYAK+MS E+   + +L        DI+++TALIPG+ AP+L+   MV  MK GSVIVD+A  AGGN   + P E+   +GV   GFT+LP+ L   AS LY  N+   L  +T    G   +D  D++V  +++L +G
Sbjct:    1 MDALSSQSNLAGYRAVIEAANIYGKAMPMMMTAAGTIAPAKVFVMGAGVAGLQAIATARRLGAVVTATDVRPAAKEQVASLGAKFIAVEDEEFKAAETAGGYAKQMSAEYQAKQAELTAAHIAKQDIVVTTALIPGRAAPVLVTADMVKAMKTGSVIVDMAVSAGGNCPLSKPDEIVEVDGVKVAGFTNLPAHLPADASALYAKNLVAFLPLIT-AEDGSLNLDTEDEIVT-AMLLTRG 237          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000009301 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-0.000e+055.95symbol:nnt-1 "Protein NNT-1" species:6239 "Caenorh... [more]
-0.000e+056.75symbol:NNT "Uncharacterized protein" species:9031 ... [more]
-0.000e+056.57symbol:NNT "NAD(P) transhydrogenase, mitochondrial... [more]
-0.000e+055.03symbol:Nnt "Nicotinamide nucleotide transhydrogena... [more]
-0.000e+055.03symbol:Nnt "nicotinamide nucleotide transhydrogena... [more]
-0.000e+055.49symbol:NNT "NAD(P) transhydrogenase, mitochondrial... [more]
-0.000e+055.16symbol:Nnt "nicotinamide nucleotide transhydrogena... [more]
-1.522e-17757.49symbol:nnt "nicotinamide nucleotide transhydrogena... [more]
-1.584e-17656.46symbol:NNT "Uncharacterized protein" species:9615 ... [more]
-3.618e-16554.04symbol:si:ch1073-139a18.1 "si:ch1073-139a18.1" spe... [more]

Pages

back to top
BLAST of EMLSAG00000009301 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 8
Match NameE-valueIdentityDescription
gi|592892707|gb|GAXK01065668.1|0.000e+070.65TSA: Calanus finmarchicus comp5644_c1_seq1 transcr... [more]
gi|592932733|gb|GAXK01025820.1|5.284e-862.50TSA: Calanus finmarchicus comp8533089_c0_seq1 tran... [more]
gi|592853131|gb|GAXK01104413.1|1.312e-545.16TSA: Calanus finmarchicus comp2313382_c0_seq1 tran... [more]
gi|592834016|gb|GAXK01123528.1|2.028e-133.93TSA: Calanus finmarchicus comp7787016_c0_seq1 tran... [more]
gi|592957644|gb|GAXK01000912.1|2.838e+040.82TSA: Calanus finmarchicus comp638978_c0_seq1 trans... [more]
gi|592957642|gb|GAXK01000914.1|3.152e+040.82TSA: Calanus finmarchicus comp638978_c0_seq3 trans... [more]
gi|592870771|gb|GAXK01086791.1|6.140e+034.78TSA: Calanus finmarchicus comp328196_c0_seq2 trans... [more]
gi|592870772|gb|GAXK01086790.1|6.166e+034.78TSA: Calanus finmarchicus comp328196_c0_seq1 trans... [more]
back to top
BLAST of EMLSAG00000009301 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000093010.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s595:21582... [more]
back to top
BLAST of EMLSAG00000009301 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|172045566|sp|P11024.3|NNTM_BOVIN0.000e+056.57RecName: Full=NAD(P) transhydrogenase, mitochondri... [more]
gi|51338801|sp|Q13423.3|NNTM_HUMAN0.000e+055.49RecName: Full=NAD(P) transhydrogenase, mitochondri... [more]
gi|51338804|sp|Q61941.2|NNTM_MOUSE0.000e+055.16RecName: Full=NAD(P) transhydrogenase, mitochondri... [more]
gi|266809|sp|P07001.2|PNTA_ECOLI8.918e-16353.33RecName: Full=NAD(P) transhydrogenase subunit alph... [more]
gi|75463223|sp|Q9ALA2.1|PNTA_RHOSH6.616e-14948.47RecName: Full=NAD(P) transhydrogenase subunit alph... [more]
gi|1172547|sp|P43842.1|PNTA_HAEIN2.955e-14650.63RecName: Full=NAD(P) transhydrogenase subunit alph... [more]
gi|91207607|sp|Q2RSB2.1|PNTAA_RHORT1.126e-9141.91RecName: Full=NAD(P) transhydrogenase subunit alph... [more]
gi|6226674|sp|P41077.2|PNTAA_RICPR1.972e-7839.24RecName: Full=NAD(P) transhydrogenase subunit alph... [more]
gi|38604654|sp|Q8CNW8.1|DHA_STAES5.507e-3933.43RecName: Full=Alanine dehydrogenase >gi|81674216|s... [more]
gi|123642815|sp|Q49YD9.1|DHA_STAS12.154e-3631.27RecName: Full=Alanine dehydrogenase[more]

Pages

back to top
BLAST of EMLSAG00000009301 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 8
Match NameE-valueIdentityDescription
gb|KFM75081.1|0.000e+066.39NAD(P) transhydrogenase, mitochondrial, partial [S... [more]
EFX83224.10.000e+063.04hypothetical protein DAPPUDRAFT_315656 [Daphnia pu... [more]
EAA08455.40.000e+063.51AGAP003167-PA [Anopheles gambiae str. PEST][more]
gb|EFA03278.1|0.000e+061.73NAD(P) transhydrogenase, mitochondrial-like Protei... [more]
EEB15892.10.000e+062.68NAD(P) transhydrogenase, putative [Pediculus human... [more]
gb|EEC04253.1|0.000e+060.09NAD(P) transhydrogenase, putative [Ixodes scapular... [more]
gb|KPM02534.1|0.000e+059.53NAD(P) transhydrogenase-like protein, partial [Sar... [more]
EFX69700.14.208e-930.77hypothetical protein DAPPUDRAFT_328858 [Daphnia pu... [more]
back to top
BLAST of EMLSAG00000009301 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|675382182|gb|KFM75081.1|0.000e+066.39NAD(P) transhydrogenase, mitochondrial, partial [S... [more]
gi|340374316|ref|XP_003385684.1|0.000e+062.91PREDICTED: NAD(P) transhydrogenase, mitochondrial-... [more]
gi|942412283|gb|JAN88071.1|0.000e+063.37NAD(P) transhydrogenase, mitochondrial [Daphnia ma... [more]
gi|1022769340|gb|KZS13829.1|0.000e+063.37NAD(P) transhydrogenase, mitochondrial [Daphnia ma... [more]
gi|1059387066|ref|XP_017768736.1|0.000e+063.86PREDICTED: NAD(P) transhydrogenase, mitochondrial-... [more]
gi|321472254|gb|EFX83224.1|0.000e+063.04hypothetical protein DAPPUDRAFT_315656 [Daphnia pu... [more]
gi|954416806|gb|KRY68635.1|0.000e+063.73NAD(P) transhydrogenase, mitochondrial [Trichinell... [more]
gi|954416809|gb|KRY68638.1|0.000e+063.73NAD(P) transhydrogenase, mitochondrial [Trichinell... [more]
gi|954395398|gb|KRY57620.1|0.000e+063.73NAD(P) transhydrogenase, mitochondrial [Trichinell... [more]
gi|954395397|gb|KRY57619.1|0.000e+063.73NAD(P) transhydrogenase, mitochondrial [Trichinell... [more]

Pages

back to top
BLAST of EMLSAG00000009301 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 7
Match NameE-valueIdentityDescription
maker-scaffold336_size202805-snap-gene-1.430.000e+073.43protein:Tk02911 transcript:maker-scaffold336_size2... [more]
maker-scaffold168_size293125-snap-gene-1.700.000e+073.43protein:Tk04468 transcript:maker-scaffold168_size2... [more]
snap_masked-scaffold2149_size19838-processed-gene-0.11.001e-14247.56protein:Tk06913 transcript:snap_masked-scaffold214... [more]
snap_masked-scaffold1_size3401120-processed-gene-7.142.249e-12947.18protein:Tk04869 transcript:snap_masked-scaffold1_s... [more]
snap_masked-scaffold3444_size8628-processed-gene-0.33.296e-12848.05protein:Tk02003 transcript:snap_masked-scaffold344... [more]
maker-scaffold1839_size26660-snap-gene-0.03.628e-9644.44protein:Tk04306 transcript:maker-scaffold1839_size... [more]
snap_masked-scaffold8814_size2600-processed-gene-0.19.256e-6244.77protein:Tk07300 transcript:snap_masked-scaffold881... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s595supercontigLSalAtl2s595:215822..221204 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionaugustus_masked-LSalAtl2s595-processed-gene-2.0
Biotypeprotein_coding
EvidenceIEA
NoteNAD(P) transhydrogenase, mitochondrial
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000009301 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000009301EMLSAT00000009301-705148Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s595:215822..221204+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000009301-692067 ID=EMLSAG00000009301-692067|Name=EMLSAG00000009301|organism=Lepeophtheirus salmonis|type=gene|length=5383bp|location=Sequence derived from alignment at LSalAtl2s595:215822..221204+ (Lepeophtheirus salmonis)
AAAATGTCATAAGCTTATCATCCGTACTTCCCTTCATATCATGGTCGTAC TTAATAGAACCTCATTTAAAAATGTGTTTCTTCTTCTGGGCAAAAGGTCC TTTAGTGATGGTAAAAAAGGGATTCCTTATACTAGTATAAGACTTGGTGT ACCTAAAGAAACATGGATCCAAGAGAAAAGAGTTGCCGTTCCTCCCTCTG CTGTGGAAACATTGGTGAAAAGGGGGTTCAAAGTTTCTGTTGAGAATGAA GCCGGAACGCTCTCAAACTTTAGAAATGTAGACTATGAGTCAGTTGGAGC TAATATTGTGGATAAGAAGGAAGCCTTTTCTGCAGGTTAAATAGATTTGT GCATGTTAAAGATTTCATACAATCAATGATTTTTTTTTTTAAATCTCTTT TTAGATATTGTCCTCAAACTCAGACAACCAAGTTTAAAAGAGGCCAAACT ATTTAGAGATGAGGCCATCCTGTATTCCTTCATATATCCCGCACAAAATC AAACCCTAATTCAAGAGCTCTCCAAGCATAACATGACTGTTTTTGGTATG GATTGTGTTCCGAGGATCTCCAGAGCGCAAGTTTTTGATGCACTCTCCTC TATGAGTAATATTTCTGGATATAGAGCAGTGGTGGAAGCTTCAAATAACT TTGGTCGCTTTTTTACGGGGCAAATTACAGCTGCAGGAAAAGTTCCTCCA GCAAAAGTTTTGGTGATTGGGGGTGGAGTAGCAGGACTTGCTGCTGTTGG ACAGGCCAAAAGTATGGGTGCAATTGTTCGTGCTTTTGATGTGAGGCCAT CAGTAAAGGAACAGATTGAGTCTATGGGGGGAGAGTTTTTAACAGTTAAC ATAAGTGAAGATGGGTCCAGTGATGGAGGCTACGCAAAGGAAATGTCTAA GGAATTCCTTGATGCTGAAATGAAATTATTTCATAATCAATGTAAGGATA TTGACATCCTTATAAGTACGGCTCTTATTCCAGGGAAAAAAGCTCCAATT TTGATCAAAAAATACATGGTAGATGACATGAAACCTGGTTCAGTCATTGT GGATCTTGCTTCGGAGGCAGGTGGAAATGTTGAAACAACAGTGCCTGGAG AGCTCTCAGTGTATAATGGTGTCACTCATATTGGATTTACGGATTTGCCG TCGAGATTGTCGACTCAGGCATCAACATTGTATGGAAATAATATATCTAA GCTCTTACTTTCCATGACTGATGGATCCAAAGGTCATTTTTACGTTGATG TTAATGATGATGTTGTGCGTGGTTCCATTGTTCTCAATCAAGGAGTTATC TCATGGCCTCCCAARCCTCCCATATCAGTTGCTGCCGTTCCTGCAAAAGC TTCAAACACTGCAATATCTAAAAAGACTGAGAAGTTACCTAATTATTTAA ACATGTATCTAAAAGATTCCGTACTATATACTACAGGTCTGGGAGGATTG GTAGCACTGGGCATGGTATCTCCTAATCCTGCTTTTKCAGCCATGACTGC TACATTTGGACTAAGTTGTGTTGTTGGCTATCAAACTGTTTGGAATGTCG TTCCTGCACTTCATTCGCCTCTCATGTCAGTTACAAATGCTATATCAGGC ATAACAGCTGTTGGTGGKCTTCTTCTCATGGGMGGCGGTTACTARCCCAC GAWTACTGTGGAAKCCCTGGCAGCCACTGCTGCTTTTATATCGTTTATTA ATATATTTGGTGGATTTATTGTTACAACTCGTATGTTGGATATGTTTAAA AGACCCACTGATCCTCCAGAATATAATTATTTGTATTCAATTCCTGCTGG TGTATTCTTGGGTAGCTATGGACTCACTGCATTAAATGGGTATCCAGAAG TTCATCAAATGGCTTATTTAGCATCTTCCCTCTGCTGTGTAGGTGGATTA GCTGGGRTATCCACACAAAAACTGCTCGATTAGGGAATATTTTGGGAATA ATTGGTGTGTCTGGAGGCGTTGCAGCAACGCTAGGAACATTATTACCCTC ACTGAATGTACCACTCTTAACCCAAATGGGAATGGTTGCAGCAACTGGAG GATTGATAGGCACTGGAATAGCGAAAAAGATTCAAATTACAGATCTGCCT CAATTGGTTGCTGCCTTTCATTCACTTGTTGGTATGGCAGCCGTTCTCAC TTGTATGGCAACTTATATCGATCACTTCCCCACGTTTGCCACAGATGAAG CGGCAACTATGATAAAATCATCGCTTTTCCTTGGTACCACAATTGGAGGA ATCACTTTTTCGGGATCCTTAGTAGCATATGGAAAATTACAAGGACTTCT TAGCTCTGCACCTTTTCTTTTTCCAGGCAGACATGCTCTTAATGGAGGTC TTCTTTTGGCCAACCTGGGAGCAATGAGTTTGTTTCTAAGTGACCCCTCG TACGCTTCAGGATTAACCATACTTGGTGCTTCCTCCGCTTTAAGTTCATT GATGGGAGTTACATTAACGACTGCTATTGGAGGTGCAGATATGCCGGTTG TTATCACTGTTCTAAATTCCTATTCGGGATGGGCTCTCTGTGCAGAGGGT TTCATGTTGAATAATAATTTGATGACCGTAGTTGGAGCACTTATAGGATC ATCTGGAGCTATTTTGTCATACATCATGTGTGTTGTAAGTGATATTATTA TTCGTTTTGTGAATAGAAATCTACACTTTATTGTTGTGTATAACCCATAA AAAGTCTATAATTGAATTATTATAAACCTAATATACTAATAATTTTTGAT CACCAGGCTATGAATAGAAGTTTAACCAATGTCATCCTAGGAGGTTTTGG AACCGTGAGTAAGACAAAAACTAATAAGACTCAAGAAATAGCTGGTACTC ACACAGAATGGAGCACGAATGATACCGTCAAGGCGTTGGCAGATGCTAAA AATATTATAATTGTTCCTGGTTACGGACTTGCTGTGGCCAAAGGTCAATA TCCTGTTGCTGAATTAGTACAAATCCTTCGATCCAAAGGAAAGAATGTGA GATTCGGCATTCATCCCGTTGCTGGACGTATGCCAGGTCAACTGAATGTC TTACTCGCTGAAGCTGGAGTCCCGTATGATATCGTCCTAGAAATGGATGA AATAAACGATGAATTCGAGGAAACGGATTTAGTGCTCGTAATTGGGGCAA ATGATACAGTTAATTCAGCTGCAGAAGATGATCCCGAATCGATTATTGCA GGGATGCCAGTCCTCAAAGTGTGGAAAAGTGGACAGGTATAAGGACAACT TTCATATTTAATTAGTGTACATTATATAATATATATCCAAGTAATTTAAT GTCTCATATTCTTTCTAATCACTAGGTCGTGGTAATGAAAAGATCCCTTG GAGTCGGCTATGCTGCCGTTGAAAATCCTATATTTTTTAATGAAAACACA TCCATGCTACTTGGGGATGCCAAAAAGTCATGTGATGGCCTACTAGCAAA ATTGAAGGAACACTATGATCTCTGAAATAAGTAGCTATAATGGAGATACT TTCAAAAACGCATTCTACAATTTATTTTAGATATTTATTACATATATTTT AGCATACAAATCTATTTTGTAAATTACGAAAAATAAAGACTTATTTTCAA TATCCATTTTCTTTCAAAGGAGTTACCTCTCCCCCCGATGATAGCTTATT TCTATTCAACATAAAGTTCTTTAACATTTCTTCATGGGCAACATGAGGTA TATTTATAAAATGAAGAAACTCCGAGAGAACCGGTAGGAGACTCGTATCA ACCCTATCTTTTGAACCACCAGCGACTCTAAGAGCTTGAACATAATCGTC TACACATGATATCTTAGAACCATTGCTCTTAAATAATTGTGAAACGTTGT CCCGGAGTTTATTCTTAGAGTGTGGTTCCGTCATAGGGAAGTATAAAGAC TTCCACATACCCAAAGAGCCACGTTTCAATCCAATTTTAGATGGCCATTT GCCATATTTTTTGTAATAACTCGGCCATACTTCAACAGTGTTGAGTCCAT TTGATGACACAACATCGATKCCATCATTGTTATTGKCCCAGATTGTATCC GTAGTCTCATCTTCAAACACAAGACGAAATTGTGCCACCTTCTTCATGAT TTGTACATCCTTAAGAGTAGCAAATGTACAAAGCGGAAATCCAAAAGACG GAAGATAGATATTCAATACCTTCCATGTATCCTTGTAATATAAATCGACT TTGATTTTGACAAAGTCGGAGTCAATAATCCGAATGATCTCTTTGAATAT ATTAATTATTTGATCTATTGGCACTTTCCACGTGGAATTCTCAAATTTGA GAGTTGAAGTTTTCAAAGAATCAGAAATAAATTTTTCTCCTAAGTGTTTC CCAGCCACTAAGAACTCGATTAATAAAGAACTGCATTCAGATGAAATCGT AAGTTGAGAAGCTACTTTGTTTCTTTTTCGGTTGTAGGATTTAGATACTT GTGTCGACTTGTTATTTATTTCAGAGCCCAATTCAGGTGTCAACGGAACG CTCAGTTCATACTGAGATTTTGAATCTGAGTCCAGTATATCTTTAGCTCG ACAACTCATTTCAAATGATGAAGAATCATTTTGAGTATCGCTACATGACG AACCCGTAGAACTCATGAGATTCAGGAAATCAAAGGTATTGTATTCGTCT TTAATAGCAGACTCCTCGACTTCTAAAGGCTGTTCATCCAAATCCACATC CAAGAATGAAATATCCTCATGCTCTTTGAGATGAAGGGGAGAGTAATGTT CTTGCTGAAGAGCTTCATCACTGAGATCAATGAGGGGTGCCAGGGAGACA CTGGAGTTACTCAGAGAGGAAGCCTTTGCAAGATCGGGCATTTTGGCCTT GATAATAACATCCAAGAGAATAGTAGAGATGATCCGCTTCTGCACATAGC TTTGGATGGCTTGAAGTCGAAAATGAAGAGCTTTGATGACGATAACAAAA TCCTCTTTATTGCAATTCTTTTGAACAAAGCAAGGGAAATTCTTGGATGT CTTGAGTTGTGGAACAAGGGACTCGAAGCAAATTTTGTATGGCTCSCCTT GATGGAAATTGCTGGTGATCACTGAGATGGACTCGGATGGTCGGAAAGTA AATGTTGGAAGGCTGTCGTCATTATAACCATACGACGGCATAAAAATTAC ATCCCAAGATCGAAATATGGGTGTGTAACGTACATAGGGATCAGGACGGA ATCGGGGTCTTGAGTTCTGAGGGGATCCATTGTGCCAATCCTCATTGGAA TTCAACATCTTTCGATGATTCATTTTCCTTTAGTAGGATTAGATCTTCAA AATCTACAGATTCCACGCTGAGTTTGCTGCGGGTGAAGGCCCACGACTCA CTAACAATATAGCTTTAGAAATTAGAAGCATCA
back to top
Add to Basket