EMLSAT00000011088, EMLSAT00000011088-706935 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000011088
Unique NameEMLSAT00000011088-706935
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
E F35 g18363_LsRictor female
  1. PreAdult2
-Missing-
no visible phenotype
15.10.2012 - 14:33
26.11.2012 (All day)
Molecular characterization and functional... more
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s751supercontigLSalAtl2s751:214211..219919 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000011088 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000011088EMLSAG00000011088-693854Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000049568EMLSAE00000049568-758496Lepeophtheirus salmonisexon
EMLSAE00000049569EMLSAE00000049569-758497Lepeophtheirus salmonisexon
EMLSAE00000049570EMLSAE00000049570-758498Lepeophtheirus salmonisexon
EMLSAE00000049571EMLSAE00000049571-758499Lepeophtheirus salmonisexon
EMLSAE00000049572EMLSAE00000049572-758500Lepeophtheirus salmonisexon
EMLSAE00000049573EMLSAE00000049573-758501Lepeophtheirus salmonisexon
EMLSAE00000049574EMLSAE00000049574-758502Lepeophtheirus salmonisexon
EMLSAE00000049575EMLSAE00000049575-758503Lepeophtheirus salmonisexon
EMLSAE00000049576EMLSAE00000049576-758504Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto774645auto774645Lepeophtheirus salmonispolypeptide
EMLSAP00000011088EMLSAP00000011088Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000011088

>EMLSAP00000011088 ID=EMLSAP00000011088|Name=EMLSAP00000011088|organism=Lepeophtheirus salmonis|type=polypeptide|length=1707bp
MASGYYYPPGRTNGGGRLYCGKRGNPNLRARFLENNNEDDELDLSEGSCV
GENVIEALKYLSSKGGSKGKKLAYLNALVKVLLEQRKDSLEEDLSLGLRL
KEIMLCLRIPLTHEAAEVRAATLRVFRYIVDRPCRVQDFLQINAHLLVSR
CIDIDLDNRVERLQALRFIRKLLFSCPESFPSSLCRSLIAIAEGGVKEND
RLLRISLAILCEISVLNSTVFILCQGVRALTNSLLDCSMPRMAEAMIGCL
LRLFNNPKTRSMANINLGVVITPFTEFRYIHNWFSQKVPTPSEALEDKQM
RFQCSQQAILSLLRSWPGLLQLCNLSSKNSPLKALIDILYLSNSEVRNLL
IDLIYEMLYLRVPKSSSNVKEVLEDIDPSSPRENWQXKEGFVASEGFDIL
PRLPNIRENHLSILLTCLMELNLPEALVNVLVSSSLVLSIKATVLLGELL
HKTFILLPHETNYSNHCLPTLFAEVASSDPERANRASQAVSTLNRIHSIK
KRGPTASSLFFYEILSVSERFPNGEGFIGVKLQNPGAWSQLLNKSADDRV
NTAIKESGVLSPRLNWVDWQWDQITVVFQCPSDNFLKNLESSTNKQFLRK
IFDFFKPSNGKFSKVELSRRESKEYGWVGIVFLDFLLKCGSGEGSRILDE
LLSDIHYYFKAVISAESAHDCLISPTKIASTACQYYFLFIGHLSRTQSGQ
GHLFRHLFLPSLAELLGMRSELYMKLIISSLDYSREWGSRALLQRALVDL
PEETPRLYATRFLGILIRSKSANVAQWGISLLVQQLYDPSPIIYSTALEL
LDEACDDKMNLEAVICSFASQKNKFKERISKAKSLRWSLILTRFVGSSNG
FKLLSHINLVEDEIKKWGSEYNLQYVKLVEELLNESFTLHQRDEDGTYGR
RKYGPHTVKDLFIPPHLYGQLAISEEGLEILQRKDSAFWPMLQTIRLARM
PDEDKAICTFKSAIWGICHVASSPGGARIVEQHGGIRRIVDIALSNEIYS
LRGTAYYALSLVATNRVGANALSSLNWFSLRFGREENWPVLEDWFANQLY
LLKERARTESEDVSNEDDDDSSSNYDDDNQKTLTPANIDSYFGSTSFGNT
SSGKSKLTSLFRSLSLSDSSGERVLSRLSEGRQSLSKKIKKSLSRRSSTK
SRRDSNVSGKTTSSVDTELLQAQSSSKRLSFSSEVCDEDGYSLTDHSPVK
AESSSVNAGLENIDEEEPPGAAAATLSFFSEFQPPSSEAKNSSFIIDSAS
TSGISSEDSCKLVVTAPIVANISSAKLSPIPSLIDNSSNDGFIQPHARSG
QRAFSESEALPIDVITMKSTDLQLGGGSVSSVCSIGSWTTENSGYRTIRG
IHSRRRPLLSESEVDTETNSQNAELTGSANSDTYRRSSGGLIRRKDSWTH
KSKSLDYRLTRLRKNNSSCVNHLISPDNQPISILTPTVQQQTSPVELVGG
QEPQYRGIAVPSQITALFPFIVEQDSSDVGDHFPTSVTLSSISTRDSSNA
FFGLELHTPYNCLSCYRLTYPCKSQSRSRSRTSSLTNPASERVSTESSTV
STGGSPSNLRKIVVTKGVIVDSTDSIISAMSSDQETATGKMRDNSVLGKV
FQRKEVLKLIDSMMHFSTKTHEQGLLKMKQKFPNLFNDLCLYSEVSLLLS
KYAYRLTSRXFIQELFIDLHYDDLYEEPAKILKIEDLENVREMMDDPGTS
SDSKINS
back to top

mRNA from alignment at LSalAtl2s751:214211..219919-

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000011088-706935 ID=EMLSAT00000011088-706935|Name=EMLSAT00000011088|organism=Lepeophtheirus salmonis|type=mRNA|length=5709bp|location=Sequence derived from alignment at LSalAtl2s751:214211..219919- (Lepeophtheirus salmonis)
ATGGCAAGTGGATATTATTATCCACCGGGTCGTACTAATGGAGGTGGGCG ACTCTATTGCGGTAAACGAGGCAACCCGAATTTGAGGGCTCGATTCCTGG AGAATAACAACGAAGACGATGAGTTGGATTTGTCTGAGGGGAGTTGTGTT GGGGAGAACGTGATTGAGGCTCTCAAGTACCTGTCCTCCAAAGGAGGGTC CAAGGGAAAGAAACTGGCCTATCTGAACGCACTCGTCAAAGTTCTCTTGG AACAGCGGAAGGATTCCTTGGAGGAGGATCTGTCTCTGGGCTTGAGGCTC AAGGAAATCATGCTTTGGTAAAGAGGGGAGTCACTGATTCAGTCATGGAG GGGATTCATTCCTTTGATTTCATTGCAGTCTCCGTATTCCTTTGACCCAT GAAGCGGCAGAAGTGCGAGCTGCGACTCTTCGTGTGTTTCGATACATTGT GGATCGTCCTTGCAGAGTCCAGGATTTCCTTCAAATCAATGCTCACCTCC TTGTTTCAAGATGCATCGACATCGACCTGGACAATCGAGTAGAAAGACTG CAAGCCCTGCGGTTCATCCGTAAACTCTTATTTTCTTGCCCCGAGTCCTT CCCTTCCTCTCTGTGCCGGAGTCTTATAGCCATTGCAGAGGGTGGGGTTA AAGAAAATGACCGTTTACTCAGGATCTCTTTAGCCATTCTTTGCGAAATA AGTAAGTTCATTCATTTTATAGAGAAATTTATATAGATAGTATCCATTGC TTTTTTCCCCCAGGTGTTTTGAACAGTACAGTGTTTATACTTTGTCAGGG TGTCAGAGCTTTAACAAATTCCTTACTTGATTGCTCAATGCCTCGAATGG CAGAGGCCATGATTGGATGCCTTTTACGCTTATTTAATAATCCTAAAACT AGGTCTATGGCTAATATTAATCTCGGAGTTGTGATCACCCCATTTACAGA GTTTCGCTACATTCATAATTGGTTTAGTCAAAAAGTGCCCACGCCCTCTG AAGCGCTTGAGGATAAGCAAATGAGGTTTCAATGTAGTCAACAAGCCATT CTGTCCTTACTTCGTTCATGGCCTGGTCTTCTACAACTCTGTAATCTAAG TTCGAAAAATTCTCCATTAAAGGCCTTGATTGATATATTGTATTTGTCAA ATTCGGAAGTTCGCGTGAGGAGATAATGAATATTTAATGCAATAAAATAG TGTATTGATTCGTTAAATATTTACAGAATTTATTGATTGATTTAATATAT GAGATGCTTTATCTGCGAGTTCCTAAGTCTTCGTCTAACGTGAAAGAGGT TCTTGAAGACATTGATCCCTCTTCTCCTCGAGAGAATTGGCAGMTGAAGG AAGGATTCGTTGCTTCGGAAGGCTTTGATATTCTTCCTAGATTGTCGAAA GCTAGGMAATTGAATTCATTTACTTCTTACCTCTATTTGCTCATATCTTA ACTTTTTCCTTTTCAGACCAAATATTAGAGAAAATCATCTTAGTATTTTG CTTACTTGCCTTATGGAGCTAAACTTACCTGAAGCTCTGGTTAATGTTTT AGTATCATCCAGCCTTGTTCTCTCAATTAAAGCGACTGTTCTTCTTGGAG AATTACTTCATAAAACTTTTATATTGTTGCCACACGAAACTAATTACTCA AATCATTGTCTTCCTACTTTATTTGCTGAAGTTGCATCCTCAGATCCTGA AAGGTATAATAATCCTATTTGAGCATCAGGTTGAAAAATATTTATATTTT TATAACATTTTGTAGGGCTAATCGAGCGTCTCAAGCTGTTTCTACTCTAA ATCGTATTCATTCTATTAAAAAGAGGGGGCCAACGGCTTCTAGTTTATTT TTTTATGAAATATTATCTGTAAGTGAGCGCTTTCCTAATGGGGAAGGCTT TATCGGAGTTAAGCTTCAAAATCCCGGAGCTTGGAGTCAATTGTTAAACA AATCTGCAGATGATCGTGTTAACACTGCTATCAAAGAGTCAGGGGTTTTG TCTCCTAGACTTAATTGGGTAGATTGGCAATGGGATCAAATAACAGTCGT TTTTCAATGCCCCAGTGATAATTTTTTGAAAAATTTGGAGAGTTCCACTA ATAAGCAATTTCTGAGGAAAATATTTGATTTTTTTAAACCTTCAAATGGA AAGTTTTCTAAAGTTGAGTTGAGTAGACGAGAGTCGAAAGAGTATGGTTG GGTGGGCATTGTGTTTTTAGATTTCCTACTCAAATGTGGTTCTGGCGAAG GATCAAGGATACTTGATGAACTCCTCTCGGACATTCATTACTATTTTAAA GCCGTCATCTCAGCAGAGTCTGCACATGATTGTTTAATTTCCCCTACTAA AATCGCTAGTACAGCATGTCAATATTACTTTTTATTTATTGGGCATCTTT CTCGTACCCAAAGTGGACAAGGCCATCTTTTTCGACATTTGTTCTTACCA AGGTTTGTTTATATTATGAGAATACACAAAAATACACATTTTTTTATATT TAACTTTTATGTACCTATTCTAGTTTAGCAGAGCTATTAGGGATGCGAAG TGAGTTGTATATGAAATTAATTATTTCTTCCCTGGATTATTCGAGGGAAT GGGGGTCAAGGGCCCTACTGCAAAGAGCTCTGGTAGATCTTCCTGAAGAA ACTCCCCGTTTATATGCTACCAGATTTCTAGGAATTTTAATTAGGAGCAA AAGTGCCAACGTTGCCCAATGGGGAATTAGTTTACTGGTGAGTCTTTTAA AACTTATTTAATGTACTACACACTGTTTTCTTTCTTGGAAATTATTTGAG ATATTGATATAAAAAATTTGTTCCTGCAATTATAGGTTCAACAGCTCTAC GATCCATCTCCAATAATTTATTCTACTGCCCTGGAATTATTAGACGAAGC CTGTGATGACAAAATGAATTTAGAAGCCGTCATATGTAGCTTTGCATCTC AAAAGAATAAATTTAAGGAGCGTATAAGTAAAGCAAAAAGCCTTAGATGG AGCCTCATTTTAACTCGTTTTGTTGGTTCATCAAATGGATTCAAATTGTT AAGTCATATAAATTTAGTTGAAGATGAAATAAAAAAGTGGGGGAGCGAGT ATAATCTTCAGTACGTGAAACTTGTTGAAGAACTTCTTAATGAATCCTTT ACACTGCATCAAAGAGACGAAGATGGAACATATGGGAGAAGAAAGTATGG ACCCCACACTGTGAAGGATCTCTTTATACCGCCTCATTTATATGGACAGT TGGCTATCTCTGAGGAGGGTCTTGAAATCCTTCAGCGAAAAGACTCCGCA TTTTGGCCCATGCTTCAAACAATAAGATTAGCCCGTATGCCAGACGAAGA TAAGGCCATATGCACATTTAAGTCAGCCATATGGGGAATATGTCATGTTG CAAGTTCACCTGGAGGAGCCAGGATTGTTGAGCAACATGGTGGTATCAGG CGTATTGTGGACATTGCTTTGTCAAATGAAATTTATTCTCTCAGGGGCAC AGCTTACTACGCCTTAAGCCTTGTTGCTACAAACAGAGTTGGAGCAAATG CGTTGTCTAGTCTAAATTGGTTTAGTCTTCGGTTTGGAAGAGAAGAAAAT TGGCCTGTACTAGAGGATTGGTTTGCCAATCAATTGTACCTTCTTAAGGA AAGAGCTAGAACTGAGAGCGAGGATGTATCCAATGAGGACGATGATGATT CTTCAAGCAATTATGATGATGATAATCAAAAAACTCTTACTCCAGCAAAT ATTGATTCTTATTTTGGCTCCACGTCATTTGGAAATACCTCTTCTGGGAA AAGCAAACTGACCTCTCTTTTTCGAAGTCTAAGTTTGAGTGATTCGAGTG GGGAACGTGTGCTGAGTCGTTTAAGTGAAGGAAGACAATCATTGTCTAAA AAAATTAAAAAAAGTTTGAGTAGACGCTCTTCTACAAAATCTAGAAGAGA TTCTAATGTTAGTGGGAAAACAACTTCATCAGTTGATACGGAGCTTCTTC AGGCTCAGTCCTCAAGTAAGAGACTTAGCTTTAGTTCTGAAGTCTGTGAT GAAGATGGATATTCTCTCACTGATCATTCCCCTGTCAAAGCCGAATCATC GTCAGTAAACGCAGGGTTAGAAAATATTGACGAAGAAGARCCTCCAGGAG CTGCAGCTGCTACTCTTTCATTCTTCAGTGAATTTCAGCCTCCCTCATCT GAAGCAAAGAATAGTAGCTTTATTATAGATTCTGCTTCCACAAGTGGCAT AAGTTCCGAAGACTCCTGCAAATTGGTTGTCACAGCACCGATAGTAGCAA ATATCTCTTCTGCTAAGTTATCTCCCATACCCTCATTGATTGATAATAGC TCGAATGATGGTTTTATACAGCCCCACGCACGGTCCGGTCAGAGAGCTTT CAGCGAAAGTGAAGCCCTTCCAATTGATGTTATCACCATGAAAAGTACGG ATCTTCAATTGGGTGGTGGATCCGTTTCCTCTGTTTGCAGTATCGGATCT TGGACTACTGAAAATTCGGGTTACCGAACAATTCGTGGAATTCATAGTCG AAGGCGCCCTCTTCTCAGCGAGTCAGAAGTAGATACAGAGACCAACTCAC AAAATGCTGAATTAACAGGATCAGCCAATTCTGATACATACAGACGTTCC TCAGGTGGTCTAATCAGGAGGAAAGACTCATGGACTCACAAGTCCAAAAG TCTTGATTATAGACTTACTCGTCTACGTAAAAATAATTCCTCGTGTGTAA ATCATCTTATCTCACCGGATAATCAGCCTATATCTATACTTACACCAACT GTTCAGCAGCAAACCTCACCTGTGGAACTAGTGGGGGGTCAAGAACCTCA GTATCGAGGGATTGCAGTTCCTTCTCAAATCACGGCCTTATTTCCATTTA TTGTTGAGCAAGATTCAAGTGACGTTGGTGATCATTTTCCTACGTCTGTG ACCTTGAGTTCAATAAGCACAAGAGACAGTTCTAACGCGTTCTTTGGACT CGAGTTACATACTCCTTATAATTGCCTTTCATGTTACCGATTAACGTATC CTTGTAAATCTCAGAGTAGAAGTAGATCTCGAACCAGTTCATTAACGAAT CCAGCATCAGAAAGAGTGTCCACAGAGTCTTCCACTGTGAGCACAGGAGG CTCTCCTTCAAATTTGAGAAAAATTGTTGTTACTAAGGGCGTTATTGTTG ATAGTACGGACTCCATTATATCTGCTATGAGCAGTGACCAGGAAACTGCA ACCGGAAAAATGAGAGATAATTCAGTTTTAGGCAAGGTCTTTCAACGTAA AGAGGTTTTGAAACTGATTGATTCCATGATGCATTTTAGTACCAAAACTC ATGAGCAGGGATTACTAAAGTAAGTCTTTGGTTTTTTTATTTTTTAAATC TTTGTTAACGTGTTTTTATAATTAATTATTATGGAATATTTTAATTGATA TTAATTTCATTTTAGAATGAAACAAAAGTTCCCAAATCTCTTCAACGATC TGTGCCTCTACTCTGAAGTGTCATTACTTTTGAGCAAATATGCTTATCGT TTAACCTCTCGACYTTTTATTCAAGAGTTATTTATCGACCTCCATTATGA CGATCTCTACGAAGAACCAGCTAAAATTCTCAAAATAGAAGACTTGGAAA ATGTACGAGAAATGATGGATGATCCTGGAACATCCTCTGATAGCAAAATC AACTCATGA
back to top
Add to Basket