|
|
Associated RNAi Experiments
InterPro
Analysis Name: InterproScan 5
Date Performed: 2014-05-02
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR001760 | Opsin | PRINTS | PR00238 | OPSIN | coord: 181..193
score: 33.77
coord: 65..77
score: 43.34
coord: 304..316
score: 38.09 |
| IPR000276 | G protein-coupled receptor, rhodopsin-like | PRINTS | PR00237 | GPCRRHODOPSN | coord: 209..232
score: 20.5
coord: 307..333
score: 26.65
coord: 123..145
score: 29.19
coord: 269..293
score: 18.77
coord: 44..68
score: 23.48
coord: 158..179
score: 25.01
coord: 77..98
score: 33.63 |
| IPR000276 | G protein-coupled receptor, rhodopsin-like | PFAM | PF00001 | 7tm_1 | coord: 59..325
e-value: 7.4E-49
score: 166.0 |
| IPR000276 | G protein-coupled receptor, rhodopsin-like | PROSITE | PS00237 | G_PROTEIN_RECEP_F1_1 | coord: 129..145 |
| IPR000856 | Opsin RH3/RH4 | PRINTS | PR00577 | OPSINRH3RH4 | coord: 198..212
score: 25.0
coord: 221..238
score: 38.19
coord: 333..351
score: 35.53
coord: 256..270
score: 65.83 |
| None | No IPR available | GENE3D | 1.20.1070.10 | | coord: 28..355
e-value: 3.2E-71
score: 239.2 |
| None | No IPR available | PANTHER | PTHR24240:SF11 | OPSIN | coord: 8..352 |
| None | No IPR available | PANTHER | PTHR24240 | OPSIN | coord: 8..352 |
| None | No IPR available | SUPERFAMILY | 81321 | Family A G protein-coupled receptor-like | coord: 26..344 |
| None | No IPR available | TMHMM | TMhelix | | coord: 277..296 |
| None | No IPR available | TMHMM | TMhelix | | coord: 160..182 |
| None | No IPR available | TMHMM | TMhelix | | coord: 206..228 |
| None | No IPR available | TMHMM | TMhelix | | coord: 117..139 |
| None | No IPR available | TMHMM | TMhelix | | coord: 45..67 |
| None | No IPR available | TMHMM | TMhelix | | coord: 80..102 |
| IPR027430 | Visual pigments (opsins) retinal binding site | PROSITE | PS00238 | OPSIN | coord: 309..325 |
| IPR017452 | GPCR, rhodopsin-like, 7TM | PROSITE | PS50262 | G_PROTEIN_RECEP_F1_2 | coord: 59..325
score: 37.242 |
Analyses
This polypeptide is derived from or has results from the following analyses
Cross References
External references for this polypeptide
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >EMLSAP00000005061 ID=EMLSAP00000005061|Name=EMLSAP00000005061|organism=Lepeophtheirus salmonis|type=polypeptide|length=362bp
MDDVYYNQYPPGMKMTDGIPEELREVIHSHWDQFSPANPLIAHFFGVMFF
FLWVMNFVGNGLVIFIFSKVKSLRTPSNMFVINLALSDLLMMTTMGPAVT
VNVFMQRYWAWGVFGCKLYGCIGAICGVVSILTMVVIGYDRYNVIVKGLN
GFRISVGKALAIILVIWAYSIAISALALFDIWGGYTVEGLLFTCSYDYLT
DDANNTTYILFTFFFMYVLPMSLVFFFYSSIVKAVWAHEMALKQQAKKMN
VESLRTNVDSNAESAEIRIAKVAVTNVSLWAGIWTPXXLVVLXAVMGSRS
SITPLVSQLPSFIAKTASCLNPMVYAMSHPKYREALMKEVPCLGIEEESM
QETVTTKEPVKA back to top
|
