EMLSAG00000000579, EMLSAG00000000579-683345 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000579 vs. C. finmarchicus
Match: gi|592806036|gb|GAXK01148532.1| (TSA: Calanus finmarchicus comp229663_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.913e+0 Identity = 17/53 (32.08%), Postives = 27/53 (50.94%), Query Frame = 0 Query: 4 QDPKKLPIILLRDWALRFFFLEDHGQRGWTCMNLTSSGYMEKIEDRNGSGSFH 56 Q P++L I D ++ F HG +G +C+N T Y+ + + SGS H Sbjct: 792 QLPEELVYI---DIFSQYTFQHFHGNKGLSCLNFTLLDYLLNVTE---SGSIH 932
BLAST of EMLSAG00000000579 vs. C. finmarchicus
Match: gi|592806037|gb|GAXK01148531.1| (TSA: Calanus finmarchicus comp229663_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.917e+0 Identity = 17/53 (32.08%), Postives = 27/53 (50.94%), Query Frame = 0 Query: 4 QDPKKLPIILLRDWALRFFFLEDHGQRGWTCMNLTSSGYMEKIEDRNGSGSFH 56 Q P++L I D ++ F HG +G +C+N T Y+ + + SGS H Sbjct: 804 QLPEELVYI---DIFSQYTFQHFHGNKGLSCLNFTLLDYLLNVTE---SGSIH 944
BLAST of EMLSAG00000000579 vs. C. finmarchicus
Match: gi|592806026|gb|GAXK01148542.1| (TSA: Calanus finmarchicus comp229663_c1_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.387e+0 Identity = 17/53 (32.08%), Postives = 27/53 (50.94%), Query Frame = 0 Query: 4 QDPKKLPIILLRDWALRFFFLEDHGQRGWTCMNLTSSGYMEKIEDRNGSGSFH 56 Q P++L I D ++ F HG +G +C+N T Y+ + + SGS H Sbjct: 16 QLPEELVYI---DIFSQYTFQHFHGNKGLSCLNFTLLDYLLNVTE---SGSIH 156
BLAST of EMLSAG00000000579 vs. C. finmarchicus
Match: gi|592930952|gb|GAXK01027601.1| (TSA: Calanus finmarchicus comp7750036_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.084e+0 Identity = 13/37 (35.14%), Postives = 22/37 (59.46%), Query Frame = 0 Query: 10 PIILLRDWALRFFFLEDHGQRGWTCMNLTSSGYMEKI 46 PI+L LR F + H +R ++ +NLTS G+ + + Sbjct: 195 PILLHH**QLRITFAKHHVRRFFSSVNLTSGGFYQHL 305
BLAST of EMLSAG00000000579 vs. L. salmonis peptides
Match: EMLSAP00000000579 (pep:novel supercontig:LSalAtl2s:LSalAtl2s10987:7:1255:1 gene:EMLSAG00000000579 transcript:EMLSAT00000000579 description:"snap_masked-LSalAtl2s10987-processed-gene-0.0") HSP 1 Score: 151.754 bits (382), Expect = 3.537e-49 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0 Query: 1 MTPQDPKKLPIILLRDWALRFFFLEDHGQRGWTCMNLTSSGYMEKIEDRNGSGSFHQSHIRPRSLWVLLRSL 72 MTPQDPKKLPIILLRDWALRFFFLEDHGQRGWTCMNLTSSGYMEKIEDRNGSGSFHQSHIRPRSLWVLLRSL Sbjct: 1 MTPQDPKKLPIILLRDWALRFFFLEDHGQRGWTCMNLTSSGYMEKIEDRNGSGSFHQSHIRPRSLWVLLRSL 72
BLAST of EMLSAG00000000579 vs. L. salmonis peptides
Match: EMLSAP00000008995 (pep:novel supercontig:LSalAtl2s:LSalAtl2s5641:3040:4160:-1 gene:EMLSAG00000008995 transcript:EMLSAT00000008995 description:"maker-LSalAtl2s5641-snap-gene-0.3") HSP 1 Score: 46.9802 bits (110), Expect = 1.535e-8 Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = 0 Query: 24 LEDHGQRGWTCMNLTSSGYMEKIEDRNG 51 ++ HGQRGW CMN+TSS YMEKI+ NG Sbjct: 61 MKGHGQRGWMCMNITSSEYMEKIKYCNG 88 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000579 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000579 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 4
BLAST of EMLSAG00000000579 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000000579 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000579 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000579 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000579 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s10987:7..1255+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000579-683345 ID=EMLSAG00000000579-683345|Name=EMLSAG00000000579|organism=Lepeophtheirus salmonis|type=gene|length=1249bp|location=Sequence derived from alignment at LSalAtl2s10987:7..1255+ (Lepeophtheirus salmonis)back to top Add to Basket
|