EMLSAG00000001305, EMLSAG00000001305-684071 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001305 vs. C. finmarchicus
Match: gi|592795446|gb|GAXK01159122.1| (TSA: Calanus finmarchicus comp3800263_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.084e+0 Identity = 15/51 (29.41%), Postives = 26/51 (50.98%), Query Frame = 0 Query: 21 EDPCNMVLDNHNRAEML--SRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSL 69 ED CN +D NRA++ RNF G ++++++ ++ EK L Sbjct: 180 EDDCNFTVDRWNRAKIRK*ERNFQLGLLVKLVRREINFKPVAGISNLEKKL 332
BLAST of EMLSAG00000001305 vs. C. finmarchicus
Match: gi|592954695|gb|GAXK01003858.1| (TSA: Calanus finmarchicus comp2093481_c1_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.463e+0 Identity = 10/19 (52.63%), Postives = 12/19 (63.16%), Query Frame = 0 Query: 49 WPKKQVSYTFGPSFTSKEK 67 WP V Y F PSFTS ++ Sbjct: 779 WPGNNVPYYFRPSFTSTDR 835
BLAST of EMLSAG00000001305 vs. C. finmarchicus
Match: gi|592940370|gb|GAXK01018183.1| (TSA: Calanus finmarchicus comp32024_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.534e+0 Identity = 11/33 (33.33%), Postives = 19/33 (57.58%), Query Frame = 0 Query: 38 SRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 ++N + +N W V YT +FTS E+++I Sbjct: 312 TKNGIAALDNHWGSGLVPYTIDAAFTSSERAVI 410
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000001305 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1217:75372:75658:-1 gene:EMLSAG00000001305 transcript:EMLSAT00000001305 description:"maker-LSalAtl2s1217-snap-gene-1.13") HSP 1 Score: 147.517 bits (371), Expect = 1.335e-47 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0 Query: 1 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI Sbjct: 1 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000008156 (pep:novel supercontig:LSalAtl2s:LSalAtl2s488:318508:319851:-1 gene:EMLSAG00000008156 transcript:EMLSAT00000008156 description:"maker-LSalAtl2s488-snap-gene-2.6") HSP 1 Score: 135.961 bits (341), Expect = 4.207e-42 Identity = 63/70 (90.00%), Postives = 65/70 (92.86%), Query Frame = 0 Query: 1 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 MITYVLLLS+ SILVQPYHAED C MVLDNHNRAEM+SRNFVFGSNN WPKKQV YTFGPSFTSKEKSLI Sbjct: 1 MITYVLLLSVFSILVQPYHAEDACKMVLDNHNRAEMMSRNFVFGSNNLWPKKQVPYTFGPSFTSKEKSLI 70
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000003608 (pep:novel supercontig:LSalAtl2s:LSalAtl2s197:439666:441909:1 gene:EMLSAG00000003608 transcript:EMLSAT00000003608 description:"augustus_masked-LSalAtl2s197-processed-gene-3.1") HSP 1 Score: 112.079 bits (279), Expect = 6.683e-33 Identity = 50/70 (71.43%), Postives = 59/70 (84.29%), Query Frame = 0 Query: 1 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 MITY+LLL++ SIL+ PY AED C M+LD HN+AEM+SRNF+FG+NN WP KQV YTFGPSFT EKSLI Sbjct: 1 MITYLLLLTVASILIPPYQAEDGCKMMLDKHNKAEMMSRNFIFGNNNLWPNKQVPYTFGPSFTPNEKSLI 70
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000009605 (pep:novel supercontig:LSalAtl2s:LSalAtl2s617:5548:8177:1 gene:EMLSAG00000009605 transcript:EMLSAT00000009605 description:"maker-LSalAtl2s617-snap-gene-0.28") HSP 1 Score: 108.997 bits (271), Expect = 1.376e-31 Identity = 49/70 (70.00%), Postives = 57/70 (81.43%), Query Frame = 0 Query: 1 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 MITY+LLL++ SIL+ PY AE CNM+LD HNRAEM+SR+FVFGSNN WP KQV YTFG S TS E+S I Sbjct: 1 MITYILLLTVCSILIPPYQAEGACNMMLDKHNRAEMMSRSFVFGSNNLWPNKQVPYTFGASLTSNERSSI 70
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000009907 (pep:novel supercontig:LSalAtl2s:LSalAtl2s645:36339:38052:1 gene:EMLSAG00000009907 transcript:EMLSAT00000009907 description:"augustus_masked-LSalAtl2s645-processed-gene-0.0") HSP 1 Score: 105.531 bits (262), Expect = 1.123e-29 Identity = 59/70 (84.29%), Postives = 62/70 (88.57%), Query Frame = 0 Query: 1 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 MITY LLLS+LSILVQPY AED C MVLDNHNRAEM+S+ FVFGSNN WPKKQVSY FGPSFTSKEK LI Sbjct: 1 MITYALLLSVLSILVQPYPAEDACKMVLDNHNRAEMMSKIFVFGSNNLWPKKQVSYNFGPSFTSKEKYLI 70
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000000529 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1082:34274:35257:-1 gene:EMLSAG00000000529 transcript:EMLSAT00000000529 description:"maker-LSalAtl2s1082-augustus-gene-0.6") HSP 1 Score: 88.9669 bits (219), Expect = 1.875e-23 Identity = 46/70 (65.71%), Postives = 56/70 (80.00%), Query Frame = 0 Query: 1 MITYVLLLSLLSILVQPYHAEDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 MITY+LLLS+ SIL+ PY AE+ C M++D HNRAEM+S+NFVFG+NN WP KQV Y FG FTS EK +I Sbjct: 4 MITYLLLLSVSSILIPPYQAEEACRMMIDKHNRAEMMSKNFVFGNNNLWPDKQVPYVFGTRFTSSEKKMI 73
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000004531 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2375:4575:5187:1 gene:EMLSAG00000004531 transcript:EMLSAT00000004531 description:"maker-LSalAtl2s2375-snap-gene-0.0") HSP 1 Score: 77.411 bits (189), Expect = 7.194e-20 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 27 VLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 +LD HN+AEM+SRNFVFGSNN WP KQV +TFGPSFTS E+SLI Sbjct: 1 MLDKHNKAEMMSRNFVFGSNNLWPNKQVPFTFGPSFTSNERSLI 44
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000007463 (pep:novel supercontig:LSalAtl2s:LSalAtl2s427:23035:25185:1 gene:EMLSAG00000007463 transcript:EMLSAT00000007463 description:"maker-LSalAtl2s427-augustus-gene-0.3") HSP 1 Score: 51.6026 bits (122), Expect = 1.992e-9 Identity = 21/50 (42.00%), Postives = 31/50 (62.00%), Query Frame = 0 Query: 21 EDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 E C +++D H+RA M SRNF+ G +N WP V YT +F+S ++ I Sbjct: 27 EGSCRVLVDAHDRAAMYSRNFIGGRSNRWPNGIVPYTISSNFSSSQRQTI 76
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000006562 (pep:novel supercontig:LSalAtl2s:LSalAtl2s35:27234:28536:-1 gene:EMLSAG00000006562 transcript:EMLSAT00000006562 description:"maker-LSalAtl2s35-augustus-gene-0.13") HSP 1 Score: 48.1358 bits (113), Expect = 3.250e-8 Identity = 19/47 (40.43%), Postives = 29/47 (61.70%), Query Frame = 0 Query: 24 CNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 C +++D ++RA M SRNF+ G +N WP V YT F+S ++ I Sbjct: 30 CRVLVDAYDRAAMYSRNFIGGRSNRWPNGIVPYTISSDFSSSQRQTI 76
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Match: EMLSAP00000011131 (pep:novel supercontig:LSalAtl2s:LSalAtl2s756:274080:275679:1 gene:EMLSAG00000011131 transcript:EMLSAT00000011131 description:"maker-LSalAtl2s756-augustus-gene-2.11") HSP 1 Score: 46.9802 bits (110), Expect = 9.656e-8 Identity = 20/50 (40.00%), Postives = 29/50 (58.00%), Query Frame = 0 Query: 21 EDPCNMVLDNHNRAEMLSRNFVFGSNNPWPKKQVSYTFGPSFTSKEKSLI 70 E C ++L ++RA M SRNF+ G +N WP V Y +FTS ++ I Sbjct: 40 EGSCKVLLGAYDRAAMYSRNFIGGRSNRWPNGIVPYIISSNFTSSQRQTI 89 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001305 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001305 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 3
BLAST of EMLSAG00000001305 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 14
Pagesback to top
BLAST of EMLSAG00000001305 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001305 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001305 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001305 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1217:75372..75658- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001305-684071 ID=EMLSAG00000001305-684071|Name=EMLSAG00000001305|organism=Lepeophtheirus salmonis|type=gene|length=287bp|location=Sequence derived from alignment at LSalAtl2s1217:75372..75658- (Lepeophtheirus salmonis)back to top Add to Basket
|