EMLSAG00000002145, EMLSAG00000002145-684911 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000002145 vs. C. finmarchicus
Match: gi|592757930|gb|GAXK01196483.1| (TSA: Calanus finmarchicus comp577599_c0_seq2 transcribed RNA sequence) HSP 1 Score: 33.8834 bits (76), Expect = 3.643e-1 Identity = 19/51 (37.25%), Postives = 31/51 (60.78%), Query Frame = 0 Query: 35 TRVDTNVKKASHAILNE--LKPIFGVQKDCELEIINIDNVQSNIDPEDRVF 83 T V+T+VK S ++ E +KP +++ LE IN+D +S DP+D+ F Sbjct: 52 TSVETSVKTLSGILVEEEEVKPKGNTKRNMTLEEINVDKTESKEDPKDKRF 204
BLAST of EMLSAG00000002145 vs. C. finmarchicus
Match: gi|592757931|gb|GAXK01196482.1| (TSA: Calanus finmarchicus comp577599_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.8834 bits (76), Expect = 3.646e-1 Identity = 19/51 (37.25%), Postives = 31/51 (60.78%), Query Frame = 0 Query: 35 TRVDTNVKKASHAILNE--LKPIFGVQKDCELEIINIDNVQSNIDPEDRVF 83 T V+T+VK S ++ E +KP +++ LE IN+D +S DP+D+ F Sbjct: 52 TSVETSVKTLSGILVEEEEVKPKGNTKRNMTLEEINVDKTESKEDPKDKRF 204
BLAST of EMLSAG00000002145 vs. C. finmarchicus
Match: gi|592811546|gb|GAXK01143022.1| (TSA: Calanus finmarchicus comp5783865_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 2.695e+0 Identity = 19/52 (36.54%), Postives = 28/52 (53.85%), Query Frame = 0 Query: 44 ASHAILNELKPIF--GVQKDCELEIINIDNVQSNIDPEDRVFKMDLLLLSSS 93 A ILN +F +Q+DC +I NV SNI + +FK+ +LLS + Sbjct: 195 AILTILNVFNCLFEISIQQDCLFIFFSIFNVCSNILLKLNIFKLSWMLLSDT 350
BLAST of EMLSAG00000002145 vs. C. finmarchicus
Match: gi|592929017|gb|GAXK01029528.1| (TSA: Calanus finmarchicus comp150073_c2_seq12 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.856e+0 Identity = 12/26 (46.15%), Postives = 19/26 (73.08%), Query Frame = 0 Query: 61 DCELEIINIDNVQSNIDPEDRVFKMD 86 DC LE++N+ VQ +I P R+FK++ Sbjct: 624 DCNLELVNVFLVQRDIHPLTRIFKLN 701
BLAST of EMLSAG00000002145 vs. C. finmarchicus
Match: gi|592929018|gb|GAXK01029527.1| (TSA: Calanus finmarchicus comp150073_c2_seq11 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.897e+0 Identity = 12/26 (46.15%), Postives = 19/26 (73.08%), Query Frame = 0 Query: 61 DCELEIINIDNVQSNIDPEDRVFKMD 86 DC LE++N+ VQ +I P R+FK++ Sbjct: 624 DCNLELVNVFLVQRDIHPLTRIFKLN 701
BLAST of EMLSAG00000002145 vs. C. finmarchicus
Match: gi|592929019|gb|GAXK01029526.1| (TSA: Calanus finmarchicus comp150073_c2_seq10 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 3.006e+0 Identity = 12/26 (46.15%), Postives = 19/26 (73.08%), Query Frame = 0 Query: 61 DCELEIINIDNVQSNIDPEDRVFKMD 86 DC LE++N+ VQ +I P R+FK++ Sbjct: 624 DCNLELVNVFLVQRDIHPLTRIFKLN 701
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Match: EMLSAP00000002145 (pep:novel supercontig:LSalAtl2s:LSalAtl2s139:1460230:1461759:-1 gene:EMLSAG00000002145 transcript:EMLSAT00000002145 description:"maker-LSalAtl2s139-augustus-gene-14.28") HSP 1 Score: 382.489 bits (981), Expect = 2.469e-136 Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 0 Query: 1 MRTLLDSYFVCFVNFIQIGLKSSSSIINSEIFINTRVDTNVKKASHAILNELKPIFGVQKDCELEIINIDNVQSNIDPEDRVFKMDLLLLSSSTNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKKFCLLPQNLEKTTCISIIDSILFTTPLSDTKNEI 190 MRTLLDSYFVCFVNFIQIGLKSSSSIINSEIFINTRVDTNVKKASHAILNELKPIFGVQKDCELEIINIDNVQSNIDPEDRVFKMDLLLLSSSTNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKKFCLLPQNLEKTTCISIIDSILFTTPLSDTKNEI Sbjct: 1 MRTLLDSYFVCFVNFIQIGLKSSSSIINSEIFINTRVDTNVKKASHAILNELKPIFGVQKDCELEIINIDNVQSNIDPEDRVFKMDLLLLSSSTNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKKFCLLPQNLEKTTCISIIDSILFTTPLSDTKNEI 190
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Match: EMLSAP00000004427 (pep:novel supercontig:LSalAtl2s:LSalAtl2s231:166619:167331:1 gene:EMLSAG00000004427 transcript:EMLSAT00000004427 description:"maker-LSalAtl2s231-augustus-gene-1.7") HSP 1 Score: 70.8626 bits (172), Expect = 7.892e-16 Identity = 42/113 (37.17%), Postives = 57/113 (50.44%), Query Frame = 0 Query: 67 INIDNVQSNIDPEDRVFKMD---LLLLSSSTNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKKFCLLPQNLEKTTCISIIDS 176 + I + Q DPE + ++ L T+ +C L+IK+ + YELELQVE DC Y KNC ++V QP NLCP +FCL P+NL C+ II S Sbjct: 26 VPIKSTQDVSDPEIQKVALETTKFLYHLFDTSKACPLYIKDVIXATKQSFPSTVYELELQVETNGADFDCDYVLKNCANIQVQQPPTNLCPGNQFCLFPENLNNINCVDIILS 138
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Match: EMLSAP00000002144 (pep:novel supercontig:LSalAtl2s:LSalAtl2s139:1454355:1455102:1 gene:EMLSAG00000002144 transcript:EMLSAT00000002144 description:"maker-LSalAtl2s139-augustus-gene-14.23") HSP 1 Score: 69.3218 bits (168), Expect = 2.466e-15 Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 0 Query: 97 SCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKKFCLLPQNLEKTTCISI 173 +C L++K+ + + YELELQVE DC Y FKNC ++V +P NLCP +FCL+P+NL+ C+ I Sbjct: 59 ACPLYVKDVIQAKKQSFPSTVYELELQVETNGADFDCDYVFKNCANIRVQEPPINLCPGNQFCLIPENLKGIDCVDI 135
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Match: EMLSAP00000002147 (pep:novel supercontig:LSalAtl2s:LSalAtl2s139:1478126:1479135:-1 gene:EMLSAG00000002147 transcript:EMLSAT00000002147 description:"maker-LSalAtl2s139-augustus-gene-14.29") HSP 1 Score: 68.9366 bits (167), Expect = 8.947e-15 Identity = 33/81 (40.74%), Postives = 50/81 (61.73%), Query Frame = 0 Query: 94 TNGSCGLHIKNCLDVQIHM-NEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKKFCLLPQNLEKTTCISI 173 T +C +H++ + + + ++ I+YE+ELQVE DC Y KNC+ VK+ QP +LCP KKFCL+P L + C+ I Sbjct: 157 TTNACPIHLREVVRAKRQLISDSINYEIELQVETNGADFDCEYVHKNCDNVKLHQPPLHLCPGKKFCLIPVKLNEINCVEI 237
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Match: EMLSAP00000002146 (pep:novel supercontig:LSalAtl2s:LSalAtl2s139:1473318:1476139:1 gene:EMLSAG00000002146 transcript:EMLSAT00000002146 description:"snap_masked-LSalAtl2s139-processed-gene-14.16") HSP 1 Score: 64.6994 bits (156), Expect = 3.681e-13 Identity = 32/79 (40.51%), Postives = 45/79 (56.96%), Query Frame = 0 Query: 94 TNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCP-NKKFCLLPQNLEKTTCI 171 T C LH+ L M+ GI+Y L+++VE C ++ K+C V++ QP P+LCP K FCL+P NL TCI Sbjct: 183 TTHPCPLHVTKILHASEQMDHGINYLLDIEVETNEIDFYCEHEVKHCKSVQLHQPSPHLCPFGKHFCLIPTNLNDVTCI 261
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Match: EMLSAP00000007005 (pep:novel supercontig:LSalAtl2s:LSalAtl2s398:305820:307985:1 gene:EMLSAG00000007005 transcript:EMLSAT00000007005 description:"maker-LSalAtl2s398-snap-gene-3.25") HSP 1 Score: 56.225 bits (134), Expect = 7.532e-10 Identity = 30/91 (32.97%), Postives = 49/91 (53.85%), Query Frame = 0 Query: 94 TNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKK-FCLLPQNLEKTTCISIIDSILFTTPL 183 T+ C LH+ + + G +YELE+QVE DC + KNC V+V +P CP+++ C++P L+ CI +++I TP+ Sbjct: 167 TSNPCPLHLVEVIRAKQQAVMGFNYELEIQVETNGADFDCEHIIKNCENVRVHEPIAEFCPHEEPSCVVPVRLQDVDCIE-VNTIFNETPI 256 HSP 2 Score: 46.9802 bits (110), Expect = 9.504e-7 Identity = 27/78 (34.62%), Postives = 39/78 (50.00%), Query Frame = 0 Query: 94 TNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCP-NKKFCLLPQNLEKTTC 170 TN +C +H+ D QI N Y +E Q+E C KNC V+V + P LCP N C++P+ L++ C Sbjct: 384 TNIACQVHVN---DAQILKNVNDVYHMEFQLETRKSEEGCKSIKKNCKNVRVREIKPQLCPHNNPICIVPEQLDEVEC 458
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Match: EMLSAP00000002142 (pep:novel supercontig:LSalAtl2s:LSalAtl2s139:1427481:1429315:-1 gene:EMLSAG00000002142 transcript:EMLSAT00000002142 description:"snap_masked-LSalAtl2s139-processed-gene-14.19") HSP 1 Score: 48.9062 bits (115), Expect = 1.941e-7 Identity = 21/77 (27.27%), Postives = 45/77 (58.44%), Query Frame = 0 Query: 94 TNGSCGLHIKNCLDVQIHMNEGISYELELQVEVESDLTDCPYKFKNCNGVKVFQPYPNLCPNKKFCLLPQNLEKTTC 170 T+ +C +H++ + + +G +Y+LE+QVE + +C Y K C+ + V +P + +++ C+LP +L++ C Sbjct: 173 TSSACPIHLREVVQASEQIVDGTNYKLEIQVETDGANFECEYVQKQCSNIIVHEPLAHCPHDEEDCILPVDLQEVEC 249 The following BLAST results are available for this feature:
BLAST of EMLSAG00000002145 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000002145 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000002145 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 7
BLAST of EMLSAG00000002145 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000002145 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000002145 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000002145 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s139:1460230..1461759- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000002145-684911 ID=EMLSAG00000002145-684911|Name=EMLSAG00000002145|organism=Lepeophtheirus salmonis|type=gene|length=1530bp|location=Sequence derived from alignment at LSalAtl2s139:1460230..1461759- (Lepeophtheirus salmonis)back to top Add to Basket
|