EMLSAT00000000118, EMLSAT00000000118-695965 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000000118
Unique NameEMLSAT00000000118-695965
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
A F2 (IRP1) LsIRP1A female
  1. PreAdult2
  2. Adult
-Missing-
-Missing-
23.01.2012 - 09:00
24.02.2012 - 09:00
Characterisation of iron regulatory protein 1A... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, shorter eggstrings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
B F2+F3 (IRP1+IRP2) LsIRP1B, LsIRP1A female
  1. PreAdult2
  2. Adult
-Missing-
female reproduction, shorter eggstrings
19.03.2012 - 09:00
18.04.2012 - 09:00
Characterisation of iron regulatory protein 1A... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
NAE F2 LsIRP1A unknown
  1. Nauplius I
  2. Copepodid
no phenotype
no visible phenotype
12.06.2014 (All day)
20.06.2014 (All day)
Characterisation of iron regulatory protein 1A... more
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s101supercontigLSalAtl2s101:496791..499884 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000000118 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000000118EMLSAG00000000118-682884Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000000497EMLSAE00000000497-709425Lepeophtheirus salmonisexon
EMLSAE00000000498EMLSAE00000000498-709426Lepeophtheirus salmonisexon
EMLSAE00000000499EMLSAE00000000499-709427Lepeophtheirus salmonisexon
EMLSAE00000000500EMLSAE00000000500-709428Lepeophtheirus salmonisexon
EMLSAE00000000501EMLSAE00000000501-709429Lepeophtheirus salmonisexon
EMLSAE00000000502EMLSAE00000000502-709430Lepeophtheirus salmonisexon
EMLSAE00000000503EMLSAE00000000503-709431Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto778177auto778177Lepeophtheirus salmonispolypeptide
EMLSAP00000000118EMLSAP00000000118Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000000118

>EMLSAP00000000118 ID=EMLSAP00000000118|Name=EMLSAP00000000118|organism=Lepeophtheirus salmonis|type=polypeptide|length=895bp
MANPFDKILKNFEIGGKTYKYYDVSSLDPSYHKLPYSIRILLESAVRNCD
NFQVYEKDVETILNWEGNRGKNAEIPFRPGRVILQDFTGVPAIVDFAAMR
DAVKKLGGDPSKINPTCPTDLVIDHSIQVDFARESKALMKNEDLEFQRNK
ERFTFLKWGASSFQNMLIIPPGSGIVHQVNLEYLARVCFTDTDLVFPDSV
VGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQPISMVLPEVVGYRISGSP
QPLVNSTDIVLTITKHLRQVGVVGRFVEFYGPGIKHLSIADRATISNMCP
EYGATIGXFPVDLVSIEYLRLTNRESSKVKCIQEYLHLTNLLRDYEDKST
DPTFSQIVVLDLGTVVTSCSGPKRPQDRVAVTDMKNDFLQCLSNKIGFKG
FAIPDNKKNITVPIIAPDNKEYILRHGSVLIAAITSCTNTSNPSVMLGAG
LLAKKAVDKGLTVPPYIKTSLSPGSGVVTYYLKNSGVIPYLDALGFSIVG
YGXMTCIGNSGPLEDYVVXGXNKGDLVCAGVLSGNRNFEGRINPHTRANY
LASPPLVIAYAIAGRVDIDFEVEALGFDANNEPIYLRDIWPTRDEIQIVE
KKYIVPSMFEDVYSKVTTGNERWNSLEAPKGILYPWDIESTYIKSPPFFD
NMSEELPEPKKIKNALALLNLGXSFTXDHISPAGXIARNXPAARYLASKN
ISPREFNSYGSRRGNDAIMARGTFANIRLVNKFLGGKPGPKTIHLISGDI
MDVFDAAMEYKKENQHLIVLAGKDYGCGSSRDWAAKGPFLLGVRAVIAES
YERIHRSNLVGMGIVPLQYSEGESSESLGFSGKEKFSVELPTNLIPQQVL
DIKVECLDGSIKSFKATVRFDTELELTYYRHGGILNYMIRKVISD
back to top

mRNA from alignment at LSalAtl2s101:496791..499884-

Legend: exonpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000000118-695965 ID=EMLSAT00000000118-695965|Name=EMLSAT00000000118|organism=Lepeophtheirus salmonis|type=mRNA|length=3094bp|location=Sequence derived from alignment at LSalAtl2s101:496791..499884- (Lepeophtheirus salmonis)
ATGGCTAATCCATTTGACAAGATATTAAAGAATTTCGAAATTGGGGGAAA AACCTATAAATACTACGATGTGTCGTCCTTGGATCCCTCCTATCATAAGT TGCCTTACTCCATACGGATTTTGCTTGAATCTGCCGTTCGAAACTGTGAT AATTTCCAAGTAAAGCTATTCTGCATTTAGTCAAGGATCACGCATGTTCC TTTTTATTCCCTTAGGTGTACGAGAAAGACGTGGAAACAATACTGAACTG GGAAGGGAATCGAGGGAAGAATGCAGAGATTCCATTCCGACCAGGTCGTG TTATACTCCAAGACTTTACTGGAGTTCCCGCTATCGTGGATTTTGCAGCT ATGAGAGATGCTGTCAAGAAACTCGGCGGAGATCCCTCCAAGATCAACCC AACATGTCCCACAGATCTCGTTATTGATCACTCCATCCAAGTGGACTTTG CTCGTGAGTCCAAGGCTCTCATGAAGAATGAGGATTTAGAGTTTCAACGA AACAAGGAGAGATTCACATTTCTTAAATGGGGTGCGAGCAGTTTTCAAAA CATGCTCATCATACCTCCAGGATCTGGGATTGTTCATCAAGTGAATCTTG AGTATTTGGCCCGCGTTTGCTTTACAGATACGGATCTTGTTTTCCCTGAC TCTGTCGTAGGAACAGATTCCCATACCACGATGATTAATGGTCTTGGAGT TGTTGGATGGGGAGTTGGAGGCATAGGTATTCATTAGCGCTTCAATTTAT AAAAACATCCTAATTTTTGCCCTTTTTTTACAGAGGCTGAAGCTGTAATG TAAGTTCCTTTATTGTTAACCCTTTTTTACTTTAATAATAATAATAAAAA ATAAGGAAGTAATATAGGTAAATATTTAAAATGATTTCAAAAATTTTAAA GGCTTGGACAACCCATTTCCATGGTCTTACCTGAGGTTGTGGGCTACCGA ATCTCAGGCTCCCCCCAACCCCTGGTCAACTCAACGGATATTGTATTGAC AATTACAAAACATTTACGACAAGTCGGGGTTGTTGGTAGGTTTGTGGAAT TTTATGGTCCTGGGATCAAACACCTCTCCATTGCTGATAGAGCAACAATT TCAAATATGTGTCCCGAGTATGGTGCAACCATCGGCTAMTTTCCAGTGGA TTTGGTATCCATTGAATACCTCAGGTTTTAACATATTTTTAGTCTTCTCA ACCATCTCATTGACTTATTATTTTTTTATCTTTCAAGACTTACAAATCGT GAATCCTCAAAGGTGAAGTGCATTCAAGAGTATCTTCATCTCACGAATCT TTTAAGGGACTATGAGGATAAGTCCACTGATCCCACATTTTCTCAAATTG TGGTACTTGACTTGGGAACTGTTGTTACAAGTTGTTCGGGTCCAAAACGG CCTCAAGATAGAGTTGCCGTCACTGACATGAAAAATGACTTTTTACAGTG TCTATCTAATAAGATTGGCTTCAAGGGATTCGCCATTCCTGATAACAAGA AAAATATAACTGTGCCAATCATTGCTCCAGATAACAAGGAGTATATTCTA AGACATGGCTCCGTTCTTATTGCAGCTATTACTAGCTGCACGAATACTTC AAATCCAAGGTAAGTTGTGGGTTGTCTATTCTACCGTTTTTAATATCTGA TGATTTTCTGTTTATTCTCAAGTGTTATGTTAGGTGCTGGATTATTGGCA AAAAAAGCAGTGGATAAAGGGCTTACTGTTCCTCCTTATATCAAGACTAG CCTGTCTCCTGGTTCAGGAGTAGTCACCTACTATCTTAAAAATTCAGGTG TGATCCCTTATCTAGATGCACTTGGATTCTCAATTGTTGGATATGGCTGS ATGACTTGTATTGGTAATTCTGGTCCTCTTGAAGATTATGTGGTGGRAGG TGKAAATAAGGGGGACCTTGTTTGTGCTGGAGTCCTTTCTGGAAATCGTA ATTTTGAGGGTCGTATTAATCCTCATACGCGAGCAAATTATTTAGCCTCT CCGCCCTTGGTTATTGCGTATGCGATTGCTGGACGAGTGGATATCGATTT TGAAGTAGAAGCTCTCGGATTTGATGCTAACAATGAACCCATTTATCTGC GAGATATCTGGCCTACTCGGGATGAGATTCAAATTGTAGAAAAGAAGTAT ATTGTTCCTTCTATGTTTGAAGATGTTTACTCAAAAGTAACTACTGGAAA TGAGAGATGGAATTCTCTGGAAGCTCCAAAAGGAATACTCTATCCTTGGG ATATAGAGTCAACCTATATAAAAAGCCCTCCATTTTTCGACAATATGTCA GAGGAATTGCCTGAACCTAAAAAAATAAAGAATGCACTAGCTCTTTTGAA TCTAGGCGMCTCTTTTACCASGGATCATATAAGTCCTGCTGGAAKTATTG CWAGAAATASCCCCGCCGCAAGATATTTAGCTTCCAAGAACATCAGTCCA AGAGAATTTAATTCATATGGTTCACGTCGGGGTAATGATGCTATTATGGC TCGAGGGACATTTGCAAACATACGTCTTGTAAACAAATTCCTTGGAGGAA AGCCCGGCCCTAAAACCATTCATCTCATTTCGGGGGACATAATGGATGTA TTTGATGCTGCAATGGAGTATAAAAAGGAAAATCAACACCTCATTGTTCT GGCTGGAAAAGACTATGGCTGTGGTTCAAGTCGTGATTGGGCAGCGAAAG GTCCATTTTTACTGGTGAGGAAATTATTTCTATGAGTCCACTTCATTTAT TGTATATGGTTATAATTAAAATTATTTAGGGTGTAAGGGCTGTGATTGCG GAATCTTATGAAAGGATTCATCGATCGAACCTTGTAGGAATGGGAATCGT CCCCCTTCAATACTCTGAGGGCGAGTCTAGTGAGTCACTCGGATTTTCTG GCAAGGAAAAGTTTAGTGTCGAACTTCCCACTAATTTAATTCCTCAACAA GTTCTGGATATTAAAGTTGAATGTCTTGACGGATCTATCAAATCGTTCAA GGCCACAGTGAGATTTGACACTGAGTTGGAATTAACATATTATCGCCATG GTGGCATTCTTAATTATATGATAAGAAAAGTTATATCTGACTAG
back to top
Add to Basket