EMLSAG00000000010, EMLSAG00000000010-682776 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000010
Unique NameEMLSAG00000000010-682776
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:IntS11 "Integrator 11" species:7227 "Drosophila melanogaster" [GO:0006379 "mRNA cleavage" evidence=ISS] [GO:0005847 "mRNA cleavage and polyadenylation specificity factor complex" evidence=ISS] [GO:0006378 "mRNA polyadenylation" evidence=ISS] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0034472 "snRNA 3'-end processing" evidence=IDA] [GO:0016180 "snRNA processing" evidence=ISS] [GO:0032039 "integrator complex" evidence=ISS] [GO:0022008 "neurogenesis" evidence=IMP] InterPro:IPR001279 SMART:SM00849 Pfam:PF07521 EMBL:AE014297 GO:GO:0022008 GO:GO:0006378 GO:GO:0016787 GO:GO:0034472 Gene3D:3.60.15.10 GO:GO:0005847 GO:GO:0006379 eggNOG:COG1236 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 KO:K13148 GeneTree:ENSGT00730000110857 OMA:AYIDNPG OrthoDB:EOG741Z1M EMBL:AY061097 RefSeq:NP_651721.1 UniGene:Dm.3722 SMR:Q9VAH9 STRING:7227.FBpp0084842 EnsemblMetazoa:FBtr0085476 GeneID:43506 KEGG:dme:Dmel_CG1972 UCSC:CG1972-RA CTD:43506 FlyBase:FBgn0039691 InParanoid:Q9VAH9 GenomeRNAi:43506 NextBio:834295 PRO:PR:Q9VAH9 Uniprot:Q9VAH9)

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 398/599 (66.44%), Postives = 482/599 (80.47%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVSN---VSFCHQDEQLGEFVLNIVRSI 599
            +I++TPLGAGQDVGRSCLL+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T H+D VIISHFHLDHCGALPYM+E+VGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFT+ MIK+CMKKV+ V LHQ + VD  LEIKAYYAGHVLGAAMF +KVG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+CV +GGKVLIPVFALGRAQELCILLETYW+RMNLK PI+F+ GLTEKA  YYKMFITWTN+KIRKTFV RNMFDFK IKP D+AYI NPG MVVFATPGMLH GLSL IF++W  NE NM+IMPGYCV GTVG+KIL G +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI  CEPKNVMLVHGE  KM+FL++KI+ E  ++ +MPANGET  IS P+ +    S S++K E   Y  +PPDPKR RL+HGV+VMKD  + + +     +E GI  H +R+T  V   +    P+   +++L   +   L   +++++ +      E+V  K+E DE         +S+ +QDE +G ++LN+++++
Sbjct:    3 DIKITPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSHIDCVIISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTTQMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPVFALGRAQELCILLETYWERMNLKYPIYFALGLTEKANTYYKMFITWTNQKIRKTFVHRNMFDFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVGNKILGGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQNCEPKNVMLVHGEAGKMKFLRSKIKDEFNLETYMPANGETCVISTPVKIPVDASVSLLKAEARSYNAQPPDPKRRRLIHGVLVMKDNRIMLQNLTDALKEIGINRHVMRFTSKVKMDD--SGPVIRTSERLKTLLEEKLA-GWTVTMQENGSIAIESVEVKVEEDEKDPKQKNILISWTNQDEDIGAYILNVLQNM 596          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:CPSF3L "Integrator complex subunit 11" species:9031 "Gallus gallus" [GO:0005634 "nucleus" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 GO:GO:0016787 GO:GO:0032039 Gene3D:3.60.15.10 eggNOG:COG1236 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 HOGENOM:HOG000231294 KO:K13148 GO:GO:0016180 HOVERGEN:HBG080215 EMBL:AJ720814 RefSeq:NP_001012854.1 UniGene:Gga.13403 ProteinModelPortal:Q5ZIH0 STRING:9031.ENSGALP00000002583 PaxDb:Q5ZIH0 GeneID:419418 KEGG:gga:419418 CTD:54973 InParanoid:Q5ZIH0 NextBio:20822477 PRO:PR:Q5ZIH0 Uniprot:Q5ZIH0)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 397/598 (66.39%), Postives = 469/598 (78.43%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLS--AVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIEN--DEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EI+VTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPTKAI PILLED R++ V++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VDE LEIKAYYAGHVLGAAMFQ+KVG  S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLK PI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DRA+  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQLI   EP+NV+LVHGE  KMEFLK KIE E  V C+MPANGET TI    ++   +S  ++K+E     L  PD K+ +L+HG ++MKD +  ++ PE+  +E G+  H +R+T  V     +Q P        ++YN +   L D     L D  I +   +I    +  D+G  V  VS+ +QDE+LG ++ ++++
Sbjct:    3 EIKVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGYNDDRRFPDFSYI--TQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTKAICPILLEDYRKITVDKKGETNFFTSQMIKDCMKKVVAVHLHQTVQVDEELEIKAYYAGHVLGAAMFQIKVGCESVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKAPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQILEVKMQVEYMSFSAHADAKGIMQLIRQAEPRNVLLVHGEAKKMEFLKQKIEQEFHVNCYMPANGETTTIFTNPSIPVDISLGLLKRETAIGLL--PDAKKPKLMHGTLIMKDNSFRLVSPEQALKELGLAEHQLRFTCRV----HIQDPRKEHETVLRVYNHLKGVLKDYSVQHLPDGSITVESILIQATAHSEDQGTKVLLVSWTYQDEELGSYLTSLLK 592          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:CPSF3L "Integrator complex subunit 11" species:9031 "Gallus gallus" [GO:0016787 "hydrolase activity" evidence=IEA] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 GO:GO:0008152 GO:GO:0016787 Gene3D:3.60.15.10 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 OMA:IDNPGPM GeneTree:ENSGT00730000110857 OrthoDB:EOG741Z1M TreeFam:TF105878 EMBL:AADN03007960 Ensembl:ENSGALT00000002586 Uniprot:F1NV30)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 396/598 (66.22%), Postives = 469/598 (78.43%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLS--AVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIEN--DEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EI+VTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPTKAI PILLED R++ V++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VDE LEIKAYYAGHVLGAAMFQ+KVG  S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLK PI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DRA+  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQLI   EP+NV+LVHGE  KMEFLK KIE E  V C+MPANGET +I    ++   +S  ++K+E     L  PD K+ +L+HG ++MKD +  ++ PE+  +E G+  H +R+T  V     +Q P        ++YN +   L D     L D  I +   +I    +  D+G  V  VS+ +QDE+LG ++ ++++
Sbjct:    3 EIKVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGYNDDRRFPDFSYI--TQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTKAICPILLEDYRKITVDKKGETNFFTSQMIKDCMKKVVAVHLHQTVQVDEELEIKAYYAGHVLGAAMFQIKVGCESVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKAPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQILEVKMQVEYMSFSAHADAKGIMQLIRQAEPRNVLLVHGEAKKMEFLKQKIEQEFHVNCYMPANGETTSIFTNPSIPVDISLGLLKRETAIGLL--PDAKKPKLMHGTLIMKDNSFRLVSPEQALKELGLAEHQLRFTCRV----HIQDPRKEHETVLRVYNHLKGVLKDYSVQHLPDGSITVESILIQATAHSEDQGTKVLLVSWTYQDEELGSYLTSLLK 592          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:Cpsf3l "cleavage and polyadenylation specific factor 3-like" species:10090 "Mus musculus" [GO:0003674 "molecular_function" evidence=ND] [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0008150 "biological_process" evidence=ND] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0072562 "blood microparticle" evidence=ISO] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 MGI:MGI:1919207 GO:GO:0005737 GO:GO:0016787 GO:GO:0032039 Gene3D:3.60.15.10 eggNOG:COG1236 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 HOGENOM:HOG000231294 KO:K13148 OMA:IDNPGPM GeneTree:ENSGT00730000110857 GO:GO:0016180 HOVERGEN:HBG080215 CTD:54973 TreeFam:TF105878 EMBL:AK010425 EMBL:AK090206 EMBL:AK150436 EMBL:AK152740 EMBL:AK167607 EMBL:AK172533 EMBL:BC008240 EMBL:BC011155 RefSeq:NP_082296.1 RefSeq:XP_006539258.1 UniGene:Mm.475640 ProteinModelPortal:Q9CWS4 SMR:Q9CWS4 IntAct:Q9CWS4 MINT:MINT-4125626 STRING:10090.ENSMUSP00000030901 PhosphoSite:Q9CWS4 PaxDb:Q9CWS4 PRIDE:Q9CWS4 Ensembl:ENSMUST00000030901 GeneID:71957 KEGG:mmu:71957 UCSC:uc008wfh.1 InParanoid:Q9CWS4 NextBio:335052 PRO:PR:Q9CWS4 ArrayExpress:Q9CWS4 Bgee:Q9CWS4 Genevestigator:Q9CWS4 Uniprot:Q9CWS4)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 390/597 (65.33%), Postives = 472/597 (79.06%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRS 598
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DR +  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFL+ KIE E  V C+MPANGET T+    ++   +S  ++K+E ++  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V  ++  +   +A+  ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG F+  ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSISGKNVMLDCGMHMGYNDDRRFPDFSYI--TQSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRTFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQMLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFRVSCYMPANGETVTLPTSPSIPVGISLGLLKREMVQGLL--PEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLQDTRKEQETAL--RVYSHLKSTLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQDEELGSFLTTLLKN 593          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:Cpsf3l "Integrator complex subunit 11" species:10116 "Rattus norvegicus" [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 RGD:1306841 GO:GO:0005634 GO:GO:0005737 GO:GO:0008152 GO:GO:0016787 Gene3D:3.60.15.10 eggNOG:COG1236 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 HOGENOM:HOG000231294 KO:K13148 OMA:IDNPGPM GeneTree:ENSGT00730000110857 HOVERGEN:HBG080215 CTD:54973 OrthoDB:EOG741Z1M TreeFam:TF105878 EMBL:BC105303 RefSeq:NP_001029064.1 UniGene:Rn.98615 ProteinModelPortal:Q3MHC2 STRING:10116.ENSRNOP00000026725 PaxDb:Q3MHC2 Ensembl:ENSRNOT00000026725 GeneID:298688 KEGG:rno:298688 InParanoid:Q3MHC2 NextBio:644186 PRO:PR:Q3MHC2 Genevestigator:Q3MHC2 Uniprot:Q3MHC2)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 390/597 (65.33%), Postives = 472/597 (79.06%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRS 598
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DR +  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFL+ KIE E  V C+MPANGET T+    ++   +S  ++K+E ++  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V  ++  +   +A+  ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG F+  ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSISGKNVMLDCGMHMGYNDDRRFPDFSYI--TQSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRTFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQMLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFRVSCYMPANGETVTLPTSPSIPVGISLGLLKREMVQGLL--PEAKKPRLLHGTLIMKDNNFRLVSSEQALKELGLAEHQLRFTCRVHLQDTRKEQETAL--RVYSHLKSTLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQDEELGSFLTALLKN 593          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:Cpsf3l "cleavage and polyadenylation specific factor 3-like" species:10116 "Rattus norvegicus" [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0072562 "blood microparticle" evidence=ISO] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 RGD:1306841 GO:GO:0005634 GO:GO:0005737 GO:GO:0008152 GO:GO:0016787 Gene3D:3.60.15.10 eggNOG:COG1236 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 HOGENOM:HOG000231294 KO:K13148 OMA:IDNPGPM GeneTree:ENSGT00730000110857 HOVERGEN:HBG080215 CTD:54973 OrthoDB:EOG741Z1M TreeFam:TF105878 EMBL:BC105303 RefSeq:NP_001029064.1 UniGene:Rn.98615 ProteinModelPortal:Q3MHC2 STRING:10116.ENSRNOP00000026725 PaxDb:Q3MHC2 Ensembl:ENSRNOT00000026725 GeneID:298688 KEGG:rno:298688 InParanoid:Q3MHC2 NextBio:644186 PRO:PR:Q3MHC2 Genevestigator:Q3MHC2 Uniprot:Q3MHC2)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 390/597 (65.33%), Postives = 472/597 (79.06%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRS 598
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DR +  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFL+ KIE E  V C+MPANGET T+    ++   +S  ++K+E ++  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V  ++  +   +A+  ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG F+  ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSISGKNVMLDCGMHMGYNDDRRFPDFSYI--TQSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRTFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQMLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFRVSCYMPANGETVTLPTSPSIPVGISLGLLKREMVQGLL--PEAKKPRLLHGTLIMKDNNFRLVSSEQALKELGLAEHQLRFTCRVHLQDTRKEQETAL--RVYSHLKSTLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQDEELGSFLTALLKN 593          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:CPSF3L "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0016787 "hydrolase activity" evidence=IEA] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 GO:GO:0008152 GO:GO:0016787 Gene3D:3.60.15.10 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 KO:K13148 OMA:IDNPGPM GeneTree:ENSGT00730000110857 CTD:54973 OrthoDB:EOG741Z1M TreeFam:TF105878 EMBL:AAEX03003844 RefSeq:XP_003639102.1 ProteinModelPortal:E2QY53 Ensembl:ENSCAFT00000030626 GeneID:100855777 KEGG:cfa:100855777 Uniprot:E2QY53)

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 391/596 (65.60%), Postives = 469/596 (78.69%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMG+ND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLK PI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DRA+  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFLK KIE E  V C+MPANGET T+    ++   +S  ++K+E  +  L  PD K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V   +  +    AV  ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG ++ ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYI--TRNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHEAVERGGKVLIPVFALGRAQELCILLETFWERMNLKAPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQEFRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLL--PDVKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDPRKEQEMAV--RVYSHLKSVLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQDEELGSYLTSLLK 592          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:CPSF3L "Integrator complex subunit 11" species:9606 "Homo sapiens" [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0072562 "blood microparticle" evidence=IDA] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 GO:GO:0005634 GO:GO:0005737 GO:GO:0072562 GO:GO:0008152 GO:GO:0016787 EMBL:AL139287 EMBL:CH471183 Gene3D:3.60.15.10 eggNOG:COG1236 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 KO:K13148 HOVERGEN:HBG080215 CTD:54973 EMBL:AL136813 EMBL:AK000549 EMBL:AK021939 EMBL:AK023356 EMBL:AK056652 EMBL:AK291387 EMBL:AK297350 EMBL:CR533557 EMBL:BC000675 EMBL:BC007978 EMBL:BC013904 EMBL:BK005728 EMBL:BK005673 RefSeq:NP_001243385.1 RefSeq:NP_001243389.1 RefSeq:NP_001243391.1 RefSeq:NP_001243392.1 RefSeq:NP_060341.2 RefSeq:XP_005244819.1 UniGene:Hs.6449 ProteinModelPortal:Q5TA45 SMR:Q5TA45 BioGrid:120310 IntAct:Q5TA45 MINT:MINT-1482228 PhosphoSite:Q5TA45 DMDM:118572557 PaxDb:Q5TA45 PRIDE:Q5TA45 DNASU:54973 Ensembl:ENST00000419704 Ensembl:ENST00000435064 Ensembl:ENST00000450926 Ensembl:ENST00000540437 Ensembl:ENST00000545578 GeneID:54973 KEGG:hsa:54973 UCSC:uc001aee.2 UCSC:uc001aef.2 UCSC:uc001aeh.2 UCSC:uc009vjz.2 GeneCards:GC01M001236 HGNC:HGNC:26052 HPA:HPA028379 HPA:HPA029025 MIM:611354 neXtProt:NX_Q5TA45 PharmGKB:PA142672080 InParanoid:Q5TA45 OMA:AYIDNPG OrthoDB:EOG741Z1M PhylomeDB:Q5TA45 TreeFam:TF105878 ChiTaRS:CPSF3L GeneWiki:CPSF3L GenomeRNAi:54973 NextBio:58222 PRO:PR:Q5TA45 ArrayExpress:Q5TA45 Bgee:Q5TA45 Genevestigator:Q5TA45 Uniprot:Q5TA45)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 389/596 (65.27%), Postives = 470/596 (78.86%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMG+ND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FI WTN+KIRKTFV+RNMF+FK IK  DRA+  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFLK KIE E  V C+MPANGET T+    ++   +S  ++K+E  +  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V   +  +   +A+  ++Y+ +   L D     L D  + +   ++       D G  V  VS+ +QDE+LG F+ ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYI--TQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLL--PEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETAL--RVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLK 592          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:CPSF3L "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0016787 "hydrolase activity" evidence=IEA] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 GO:GO:0008152 GO:GO:0016787 Gene3D:3.60.15.10 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 KO:K13148 OMA:IDNPGPM GeneTree:ENSGT00730000110857 CTD:54973 OrthoDB:EOG741Z1M TreeFam:TF105878 EMBL:FP102596 RefSeq:XP_003127541.3 Ensembl:ENSSSCT00000003708 GeneID:100523908 KEGG:ssc:100523908 Uniprot:F1RJE8)

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 387/596 (64.93%), Postives = 469/596 (78.69%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EIRVTPLGAGQDVGRSC+LVSIGGKN+MLDCGMHMG++D+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMT PT+AI PILLED R++AV++KGE+NFFTS MIK+CMKK VAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RM+LK PI+FSTGLTEKA +YYK+FI WTN+KIRKTFV+RNMF+FK IK  DRA+  +PGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP+NV+LVHGE  KMEFLK KIE E  + C+MPANGET T+    ++   +S  ++K+E  +  L  PD K+ARLLHG ++MKD T  ++  E+  +E G+  H +R+T  V   +  +     +A ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG ++ ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSIGGKNVMLDCGMHMGFSDDRRFPDFSYI--TRHGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTQPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKAVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMDLKAPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADSPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLELEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPENVLLVHGEAKKMEFLKQKIEQEFRLSCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLL--PDAKKARLLHGTLIMKDSTFRLVSSEQALKELGLAEHQLRFTCRVHLHDPRKE--QEMAMRVYSHLKSLLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQDEELGSYLTSLLK 592          
BLAST of EMLSAG00000000010 vs. GO
Match: - (symbol:CPSF3L "Integrator complex subunit 11" species:9913 "Bos taurus" [GO:0005634 "nucleus" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] InterPro:IPR001279 Pfam:PF00753 SMART:SM00849 Pfam:PF07521 GO:GO:0005634 GO:GO:0005737 GO:GO:0008152 GO:GO:0016787 Gene3D:3.60.15.10 eggNOG:COG1236 InterPro:IPR022712 InterPro:IPR011108 Pfam:PF10996 SMART:SM01027 HOGENOM:HOG000231294 EMBL:BC110155 UniGene:Bt.4894 ProteinModelPortal:Q2YDM2 PRIDE:Q2YDM2 HOVERGEN:HBG080215 InParanoid:Q2YDM2 Uniprot:Q2YDM2)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 384/596 (64.43%), Postives = 466/596 (78.19%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMG++D+RRFPDFS+  +T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMT PT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RM+LK PI+FSTGLTEKA +YYK+FI WTN+KIRKTFV+RNMF+FK IK  DRA+  +PGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP+NV+LVHGE  KMEFLK KIE E  V C+MPANGET T+    ++   +S  ++K+E  +  L  PD K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V   +  +     +A ++Y+ +   L D     L D  + +   ++       D G  V  VS+ +QDE+LG ++ ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFSDDRRFPDFSY--NTRSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTQPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPSLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMDLKAPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADSPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPENVLLVHGEAKKMEFLKQKIEQEFRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLL--PDAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKE--QEMAMRVYSHLKSVLKDHCVQHLPDGSVTVESILVQAAAHSEDPGTKVLLVSWTYQDEELGSYLTSLLK 592          
BLAST of EMLSAG00000000010 vs. C. finmarchicus
Match: gi|592769975|gb|GAXK01184593.1| (TSA: Calanus finmarchicus comp135388_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 890.182 bits (2299), Expect = 0.000e+0
Identity = 421/600 (70.17%), Postives = 499/600 (83.17%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMK-DETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLP-DDFSISLSDKEIFISETVICKIENDEGKVVSN--VSFCHQDEQLGEFVLNIVRSI 599
            +I+VTPLGAGQDVGRSCLL+SIGGKN+MLDCGMHMGY+D+RRFPDFS+I  T   PL+ HLD VIISHFHLDHCGALPYMTEM+GY+GPIYMT PTKAIAPILLEDMR+VAV++KGE NFFTSAMIK+C KK++AV+LHQV++VD  LEIKAYYAGHVLGAAMFQVKVGN+S+VYTGDYNMTPDRHLGAAWID+CRPDLLITESTYATTVRDSKRCRERDFLKKVHDC+++GGKVLIPVFALGRAQELCILLETYW+RMNLK PI+FS G+TEKA  YYKMFI+WTNEKIRKTFV+RNMFDFK IKP DR+YI NPGPMVVFATPGMLH GLSL IF  WC  E NMIIMPGYCV+GT+GHKILNG +++EF KG+  EVKMSVQYMSFSAHADAKGIMQLIS+CEP+NVMLVHGE  KM+FL++KI++EHG+ CFMPANGETA I    T+   VS S++K E  +YA +PPD KR RLLHG++VMK D TL++ +PE    + GIQ HT+R+T  V  ++  Q  L     KL +A    L    F++S + +     E+VI ++E  E + V++  VS+ + D+ LG  +L   +++
Sbjct:   51 DIKVTPLGAGQDVGRSCLLLSIGGKNIMLDCGMHMGYSDDRRFPDFSYI--TTDEPLSEHLDCVIISHFHLDHCGALPYMTEMIGYNGPIYMTVPTKAIAPILLEDMRKVAVDKKGEQNFFTSAMIKDCTKKIIAVNLHQVVQVDAELEIKAYYAGHVLGAAMFQVKVGNQSVVYTGDYNMTPDRHLGAAWIDRCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCIDKGGKVLIPVFALGRAQELCILLETYWERMNLKCPIYFSAGMTEKANQYYKMFISWTNEKIRKTFVDRNMFDFKHIKPFDRSYIDNPGPMVVFATPGMLHAGLSLTIFRRWCGEEKNMIIMPGYCVSGTIGHKILNGQKRIEFEKGQVTEVKMSVQYMSFSAHADAKGIMQLISWCEPRNVMLVHGEGEKMKFLRSKIKAEHGIDCFMPANGETALIPGRGTVPARVSVSLLKAEAARYAAEPPDSKRPRLLHGIMVMKADGTLTLEEPEAAITQLGIQQHTVRFTSTVTLQD--QGGLEEALVKLQSAAQAKLEGSSFTVSKTAECELRVESVIVQVEQGEVRGVTDVRVSWAYSDDFLGSTILQAFQAL 1838          
BLAST of EMLSAG00000000010 vs. C. finmarchicus
Match: gi|592906641|gb|GAXK01051734.1| (TSA: Calanus finmarchicus comp29218_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 339.732 bits (870), Expect = 6.155e-105
Identity = 190/505 (37.62%), Postives = 281/505 (55.64%), Query Frame = 0
Query:    5 IRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMN--LKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRA-YIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESE------HGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDP 500
            +++TPLG+GQ+VGRSC +V    K +MLDCG+H G       P    IE          +D ++ISHFHLDH GALP+  +   + G  +MTH TKAI   LL D  +V+     +   +T + ++  M K+  ++ H+   V   ++   Y AGHVLGAAMF +++    I+YTGD++   DRHL +A I   RPD+LI ESTY T + + +  RE  F + V+D V RGG+ LIPVFALGRAQEL ++L+ YW        +PI++++ L +K    Y+ FI   NEKIR+     N F FK I  L    +  + GP V+ A+PGM+  GLS  +FE WCT++ N  I+ GYCV GT+   IL+  +++    G+ + + +SV Y+SFSAH D K     I   +P +V+LVHGE  +M  LKA +  E      H ++   P N    T++  +   G   + ++       +L    P+    L G++V ++    IL P
Sbjct:  753 MKITPLGSGQEVGRSCHIVQFKDKKIMLDCGIHPGLTGMDALPFVDMIE-------ADQIDLLLISHFHLDHAGALPWFLQKTTFRGKCFMTHATKAIFFWLLSDYIKVS-NISTDQMLYTDSDLEAAMDKIETINFHEEKEV-AGIKFWCYNAGHVLGAAMFMLEIAGVKILYTGDFSREEDRHLMSAEIPNIRPDVLIVESTYGTHIHEKREDRENRFTQTVNDIVSRGGRCLIPVFALGRAQELLLILDEYWAAHPELSDIPIYYASSLAKKCMAVYQTFINSMNEKIRRQIAVNNPFVFKHISNLKGIDHFDDIGPCVILASPGMMQSGLSRELFESWCTDKKNGCIVAGYCVEGTLAKHILSDPQEVTAMNGQKLPLNLSVDYISFSAHTDYKQTSGFIRALKPPHVVLVHGEANEMSRLKAALIREYEADPTHNIEIHNPRN----TVAVELYFRGEKMAKVMG------SLAMQKPEEGLKLSGILVKRNFNYHILSP 2210          
BLAST of EMLSAG00000000010 vs. C. finmarchicus
Match: gi|592908501|gb|GAXK01049874.1| (TSA: Calanus finmarchicus comp31353_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 156.377 bits (394), Expect = 3.063e-39
Identity = 115/382 (30.10%), Postives = 183/382 (47.91%), Query Frame = 0
Query:    1 MTEEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVD---ESLEIKAYYAGHVLGAAMFQ-VKVGNRSIVYTGDYNMTPDRHLGAAWIDK-CRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATN---YYKMFITWTNEKIRKTFVER--NMFDFKFIKPLDRAYIQN--PGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKIL-NG 369
            MT  IR+TPL  G D    C L+ + G N++LD G      DE+  P  SFI  T  + + P +DAV++++  L H GALP     +G S P+Y T P   +  + L D+ + A     +   FT   +    +K+  +  +Q + +    + L +    AGH++G  +++ VK G   IVY  DYN   +RHL    I++  RP LLIT++   T  +  +R R+   +  +   +   G VL+ V   GR  EL  +++  W   +  +  +    L   A N   + K  I W +EK+ K   E+  N F FK +K        N  P P VV A+   +  G +  +F +WC+N  N +I+      GT+G  ++ NG
Sbjct:   47 MTSIIRLTPLSGGGDESPHCYLLEVDGFNILLDIGW-----DEKFSP--SFI--TTLSKVVPKVDAVLLTYPDLPHLGALPVAVGKLGLSCPVYATVPVYKMGQMFLYDIYQ-ARHNIEDFTLFTLDDVDATFEKITQLKYNQTVVLKGKGQGLALTPLPAGHMIGGTIWRIVKDGEEDIVYAVDYNHKKERHLPGCDIERLSRPSLLITDAFNTTYTQARRRLRDEQLMTNILATLRNSGNVLVCVDTAGRVLELAHMVDQLWSNKDSGLLAYSLALLNNVAFNVVEFAKSQIEWMSEKLMKVMGEKKANPFQFKHLKLCHSMAEVNKVPAPKVVLASMPDMECGFARDLFLQWCSNPKNSVILTSRSSPGTLGRDLITNG 1162          
BLAST of EMLSAG00000000010 vs. C. finmarchicus
Match: gi|592800312|gb|GAXK01154256.1| (TSA: Calanus finmarchicus comp7557129_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 3.583e+0
Identity = 12/31 (38.71%), Postives = 18/31 (58.06%), Query Frame = 0
Query:   65 DAVIISHFHLDHCGALP--YMTEMVGYSGPI 93
            D V+++H H+DH G LP  +    V   GP+
Sbjct:  188 DIVLLTHLHVDHAGGLPGLFKARAVSNRGPV 280          
BLAST of EMLSAG00000000010 vs. C. finmarchicus
Match: gi|592894649|gb|GAXK01063726.1| (TSA: Calanus finmarchicus comp375224_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 32.3426 bits (72), Expect = 5.775e+0
Identity = 25/80 (31.25%), Postives = 34/80 (42.50%), Query Frame = 0
Query:   28 KNLMLDCG---MHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVG------YSGPIYMTHP 98
            K ++ D G     M YN ER    F  I            DAV++SH H DH G L    +++       +S P Y+ HP
Sbjct:  388 KTVLFDAGPVNFGMDYNGERLGAKFGEI------------DAVMLSHGHWDHAGGLTRAFDLISKQKLEKHSTPCYL-HP 588          
BLAST of EMLSAG00000000010 vs. C. finmarchicus
Match: gi|592815984|gb|GAXK01138584.1| (TSA: Calanus finmarchicus comp102705_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 31.5722 bits (70), Expect = 7.179e+0
Identity = 18/72 (25.00%), Postives = 35/72 (48.61%), Query Frame = 0
Query:   17 GRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVG 88
            G +  LV  G + L++D G       E+  P++S    +        L  ++++H+H DH G +P + ++ G
Sbjct:  122 GTNTYLVGSGSRRLLIDAG-------EKNVPEYSQNLASVMESEKCSLKDLVVTHWHHDHIGGVPEVLKIGG 316          
BLAST of EMLSAG00000000010 vs. L. salmonis peptides
Match: EMLSAP00000000010 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:5798:7615:-1 gene:EMLSAG00000000010 transcript:EMLSAT00000000010 description:"augustus_masked-LSalAtl2s1003-processed-gene-0.0")

HSP 1 Score: 1264.21 bits (3270), Expect = 0.000e+0
Identity = 605/605 (100.00%), Postives = 605/605 (100.00%), Query Frame = 0
Query:    1 MTEEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRSIADKFKD 605
            MTEEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRSIADKFKD
Sbjct:    1 MTEEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRSIADKFKD 605          
BLAST of EMLSAG00000000010 vs. L. salmonis peptides
Match: EMLSAP00000007282 (pep:novel supercontig:LSalAtl2s:LSalAtl2s409:129273:131364:-1 gene:EMLSAG00000007282 transcript:EMLSAT00000007282 description:"maker-LSalAtl2s409-augustus-gene-1.22")

HSP 1 Score: 325.094 bits (832), Expect = 2.394e-101
Identity = 183/504 (36.31%), Postives = 275/504 (54.56%), Query Frame = 0
Query:    9 PLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMN--LKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRA-YIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEH------GVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKI 503
            PLGAGQ+VGRSC L+    K ++LDCG+H G +     P    IE          +D +++SHFHLDH GALP+  E   + G ++MTH TKAI   LL D  +V+     E   ++   ++  M+K+  ++ H+   V + +   AY AGHVLGA MF +++     +YTGD++   DRHL A      +P +LI ESTY T + + +  RE  F   VHD V RGG+ LIPVFALGRAQEL ++L+ YW       ++PI++++ L +K    Y+ F+   NE+IR+     N F FK I  L    +  + GP V+ A+PGM+  GLS  +FE WC++  N  I+ GYCV GT+   IL+   ++    G+ + +KM V Y+SFSAH D K     I   +P +V+LVHGE  +M  LK+ +  E+       +  + P N    T+S  +   G   + ++       A+ P  P +   + G++V ++    IL P  +
Sbjct:   15 PLGAGQEVGRSCHLLEFKDKRILLDCGIHPGLSGMDALPFVDLIE-------ADEIDLLLVSHFHLDHAGALPWFLEKTTFKGKVFMTHATKAIYRWLLSDYIKVS-NISTEQMLYSEQDLEASMEKIQTLNFHEEKEV-KGIRFWAYNAGHVLGAXMFMIEIAGVRTLYTGDFSREEDRHLMAXEXPSLKPHVLILESTYGTNIHEKREDRESRFTSTVHDIVTRGGRCLIPVFALGRAQELLLILDEYWGAHPELHEIPIYYASSLAKKCMAVYQTFVNAMNERIRRQISVNNPFVFKHISNLKGIDHFDDVGPCVILASPGMMQSGLSRELFESWCSDPKNGCIVAGYCVEGTLAKHILSEPEEVASMNGQKLPLKMQVNYISFSAHTDYKQTSGFIRELKPPHVILVHGEANEMSRLKSALIREYEADPSTKIDFYNPRN----TVSVDLFFRGEKMAKVMG----SLAVDP--PIQEHRVSGILVKRNFNYHILSPSDL 499          
BLAST of EMLSAG00000000010 vs. L. salmonis peptides
Match: EMLSAP00000011843 (pep:novel supercontig:LSalAtl2s:LSalAtl2s831:281816:286361:1 gene:EMLSAG00000011843 transcript:EMLSAT00000011843 description:"snap_masked-LSalAtl2s831-processed-gene-2.5")

HSP 1 Score: 151.369 bits (381), Expect = 8.427e-39
Identity = 112/412 (27.18%), Postives = 183/412 (44.42%), Query Frame = 0
Query:    1 MTEEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGES-NFFTSAMIKECMKKVVAVHLHQVIRVD---ESLEIKAYYAGHVLGAAMFQ-VKVGNRSIVYTGDYNMTPDRHLGAAWIDK-CRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMN---LKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVER--NMFDFKFIKPLDRAYIQN--PGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILN--GTRKLEFSKGKTVEVKMSVQYMSFSAHAD 397
            MT  I++ PL  G+  G  C L+ +   N +LD G    +N + +              +   +DAV++S+  LDH GALPY    +G S  I+ T P   +  + + D+     +RK E  + FT   +     K+  +  +Q   +    E + I    AGH++G  +++ VK G   I+Y  D+N   +RHL    +DK  RP +LIT++      +  +R R+   +  +   +   G VLI     GR  EL  +++  W   +   L   +      +     + K  I W +EK+ KTF  +  N F FK +K        N  P P VV A+   +  G S  +F +WCTN  N II+     A T+ + ++     R +E    K VE+    +   ++ H D
Sbjct:    1 MTSIIKMCPLSGGRSEGPHCYLLEVDDYNFLLDVGWDPFFNSKLK---------KEIKKVASKIDAVLLSYPDLDHLGALPYAVGKLGLSCSIFATVPVHKMGQMFMYDV--YEAQRKQEDFDLFTLDEVDSAFDKITQLKYNQTFALKGKGEGISITPIPAGHMIGGTIWKIVKDGEEDIIYAVDFNHKKERHLNGCDLDKLLRPSILITDAFNIGCHQLRRRVRDEKIMTNILQTLRNNGNVLICTDTAGRVLELAHMVDQLWQNRDSGLLAYSLALVNNFSYSVVEFAKSQIEWMSEKLMKTFEGKRNNPFQFKHLKLCHSMNEVNKVPSPKVVLASMPDMESGYSRELFIQWCTNPKNSIILTSRSPANTLAYDLMTKGSGRTIELEIKKRVEL-TGTELEEYNKHRD 400          
BLAST of EMLSAG00000000010 vs. L. salmonis peptides
Match: EMLSAP00000011315 (pep:novel supercontig:LSalAtl2s:LSalAtl2s77:664263:677061:-1 gene:EMLSAG00000011315 transcript:EMLSAT00000011315 description:"maker-LSalAtl2s77-augustus-gene-6.22")

HSP 1 Score: 51.6026 bits (122), Expect = 5.482e-7
Identity = 77/358 (21.51%), Postives = 136/358 (37.99%), Query Frame = 0
Query:   51 FIEDTPGAPLTPH--------LDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLED----MRRVAVER-------------------------KGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVY-TGDYNMT----PDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNL-KVPIFFSTGLTEKATNYYKMFITWTNE-KIRKTFVERNMFD---------FKFIKPLDRAYIQNP--GPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIM 353
            F++ +P    TPH        +D ++IS++      ALPY+TE  G+ G +YMT PT  I  + +E+    M R A+                           +     +    ++  + KV  +   +   V   L +    +G+ LG++ + +  G   I Y +G   +T    P   +    +D C   L++T  T   T        E  F K V +    GG VL+P +  G   +L   L    D  +L  +P++F + + + +  Y  +   W ++ K  K ++    F           K  + +      N    P ++F     L  G  +   E W +N  N I+ 
Sbjct:  821 FVDSSPEF-CTPHSGLFDFADIDVILISNYTC--MLALPYVTEESGFKGIVYMTEPTLHIGRLFMEETIEYMERTALSSRHSSSGSWKDILHALPPPLCDVSNPRSWKRIYNRKQMESSLSKVQLMGYSEKKDVFGLLTVSPVSSGYCLGSSNWIISSGFEKIGYVSGTSTLTTHPRPLNQIPLRNVD-C---LIMTSLTQTPTQMPDPMIGE--FCKSVVETTRLGGNVLVPCYPSGITYDLFECLAGQMDAHSLCTIPMYFVSPVADSSLAYSNIMAEWLSQSKQNKVYLPEEPFPHGGLARNGRLKSFRTMHDENFSNEYRQPCIMFCGHPSLRFGEVIHFIELWGSNSNNTIVF 1169          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|75026622|sp|Q9VAH9.1|INT11_DROME (RecName: Full=Integrator complex subunit 11)

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 398/599 (66.44%), Postives = 482/599 (80.47%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVSN---VSFCHQDEQLGEFVLNIVRSI 599
            +I++TPLGAGQDVGRSCLL+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T H+D VIISHFHLDHCGALPYM+E+VGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFT+ MIK+CMKKV+ V LHQ + VD  LEIKAYYAGHVLGAAMF +KVG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+CV +GGKVLIPVFALGRAQELCILLETYW+RMNLK PI+F+ GLTEKA  YYKMFITWTN+KIRKTFV RNMFDFK IKP D+AYI NPG MVVFATPGMLH GLSL IF++W  NE NM+IMPGYCV GTVG+KIL G +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI  CEPKNVMLVHGE  KM+FL++KI+ E  ++ +MPANGET  IS P+ +    S S++K E   Y  +PPDPKR RL+HGV+VMKD  + + +     +E GI  H +R+T  V   +    P+   +++L   +   L   +++++ +      E+V  K+E DE         +S+ +QDE +G ++LN+++++
Sbjct:    3 DIKITPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSHIDCVIISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTTQMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPVFALGRAQELCILLETYWERMNLKYPIYFALGLTEKANTYYKMFITWTNQKIRKTFVHRNMFDFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVGNKILGGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQNCEPKNVMLVHGEAGKMKFLRSKIKDEFNLETYMPANGETCVISTPVKIPVDASVSLLKAEARSYNAQPPDPKRRRLIHGVLVMKDNRIMLQNLTDALKEIGINRHVMRFTSKVKMDD--SGPVIRTSERLKTLLEEKLA-GWTVTMQENGSIAIESVEVKVEEDEKDPKQKNILISWTNQDEDIGAYILNVLQNM 596          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|75571225|sp|Q5ZIH0.1|INT11_CHICK (RecName: Full=Integrator complex subunit 11; Short=Int11; AltName: Full=Cleavage and polyadenylation-specific factor 3-like protein; Short=CPSF3-like protein)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 397/598 (66.39%), Postives = 469/598 (78.43%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLS--AVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIEN--DEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EI+VTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPTKAI PILLED R++ V++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VDE LEIKAYYAGHVLGAAMFQ+KVG  S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLK PI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DRA+  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQLI   EP+NV+LVHGE  KMEFLK KIE E  V C+MPANGET TI    ++   +S  ++K+E     L  PD K+ +L+HG ++MKD +  ++ PE+  +E G+  H +R+T  V     +Q P        ++YN +   L D     L D  I +   +I    +  D+G  V  VS+ +QDE+LG ++ ++++
Sbjct:    3 EIKVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGYNDDRRFPDFSYI--TQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTKAICPILLEDYRKITVDKKGETNFFTSQMIKDCMKKVVAVHLHQTVQVDEELEIKAYYAGHVLGAAMFQIKVGCESVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKAPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQILEVKMQVEYMSFSAHADAKGIMQLIRQAEPRNVLLVHGEAKKMEFLKQKIEQEFHVNCYMPANGETTTIFTNPSIPVDISLGLLKRETAIGLL--PDAKKPKLMHGTLIMKDNSFRLVSPEQALKELGLAEHQLRFTCRV----HIQDPRKEHETVLRVYNHLKGVLKDYSVQHLPDGSITVESILIQATAHSEDQGTKVLLVSWTYQDEELGSYLTSLLK 592          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|81904239|sp|Q9CWS4.1|INT11_MOUSE (RecName: Full=Integrator complex subunit 11; Short=Int11; AltName: Full=Cleavage and polyadenylation-specific factor 3-like protein; Short=CPSF3-like protein)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 390/597 (65.33%), Postives = 472/597 (79.06%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRS 598
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DR +  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFL+ KIE E  V C+MPANGET T+    ++   +S  ++K+E ++  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V  ++  +   +A+  ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG F+  ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSISGKNVMLDCGMHMGYNDDRRFPDFSYI--TQSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRTFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQMLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFRVSCYMPANGETVTLPTSPSIPVGISLGLLKREMVQGLL--PEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLQDTRKEQETAL--RVYSHLKSTLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQDEELGSFLTTLLKN 593          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|119371245|sp|Q3MHC2.1|INT11_RAT (RecName: Full=Integrator complex subunit 11; Short=Int11; AltName: Full=Cleavage and polyadenylation-specific factor 3-like protein; Short=CPSF3-like protein)

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 390/597 (65.33%), Postives = 472/597 (79.06%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRS 598
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMGYND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DR +  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFL+ KIE E  V C+MPANGET T+    ++   +S  ++K+E ++  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V  ++  +   +A+  ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG F+  ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSISGKNVMLDCGMHMGYNDDRRFPDFSYI--TQSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRTFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQMLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFRVSCYMPANGETVTLPTSPSIPVGISLGLLKREMVQGLL--PEAKKPRLLHGTLIMKDNNFRLVSSEQALKELGLAEHQLRFTCRVHLQDTRKEQETAL--RVYSHLKSTLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSWTYQDEELGSFLTALLKN 593          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|118572558|sp|Q5NVE6.2|INT11_PONAB (RecName: Full=Integrator complex subunit 11; Short=Int11; AltName: Full=Cleavage and polyadenylation-specific factor 3-like protein; Short=CPSF3-like protein)

HSP 1 Score: 818.535 bits (2113), Expect = 0.000e+0
Identity = 390/596 (65.44%), Postives = 470/596 (78.86%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMG+ND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FI WTN+KIRKTFV+RNMF+FK IK  DRA+  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFLK KIE E  V C+MPANGET T+    ++   +S  ++K+E  +  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V   +  +   +A+  ++Y+ +   L D     L D  + +   +I       D G  V  VS+ +QDE+LG F+ ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYI--TQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVSCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLL--PEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETAL--RVYSHLKSILKDHCVQHLPDGSVTVESILIQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLK 592          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|118572557|sp|Q5TA45.2|INT11_HUMAN (RecName: Full=Integrator complex subunit 11; Short=Int11; AltName: Full=Cleavage and polyadenylation-specific factor 3-like protein; Short=CPSF3-like protein; AltName: Full=Protein related to CPSF subunits of 68 kDa; Short=RC-68)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 389/596 (65.27%), Postives = 470/596 (78.86%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMG+ND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMTHPT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP+LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLKVPI+FSTGLTEKA +YYK+FI WTN+KIRKTFV+RNMF+FK IK  DRA+  NPGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP++V+LVHGE  KMEFLK KIE E  V C+MPANGET T+    ++   +S  ++K+E  +  L  P+ K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V   +  +   +A+  ++Y+ +   L D     L D  + +   ++       D G  V  VS+ +QDE+LG F+ ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYI--TQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLL--PEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETAL--RVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLK 592          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|82192739|sp|Q503E1.1|INT11_DANRE (RecName: Full=Integrator complex subunit 11; Short=Int11; AltName: Full=Cleavage and polyadenylation-specific factor 3-like protein; Short=CPSF3-like protein)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 386/598 (64.55%), Postives = 471/598 (78.76%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKI----ENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            +I+VTPLGAGQDVGRSC+LVSIGGKN+MLDCGMHMG+ND+RRFPDFS+I  T    LT  LD VIISHFHLDHCGALPYM+EMVGY GPIYMTHPTKAI PILLED R++ V++KGE+NFFTS MIK+CMKKVV ++LHQ ++VD+ LEIKAYYAGHVLGAAM Q+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRPD+LI+ESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RMNLK PI+FSTGLTEKA +YYK+FITWTN+KIRKTFV+RNMF+FK IK  DR+Y  NPGPMVVFATPGMLH G SL IF++W  NE NM+IMPGYCV GTVGHKILNG +KLE     T++VK+ V+YMSFSAHADAKGIMQLI   EP+N++LVHGE  KMEFLK KIE E  + CFMPANGET TI    ++   +S +++K+E +      PD KR R +HG ++MKD +L ++ PE+  +E G+  H +R+T  V   +      +    ++Y  +   L   +SI        I E+++ K+    E    KV+  +S+ +QDE+LG F+  +++
Sbjct:    3 DIKVTPLGAGQDVGRSCILVSIGGKNIMLDCGMHMGFNDDRRFPDFSYI--TQNGRLTEFLDCVIISHFHLDHCGALPYMSEMVGYDGPIYMTHPTKAICPILLEDFRKITVDKKGETNFFTSQMIKDCMKKVVPLNLHQTVQVDDELEIKAYYAGHVLGAAMVQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPDILISESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKAPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQRNMFEFKHIKAFDRSYADNPGPMVVFATPGMLHAGQSLQIFKKWAGNEKNMVIMPGYCVQGTVGHKILNGQKKLEMEGRATLDVKLQVEYMSFSAHADAKGIMQLIRMAEPRNMLLVHGEAKKMEFLKDKIEQEFSISCFMPANGETTTIVTNPSVPVDISLNLLKRE-MALGGPLPDAKRPRTMHGTLIMKDNSLRLVSPEQALKELGLNEHQLRFTCRVQLHDPHSD--TDTLSRIYTHLKSVL-KSYSIQHVPDGTVIVESIVIKVTSSAEEPNLKVIL-LSWSYQDEELGSFLSTLLK 593          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|118572556|sp|Q2YDM2.2|INT11_BOVIN (RecName: Full=Integrator complex subunit 11; Short=Int11; AltName: Full=Cleavage and polyadenylation-specific factor 3-like protein; Short=CPSF3-like protein)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 384/596 (64.43%), Postives = 466/596 (78.19%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI--CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVR 597
            EIRVTPLGAGQDVGRSC+LVSI GKN+MLDCGMHMG++D+RRFPDFS+  +T    LT  LD VIISHFHLDHCGALPY +EMVGY GPIYMT PT+AI PILLED R++AV++KGE+NFFTS MIK+CMKKVVAVHLHQ ++VD+ LEIKAYYAGHVLGAAMFQ+KVG+ S+VYTGDYNMTPDRHLGAAWIDKCRP LLITESTYATT+RDSKRCRERDFLKKVH+ VERGGKVLIPVFALGRAQELCILLET+W+RM+LK PI+FSTGLTEKA +YYK+FI WTN+KIRKTFV+RNMF+FK IK  DRA+  +PGPMVVFATPGMLH G SL IF +W  NE NM+IMPGYCV GTVGHKIL+G RKLE    + +EVKM V+YMSFSAHADAKGIMQL+   EP+NV+LVHGE  KMEFLK KIE E  V C+MPANGET T+    ++   +S  ++K+E  +  L  PD K+ RLLHG ++MKD    ++  E+  +E G+  H +R+T  V   +  +     +A ++Y+ +   L D     L D  + +   ++       D G  V  VS+ +QDE+LG ++ ++++
Sbjct:    3 EIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFSDDRRFPDFSY--NTRSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTQPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPSLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMDLKAPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADSPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPENVLLVHGEAKKMEFLKQKIEQEFRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLL--PDAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKE--QEMAMRVYSHLKSVLKDHCVQHLPDGSVTVESILVQAAAHSEDPGTKVLLVSWTYQDEELGSYLTSLLK 592          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|74856745|sp|Q54YL3.1|INT11_DICDI (RecName: Full=Integrator complex subunit 11 homolog)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 305/480 (63.54%), Postives = 376/480 (78.33%), Query Frame = 0
Query:    5 IRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNL-KVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNG-----------TRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYA 472
            I+V PLGAGQDVGRSC++V+IG KN+M DCGMHMG ND RRFPDFS+I  +     T  +D VII+HFHLDHCGALP+ TEM GY GPIYMT PTKAI PILLED R++ VE+KGE+NFFT+ MIK+CMKKV+ V+LHQ I+VDE L IKAYYAGHVLGAAMF  KVG+ S+VYTGDYNMTPDRHLG+AWID+ +PD+LITE+TYATT+RDSKR RERDFLK++H+CVE+GGKVLIPVFALGR QELCIL+++YW++MNL  +PI+FS GL EKA  YYK+FI WTN+KI++TFV+RNMFDFK IKP     +  PG MV+FATPGMLH G SL +F++W  NELNM I+PGYCV GTVG+K+L             ++ +E  K  T+EVK  +  +SFSAHADAKGI+QLI    P+NV+LVHGE+ KM FL  KI  E GV C+ PANG T  I    ++   +S +++K++ L Y+
Sbjct:    3 IKVVPLGAGQDVGRSCVIVTIGNKNIMFDCGMHMGMNDARRFPDFSYI--SKNGQFTKVIDCVIITHFHLDHCGALPFFTEMCGYDGPIYMTLPTKAICPILLEDYRKITVEKKGETNFFTAQMIKDCMKKVIPVNLHQTIKVDEELSIKAYYAGHVLGAAMFYAKVGDESVVYTGDYNMTPDRHLGSAWIDQVKPDVLITETTYATTIRDSKRGRERDFLKRIHECVEKGGKVLIPVFALGRVQELCILIDSYWEQMNLGHIPIYFSAGLAEKANLYYKLFINWTNQKIKQTFVKRNMFDFKHIKPFQSHLVDAPGAMVLFATPGMLHAGASLEVFKKWAPNELNMTIIPGYCVVGTVGNKLLTTGSDQQQQSKPQSQMVEIDKKTTIEVKCKIHNLSFSAHADAKGILQLIKMSNPRNVILVHGEKEKMGFLSQKIIKEMGVNCYYPANGVTIIIDTMKSIPIDISLNLLKRQILDYS 480          
BLAST of EMLSAG00000000010 vs. SwissProt
Match: gi|332278175|sp|Q8GUU3.2|CPS3B_ARATH (RecName: Full=Cleavage and polyadenylation specificity factor subunit 3-II; AltName: Full=Cleavage and polyadenylation specificity factor 73 kDa subunit II; Short=AtCPSF73-II; Short=CPSF 73 kDa subunit II; AltName: Full=Protein EMBRYO SAC DEVELOPMENT ARREST 26)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 267/528 (50.57%), Postives = 365/528 (69.13%), Query Frame = 0
Query:   10 LGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGT-RKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIK---KEHLKYA----LKPPDPKRARLLHGVIVM-KDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQS 528
            LGAGQ++G+SC++V+I GK +M DCGMHMG +D  R+P+FS I  +        +  +II+HFH+DH GALPY TE+ GY+GPIYM++PTKA++P++LED RRV V+R+GE   FT+  I  CMKKV+A+ L Q I+VDE L+I+AYYAGHVLGA M   K+G+ +IVYTGDYNMT DRHLGAA ID+ + DLLI+ESTYATT+R SK  RER+FL+ VH CV  GGK LIP FALGRAQELC+LL+ YW+RMN+KVPI+FS+GLT +A  YYKM I+WT++ +++     N FDFK +K  DR+ I  PGP V+FATPGML  G SL +F+ W  + LN++ +PGY VAGTVGHK++ G    ++   G  V+V+  V  ++FS H DAKGIM L  +  PKNV+LVHGE+  M  LK KI SE  + CF+PANGET + +    ++   S   +K     + K++    L+  D + A    GV+V+ K +   I+  ++I+E    ++H +      P + + +S
Sbjct:    8 LGAGQEIGKSCVVVTINGKKIMFDCGMHMGCDDHNRYPNFSLISKS--GDFDNAISCIIITHFHMDHVGALPYFTEVCGYNGPIYMSYPTKALSPLMLEDYRRVMVDRRGEEELFTTTHIANCMKKVIAIDLKQTIQVDEDLQIRAYYAGHVLGAVMVYAKMGDAAIVYTGDYNMTTDRHLGAAKIDRLQLDLLISESTYATTIRGSKYPREREFLQAVHKCVAGGGKALIPSFALGRAQELCMLLDDYWERMNIKVPIYFSSGLTIQANMYYKMLISWTSQNVKEKHNTHNPFDFKNVKDFDRSLIHAPGPCVLFATPGMLCAGFSLEVFKHWAPSPLNLVALPGYSVAGTVGHKLMAGKPTTVDLYNGTKVDVRCKVHQVAFSPHTDAKGIMDLTKFLSPKNVVLVHGEKPSMMILKEKITSELDIPCFVPANGETVSFASTTYIKANASDMFLKSCSNPNFKFSNSTQLRVTDHRTAD---GVLVIEKSKKAKIVHQDEISEVLHEKNHVVSLAHCCPVKVKGES 530          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: EAA13845.4 (AGAP009923-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 870.537 bits (2248), Expect = 0.000e+0
Identity = 412/611 (67.43%), Postives = 490/611 (80.20%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDE-----GKV----------VSNVSFCHQDEQLGEFVLNIVRSI 599
            +I++TPLGAGQDVGRSC+L+S+ GKN+MLDCGMHMGYNDERRFPDFSFI   P  P+T H+D VIISHFHLDHCGALPYMTEMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFT  MIK+CMKKV+AV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKC+PDLLITESTYATT+RDSKRCRERDFLKKVH+CV +GGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D+ YI NPG MVVFATPGMLH GLSL IF++W  NE NM+IMPGYCV GTVGHKIL G +K+EF   + V+VKMSV+YMSFSAHADAKGIMQLI +CEP+NVMLVHGE  KMEFLK KI  E  ++C+ PANGET TIS PI +    S SI+K E  KY  +PPDPKR R++HG++VMKD  +S++  ++I  E GI  H IR+   +   +    P     +KLYN ++  L   ++++++D      E+V  KIE +E     G V          + NVS+ +QDE LG ++L +++S+
Sbjct:    3 DIKITPLGAGQDVGRSCILLSMAGKNIMLDCGMHMGYNDERRFPDFSFI--IPEGPITNHIDCVIISHFHLDHCGALPYMTEMVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTPQMIKDCMKKVIAVTLHQSVMVDSELEIKAYYAGHVLGAAMFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCKPDLLITESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPVFALGRAQELCILLETYWERMNLKYPVYFAVGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKGYIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVGHKILGGAKKVEFENRQVVDVKMSVEYMSFSAHADAKGIMQLIQFCEPRNVMLVHGEAVKMEFLKEKIREEFKIECYTPANGETCTISTPIKIPVETSLSILKDEVKKYNAQPPDPKRRRIIHGILVMKDNKISLMSIDEIFNEAGIDRHVIRFISKIKLDDP--GPPMRTIEKLYNMLNERL-SGWTVTMNDNNSINVESVNIKIETEEQPAAIGSVGQPSVPGMHKICNVSWVNQDEDLGSYILGLLQSL 608          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: gb|EFA06334.1| (Cleavage and polyadenylation specificity factor 73-like Protein [Tribolium castaneum])

HSP 1 Score: 865.529 bits (2235), Expect = 0.000e+0
Identity = 406/598 (67.89%), Postives = 489/598 (81.77%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSIA 600
            +I++TPLGAGQDVGRSC+L+++GGKN+MLDCGMHMGYNDERRFPDFS+I      PLT ++D VIISHFHLDHCGALPYM+EMVGYSGPIYMTHPTKAIAPILLEDMR+V+VE+KG+ NFFTS MIK+CMKKV+AV LHQ + VD  +EIKAYYAGHVLGAAMF ++VG +S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+C++RGGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP DR+YI NPGPMVVFATPGMLH GLSL IF++W  NE NM+IMPG+CV GTVGHKILNG +++EF   + VEVKMSV+YMSFSAHADAKGIMQLI +CEP+NVMLVHGE  KMEFLK KI  E  + C+ PANGET  IS P+ +   VS  ++K E  K++  PPDPKR R LHGV+VMK+  + ++D +   +E GI  H IR++  V   +    P  A A KL+  I  +LP  + +  ++ EI I E+V+ K+E DE +  +  VS+ +QDE LG ++LN++  + 
Sbjct:    3 DIKITPLGAGQDVGRSCILLTMGGKNIMLDCGMHMGYNDERRFPDFSYISQE--GPLTSYIDCVIISHFHLDHCGALPYMSEMVGYSGPIYMTHPTKAIAPILLEDMRKVSVEKKGDQNFFTSQMIKDCMKKVIAVTLHQSLMVDNEIEIKAYYAGHVLGAAMFWIRVGAQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECMDRGGKVLIPVFALGRAQELCILLETYWERMNLKAPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDRSYIDNPGPMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGFCVQGTVGHKILNGAKRVEFENKQIVEVKMSVEYMSFSAHADAKGIMQLIQHCEPRNVMLVHGEAEKMEFLKQKILQEFSINCYNPANGETCVISTPVKIPIDVSLPLLKSEARKFSALPPDPKRRRTLHGVLVMKENNVCLMDVDDACKEAGINRHIIRFSSTVHLND--TGPALATAHKLHGFIKENLP-QWPVVFAEGEISI-ESVLVKVEGDEDEQKNVYVSWTNQDEDLGSYILNLLNRMG 594          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: XP_016767931.1 (PREDICTED: integrator complex subunit 11 [Apis mellifera])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 406/599 (67.78%), Postives = 491/599 (81.97%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSIAD 601
            +I+VTPLGAGQDVGRSC+LVS+GGKN+MLDCGMHMG+NDERRFPDFS+I   P  P T ++D VIISHFHLDHCGALPY TEMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFTS MIK+CMKKV+AV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++SIVYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+C++RGGKVLIPVFALGRAQELCILLETYW+RMNLKVP++F+ GLTEKA NYYKMFITWTN+KI+KTFV+RNMFDFK IKP D+AYI NPG MVVFATPGMLH GLSL IF++W  NE NM+IMPG+CV GTVGHK+LNG+R++EF   + VEVKM+V+YMSFSAHADAKGIMQLI YCEPKNVMLVHGE AKMEFLK KI+ E G  C+ PANGET  I+    +    S +++K E  KY+  PPDPKR RLLH V++++++ + ++D +++ +  GI  H +R+T  V  R+    P  +   KL   +   L   +++ L+D  I + E+V+ K+E DE    S  VS+ +QDE LG ++L  ++++ +
Sbjct:    3 DIKVTPLGAGQDVGRSCILVSMGGKNIMLDCGMHMGFNDERRFPDFSYI--IPEGPATNYIDCVIISHFHLDHCGALPYFTEMVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTSQMIKDCMKKVIAVTLHQSVMVDSELEIKAYYAGHVLGAAMFWIRVGSQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECIDRGGKVLIPVFALGRAQELCILLETYWERMNLKVPVYFALGLTEKANNYYKMFITWTNQKIKKTFVQRNMFDFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNEANMVIMPGFCVQGTVGHKVLNGSRRIEFENRQIVEVKMAVEYMSFSAHADAKGIMQLIQYCEPKNVMLVHGEFAKMEFLKEKIKQEFGTNCYNPANGETCVITTISKVPVDASLALLKAEAKKYSALPPDPKRRRLLHSVLMLREDGVCLVDADEVTKAAGITKHVVRFTSTVQVRDP--GPAHSTTLKLLQPLKERL-SGWTVQLTDGSISV-ESVLVKVEGDEDDQKSVYVSWTNQDEDLGSYILGFLQTMLN 595          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: AAF56931.1 (integrator 11 [Drosophila melanogaster])

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 398/599 (66.44%), Postives = 482/599 (80.47%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVSN---VSFCHQDEQLGEFVLNIVRSI 599
            +I++TPLGAGQDVGRSCLL+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T H+D VIISHFHLDHCGALPYM+E+VGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFT+ MIK+CMKKV+ V LHQ + VD  LEIKAYYAGHVLGAAMF +KVG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+CV +GGKVLIPVFALGRAQELCILLETYW+RMNLK PI+F+ GLTEKA  YYKMFITWTN+KIRKTFV RNMFDFK IKP D+AYI NPG MVVFATPGMLH GLSL IF++W  NE NM+IMPGYCV GTVG+KIL G +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI  CEPKNVMLVHGE  KM+FL++KI+ E  ++ +MPANGET  IS P+ +    S S++K E   Y  +PPDPKR RL+HGV+VMKD  + + +     +E GI  H +R+T  V   +    P+   +++L   +   L   +++++ +      E+V  K+E DE         +S+ +QDE +G ++LN+++++
Sbjct:    3 DIKITPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSHIDCVIISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTTQMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPVFALGRAQELCILLETYWERMNLKYPIYFALGLTEKANTYYKMFITWTNQKIRKTFVHRNMFDFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVGNKILGGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQNCEPKNVMLVHGEAGKMKFLRSKIKDEFNLETYMPANGETCVISTPVKIPVDASVSLLKAEARSYNAQPPDPKRRRLIHGVLVMKDNRIMLQNLTDALKEIGINRHVMRFTSKVKMDD--SGPVIRTSERLKTLLEEKLA-GWTVTMQENGSIAIESVEVKVEEDEKDPKQKNILISWTNQDEDIGAYILNVLQNM 596          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: EFX68345.1 (hypothetical protein DAPPUDRAFT_218302 [Daphnia pulex])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 400/602 (66.45%), Postives = 483/602 (80.23%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKY-ALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPD---DFSISLSDKEIFISETVICKIE--NDEGKVVSNVSFCHQDEQLGEFVLNIVRSI 599
            +I+VTPLGAGQDVGRSC+L+ +GGKN+MLDCGMHMGYNDERRFPDFS+I D     LT  LD VIISHFHLDHCGALP+MTEMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGE+NFFTSA IK+CMKKV+AV LHQ ++VD  +EIKAYYAGHVLGAAMF VKVGN+S+VYTGDYNMTPDRHLGAAWIDKCRP++LI+ESTYATT+RDSKRCRERDFLKKVHDCV+RGGKVLIPVFALGRAQELCILLETYW+RMNLK PI+F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMF+FK I+P D++Y   PGPMVVFATPGMLH GLSL +F++W  NE NM+IMPGYCV+GTVG K+L+G +K+E    + +EVKMSVQYMSFSAHADAKGIMQLI YCEP+NV+LVHGE  KMEFLK KI+ E+G+ C+MPANGE+A I C   +   VS S++KKE   Y  +  PDPKR   +HGV+VMKD  L +++PE+   E G+  H+IR+T  +  R      L   A +  + I   L     ++ +  SD+ +   E+V  K+E  + E +    +S+  QDE L  ++++ +R +
Sbjct:    3 DIKVTPLGAGQDVGRSCILLQMGGKNIMLDCGMHMGYNDERRFPDFSYIAD---GNLTESLDCVIISHFHLDHCGALPFMTEMVGYNGPIYMTHPTKAIAPILLEDMRKVAVERKGETNFFTSAHIKDCMKKVIAVTLHQTVQVDSEIEIKAYYAGHVLGAAMFHVKVGNQSVVYTGDYNMTPDRHLGAAWIDKCRPNILISESTYATTIRDSKRCRERDFLKKVHDCVDRGGKVLIPVFALGRAQELCILLETYWERMNLKAPIYFAVGLTEKANNYYKMFITWTNQKIRKTFVQRNMFEFKHIRPFDKSYADTPGPMVVFATPGMLHAGLSLQLFKKWAPNENNMLIMPGYCVSGTVGAKVLSGAKKVEIENRQVIEVKMSVQYMSFSAHADAKGIMQLIQYCEPQNVLLVHGEGVKMEFLKQKIQQEYGIDCYMPANGESAYIPCKPVVPVDVSLSLLKKEMALYDTVGAPDPKRPCRMHGVLVMKDNVLKLMEPEQAFGELGLNRHSIRFTSCIQLR------LPGTASRAMDQIQLILNSQNTNYPVKPSDEGLLNLESVSIKMETTDKEDRKSMMISWALQDEDLATWIMSSLRQV 595          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: EFX79332.1 (hypothetical protein DAPPUDRAFT_304859 [Daphnia pulex])

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 400/600 (66.67%), Postives = 483/600 (80.50%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKY-ALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAV-AQKLYNAISRDLPDDFSISLSDKEIFISETVICKIE--NDEGKVVSNVSFCHQDEQLGEFVLNIVRSI 599
            +I+VTPLGAGQDVGRSC+L+ +GGKN+MLDCGMHMGYNDERRFPDFS+I D     LT  LD VIISHFHLDHCGALP+MTEMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGE+NFFTSA IK+CMKKV+AV LHQ ++VD  +EIKAYYAGHVLGAAMF VKVGN+S+VYTGDYNMTPDRHLGAAWIDKCRP++LI+ESTYATT+RDSKRCRERDFLKKVHDCV+RGGKVLIPVFALGRAQELCILLETYW+RMNLK PI+F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMF+FK I+P D++Y   PGPMVVFATPGMLH GLSL +F++W  NE NM+IMPGYCV+GTVG K+L+G +K+E    + +EVKMSVQYMSFSAHADAKGIMQLI YCEP+NV+LVHGE  KMEFLK KI+ E+G+ C+MPANGE+A I C   +   VS S++KKE   Y  +  PDPKR   +HGV+VMKD  L +++PE+   E G+  H+IR+T  +  R     P +A+ A      I      ++ +  SD+ +   E+V  K+E  + E +    +S+  QDE L  ++++ +R +
Sbjct:    3 DIKVTPLGAGQDVGRSCILLQMGGKNIMLDCGMHMGYNDERRFPDFSYIAD---GNLTESLDCVIISHFHLDHCGALPFMTEMVGYNGPIYMTHPTKAIAPILLEDMRKVAVERKGETNFFTSAHIKDCMKKVIAVTLHQTVQVDSEIEIKAYYAGHVLGAAMFHVKVGNQSVVYTGDYNMTPDRHLGAAWIDKCRPNILISESTYATTIRDSKRCRERDFLKKVHDCVDRGGKVLIPVFALGRAQELCILLETYWERMNLKAPIYFAVGLTEKANNYYKMFITWTNQKIRKTFVQRNMFEFKHIRPFDKSYADTPGPMVVFATPGMLHAGLSLQLFKKWAPNENNMLIMPGYCVSGTVGAKVLSGAKKVEIENRQVIEVKMSVQYMSFSAHADAKGIMQLIQYCEPQNVLLVHGEGVKMEFLKQKIQQEYGIDCYMPANGESAYIPCKPVVPVDVSLSLLKKEMALYDTVGAPDPKRPCRMHGVLVMKDNVLKLMEPEQAFGELGLNRHSIRFTSCIQLR----LPGTAIRAMDQIQLILNSQNTNYPVKPSDEGLLNLESVSIKMETTDKEDRKSMMISWALQDEDLATWIMSSLRQV 595          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: gb|EEC05985.1| (cleavage and polyadenylation specificity factor, putative [Ixodes scapularis])

HSP 1 Score: 844.343 bits (2180), Expect = 0.000e+0
Identity = 397/597 (66.50%), Postives = 475/597 (79.56%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVI-CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRSI 599
            +I VTPLGAGQDVGRSC+L+SIGGKN+MLDCGMHMGYNDERRFPDFS++  T   PL  HLD +IISHFHLDHCGALPYMTEMVGY+GP+YMTHPTKAI PILLED R++ V+RKGE+NFFTS MIK+CMKKVVAV+LHQ ++VD+ LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFL KVHDC+++GGKVLIPVFALGRAQELCILLETYWDRMNLKVPI+F+ GLTEKATNYYKMFITWTN+KIRKTFV+RNMFDFK IKP DRA+I NPGPMVVFATPGMLH GLSL IF++W   E NM+IMPGYCVAGTVGHKIL+G RK+E    + VEVKMSVQYMSFSAHADAKGIMQLI  CEP NV+LVHGE +KMEFL+ K+  E  + C+MPANGET  I  P  +   VS  ++K+     +    D K+ +L+HG ++M+D T+ ++D  +  +E G+  H IR+T  V   +  +  L+  A  +Y  I   + D     L D  I ++  +I    + DE      VS+  QDE+LG ++L +V+ +
Sbjct:    3 QISVTPLGAGQDVGRSCILLSIGGKNIMLDCGMHMGYNDERRFPDFSYV--TQEGPLNDHLDCLIISHFHLDHCGALPYMTEMVGYAGPVYMTHPTKAICPILLEDFRKITVDRKGETNFFTSQMIKDCMKKVVAVNLHQTVQVDDELEIKAYYAGHVLGAAMFHIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLTKVHDCIDKGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIYFAVGLTEKATNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDRAFIDNPGPMVVFATPGMLHAGLSLQIFKKWAPVEGNMVIMPGYCVAGTVGHKILSGARKVELDNRQVVEVKMSVQYMSFSAHADAKGIMQLIHQCEPSNVLLVHGEASKMEFLRKKVLQEFNIDCYMPANGETVQIDTPDIIPIDVSLPLLKRA---LSQGGSDSKKPKLIHGALIMQDNTIRLMDSGQAMQELGVVGHQIRFTTTVSVSS--RGSLTKTADAIYGNIKNKIKDPSIQLLPDGSISVASALIKVGGQEDESNKAICVSWTLQDEELGSYLLGLVQEM 592          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: gb|KFM62469.1| (Integrator complex subunit 11, partial [Stegodyphus mimosarum])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 379/592 (64.02%), Postives = 469/592 (79.22%), Query Frame = 0
Query:   15 DVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLS-DKEIFISETVI-CKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRSIADKFK 604
            DVGRSC+L++IGGKN+MLDCGMHMGYND+RRFPDFSFI       L  HL  VIISHFHLDHCGALPYMTEMVGY+GPIYMT PTKAI PILLED RR+ V++KGE+NFFTS M+K+CMKKV  V LH+ ++VD+ LEIKAYYAGHVLGAAMF +KVG++S+VYTGD+N TPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFL KVHDCVERGGKVLIPVFALGRAQE+CILLETYW+RMNLK+PI+F+ GLTEKAT +YKMFITWTN+KI++TFV RNMFDFK IKP DRAYI NPGPMVVFATPGMLH GLS+ IF +W  NE NM+IMPGYCVAGTVGHK+++G +K+EF   + VEVKMSVQYMSFSAHADAKGIMQLI +CEP  V+LVHGE +KMEFLK KI  E G +CFMPANGET + S P+++   VS +++KK+  +        KR  +LHG++VM +  + +++PE    E G+  H IR+T  +   +    P S +   +Y+ + ++L +  S+ L+ D  I ++  +I   +  D+ K +  VS+ +QDE+LG+++L  +++   + K
Sbjct:   22 DVGRSCILLTIGGKNVMLDCGMHMGYNDDRRFPDFSFISQ---GNLNQHLACVIISHFHLDHCGALPYMTEMVGYNGPIYMTMPTKAICPILLEDYRRITVDKKGETNFFTSTMVKDCMKKVTTVGLHETVQVDDELEIKAYYAGHVLGAAMFLIKVGSQSVVYTGDFNTTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLTKVHDCVERGGKVLIPVFALGRAQEMCILLETYWERMNLKIPIYFAVGLTEKATTFYKMFITWTNQKIKQTFVHRNMFDFKHIKPFDRAYIDNPGPMVVFATPGMLHSGLSVQIFRKWAPNENNMLIMPGYCVAGTVGHKVISGAKKIEFENRQIVEVKMSVQYMSFSAHADAKGIMQLIQHCEPSKVLLVHGEASKMEFLKKKITQELGKECFMPANGETVSFSTPVSMPVDVSLNLVKKQLFQEGSSIAGVKRKNILHGMLVMNNNKIRLMEPEDAMCELGLTPHQIRFTSTIHIDDPAGVPASRLTDVIYSKV-KNLFETRSVQLALDCSITVASVLIQVNVREDDTKSIC-VSWGYQDEELGKYLLPAIKNWVSEIK 608          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: EEB14934.1 (Endoribonuclease YSH1, putative [Pediculus humanus corporis])

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 385/599 (64.27%), Postives = 466/599 (77.80%), Query Frame = 0
Query:    1 MTEEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDE-GKVVSNVSFCHQDEQLGEFVLNIVRS 598
            M  +I+VTPLGAGQDVGRSC+L+                        +FSFI  +P  P+T  +D VIISHFHLDHCGALPY+TEMVGY+GPIYMTHPTKAI+PILLEDMR+++VE+KGE NFFTS MIK+CMKKV+ V LHQ I VD  LEIKAYYAGHVLGAAMF ++VGN S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVH+C+E+GGKVLIPVFALGRAQELCILLETYW+RMNLKVPI+F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP DR+YI    PMVVFATPGMLH GLSL IF++W  NE NM+IMPG+CVAGTVGHKIL+G +K+EF   + V+VKMSVQYMSFSAHADAKGIMQLI YCEPKNV+LVHGE AKMEFL+ KI+ E  + C+MPANGET TI  P  +   +S +++K E   Y    P+  ++R+LHGV+V K+ +L +++ E   +E G+  H IR+T  V  R E   P + +A+KL   +   L  ++SI  +D  I + ETV+ K+E DE  +    VS+ +QDE LG ++LN++++
Sbjct:    1 MANDIKVTPLGAGQDVGRSCILL------------------------NFSFI--SPEGPITNFIDCVIISHFHLDHCGALPYLTEMVGYNGPIYMTHPTKAISPILLEDMRKISVEKKGEVNFFTSQMIKDCMKKVITVTLHQSIMVDSQLEIKAYYAGHVLGAAMFWIRVGNLSVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHECIEKGGKVLIPVFALGRAQELCILLETYWERMNLKVPIYFAVGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDRSYIDQAWPMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGFCVAGTVGHKILSGQKKIEFENRQIVDVKMSVQYMSFSAHADAKGIMQLIQYCEPKNVLLVHGEAAKMEFLRDKIKQEFHINCYMPANGETCTIDIPHKIPIDISLNLLKSESQAYNALLPNLSKSRILHGVLVNKEHSLCLMNVEDACKEAGVTRHIIRFTSTV--RMEDPRPPNKIAEKLLKIVKEKL-KNYSIQFTDSSISV-ETVLIKVEGDEDDRKCVYVSWTNQDEDLGSYILNLLQN 569          
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Match: gb|KPM11411.1| (integrator complex subunit 11-like protein [Sarcoptes scabiei])

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 246/346 (71.10%), Postives = 291/346 (84.10%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILL------------------EDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGML 331
            EI++TPLGAGQDVGRSC+L+SIG + +MLDCGMHMG+ND+RRFPDFS+I  T    L  +LD VIISHFHLDHCGALPYMTEM+GY+GPIYMTHPTKAI PILL                  ED R++ VERKGE+NFFT+ MIK+CM+KV  V+LH+ I V+E LEIKAYYAGHVLGAAMF ++ G++S+VYTGDYNMTPDRHLG+AWIDKCRP++LITESTYATT+RDSKRCRERDFL KVH+C+E+GGKVLIPVFALGR QEL ILLETYW+RMNLK+PI+F+ GL EKA NYYK+FI WTNEKI+ TFV+RNMF+F+ IKP DR+Y  +  PMVVFATPG +
Sbjct:    3 EIKITPLGAGQDVGRSCILISIGTQQIMLDCGMHMGFNDQRRFPDFSYI--TKEGSLDSYLDCVIISHFHLDHCGALPYMTEMIGYNGPIYMTHPTKAICPILLVRLCLICSLIELNLFFLQEDFRKITVERKGETNFFTNQMIKDCMRKVTPVNLHETIMVNEELEIKAYYAGHVLGAAMFYIRSGHQSLVYTGDYNMTPDRHLGSAWIDKCRPNVLITESTYATTIRDSKRCRERDFLMKVHECIEKGGKVLIPVFALGRVQELSILLETYWERMNLKIPIYFTVGLAEKANNYYKLFIPWTNEKIKNTFVKRNMFEFRHIKPFDRSYADSKEPMVVFATPGWM 346          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|1133438477|ref|XP_019875551.1| (PREDICTED: LOW QUALITY PROTEIN: integrator complex subunit 11 [Aethina tumida])

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 416/598 (69.57%), Postives = 500/598 (83.61%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSIA 600
            +I+VTPLGAGQDVGRSCLL+S+GGKN+MLDCGMHMGYNDERRFPDF++I  +P  PLTP +DAVIISHFHLDHCGALPYM+EMVGYSGPIYMTHPTKAIAPILLEDMR+V+VE+KG+ NFFTS MIK+CMKKVVAV LHQ + VD  LEIKAYYAGHVLGAAMF V+VG++SIVYTGDYNMTPDRHLGAAW+DKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+C++RGGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP DR YI NPGPMVVFATPGMLH GLSL IF++W  +E NM+IMPG+CV GTVGHKILNG +++EF     VEVKM+V+YMSFSAHADAKGIMQLI YCEP+NVMLVHGE  KMEFLK KI  E  ++C+ PANGETA I+ P+ +   VS  ++KKE  KY+L PPDPKR R +HGV++MKD ++S+++ ++   E GI  H +R+T  V   +   +  SA A KL++ I   LP  ++++ S+ EI + E+V+ K+E DE    S  VS+ +QDE LG ++L+I+ ++ 
Sbjct:    3 DIKVTPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFTYI--SPDGPLTPFIDAVIISHFHLDHCGALPYMSEMVGYSGPIYMTHPTKAIAPILLEDMRKVSVEKKGDQNFFTSQMIKDCMKKVVAVTLHQSVMVDSELEIKAYYAGHVLGAAMFWVRVGSQSIVYTGDYNMTPDRHLGAAWVDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECIDRGGKVLIPVFALGRAQELCILLETYWERMNLKAPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDRQYIDNPGPMVVFATPGMLHAGLSLQIFKKWAPSENNMVIMPGFCVQGTVGHKILNGAKRIEFENRMVVEVKMAVEYMSFSAHADAKGIMQLIQYCEPRNVMLVHGEAEKMEFLKEKIHQEFKIKCYNPANGETAIITTPVKIPIDVSLPLLKKEAKKYSLLPPDPKRRRTIHGVLLMKDSSVSMMEVDEACREAGIVRHIVRFTSTVHINDSGSA--SATAHKLHDFIKEKLP-QWNVTFSEGEISV-ESVLVKVEGDEDDQKSVYVSWTNQDEDLGSYILSILNNMG 594          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|762149648|ref|XP_011412767.1| (PREDICTED: integrator complex subunit 11-like [Crassostrea gigas])

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 417/599 (69.62%), Postives = 491/599 (81.97%), Query Frame = 0
Query:    1 MTEEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISL-SDKEIFISETVICKIENDEGKVVSN-VSFCHQDEQLGEFVLNIVR 597
            M  EI+VTPLGAGQDVGRSC+L++IGGKN+MLDCGMHMGYNDERRFPDF++I D  G  LT HLD VIISHFHLDHCGALPYM+EMVGY GPIYMTHPTKAI PILLED R++ VERKGE NFFTS MIK CMKKVV V+LH+  +VDE LEIKAYYAGHVLGAAMF +KVG +S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVHDCVE+GGKVLIPVFALGRAQELCILLE+YWDRMN+KVPI+FS GLTEKA +YYK+FITWT++KI+KTFV+RNMF+FK IKP DRA+I NPGPMVVFATPGMLH GLSL IF++W  NELNM+IMPGYCVAGTVGHKILNG RKLE    + ++VK+SVQYMSFSAHADAKGIMQLIS CEP+NVMLVHGE AKM+FLK KI+ E G+ C+ PANGE+ TI     +   +  S++K+E  K  L PPD KR R+LHG +VM+   L I+DP +  +E G++ H +R+T  +    E   P + VA+K+Y  + R L  DFSI   SD  I IS++++ ++  DE +  S  VS+ HQDE +G F+L ++R
Sbjct:    1 MASEIKVTPLGAGQDVGRSCILLTIGGKNIMLDCGMHMGYNDERRFPDFTYITDEEGDKLTDHLDCVIISHFHLDHCGALPYMSEMVGYDGPIYMTHPTKAICPILLEDYRKITVERKGEENFFTSEMIKNCMKKVVVVNLHETKQVDEELEIKAYYAGHVLGAAMFHIKVGQQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHDCVEKGGKVLIPVFALGRAQELCILLESYWDRMNIKVPIYFSLGLTEKANHYYKLFITWTSQKIKKTFVQRNMFEFKHIKPFDRAFIDNPGPMVVFATPGMLHAGLSLQIFKKWAPNELNMVIMPGYCVAGTVGHKILNGARKLELENKQILDVKLSVQYMSFSAHADAKGIMQLISQCEPRNVMLVHGEAAKMDFLKNKIQQEFGIDCYKPANGESVTIETTHNIHVDIPLSLLKREASKTGLLPPDAKRPRVLHGALVMRGNRLQIIDPSQALKEMGVEEHHLRFTSTISIEEE--GPSNKVAEKIYQLVKRKL-KDFSIHYSSDGSISISDSLLIQVSGDEDETKSVLVSWSHQDEDIGSFLLQLLR 596          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|512914556|ref|XP_004928171.1| (PREDICTED: integrator complex subunit 11 [Bombyx mori])

HSP 1 Score: 877.47 bits (2266), Expect = 0.000e+0
Identity = 411/597 (68.84%), Postives = 496/597 (83.08%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSI 599
            +I++TPLGAGQDVGRSC+L+++GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T  +D VIISHFHLDHCGALPYM+EM+GY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFTS MIK+CMKKV AV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVH+CVE+GGKVLIPVFALGRAQELCILLETYWDRMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D+ YI NPG MVVFATPGMLH GLSL IF++W   E NM+IMPG+CV GTVGHKILNG +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI YCEPKNV+LVHGE  KMEFLK KIE E  + CFMPANGET  I+ P T+   VS  ++K E ++Y  +PPDPKR R+++G++ +KD  LS+LD +++ +E GI  H IR+T  V F  E   P    A+KL N ++  L + ++I++S+  I + E+V+ K+E ++    +  VS+ +QDE LG ++L +++S+
Sbjct:    3 DIKITPLGAGQDVGRSCILLTMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSQIDCVIISHFHLDHCGALPYMSEMIGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTSQMIKDCMKKVTAVTLHQSVMVDNELEIKAYYAGHVLGAAMFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHECVEKGGKVLIPVFALGRAQELCILLETYWDRMNLKYPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKTYIDNPGAMVVFATPGMLHAGLSLNIFKKWAPYEQNMVIMPGFCVQGTVGHKILNGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQYCEPKNVLLVHGEAQKMEFLKDKIEKEFKISCFMPANGETCVINTPTTIPIDVSLRLLKAEAVRYNAQPPDPKRRRVVNGILCVKDNRLSLLDIDEMCDEIGINRHIIRFTSTVRF--EDPGPAIKTAEKLQNLLTEKL-EGWTITISEGNISV-ESVLIKVEGEDDSTKNIYVSWTNQDEDLGSYILGLLQSM 593          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|914569041|gb|KOB72797.1| (Cleavage and polyadenylation specificity factor [Operophtera brumata])

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 414/597 (69.35%), Postives = 495/597 (82.91%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSI 599
            +I++TPLGAGQDVGRSC+L+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T  +D VIISHFHLDHCGALPYM+EMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFTS MIK+CMKKV AV LHQ + VD  LEIKAYYAGHVLGAAMF +KVG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVH+CVE+GGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D+ YI+NPG MVVFATPGMLH GLSL IF++W   E NM+IMPG+CV GTVGHKILNG +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI YCEPKNV+LVHGE  KMEFLK KIE E  + C+MPANGET TI+ PI +   VS  ++K E ++Y   PPDPKR R+++G++ +KD  LS+LD +++ +E GI  H IR+T  V F  E   P    A+KL   +   L + ++I++SD  I + E+V+ K+E D+    +  VS+ +QDE LG ++L +++S+
Sbjct:    3 DIKITPLGAGQDVGRSCILLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSQIDCVIISHFHLDHCGALPYMSEMVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTSQMIKDCMKKVTAVTLHQSVMVDNDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHECVEKGGKVLIPVFALGRAQELCILLETYWERMNLKYPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKTYIENPGAMVVFATPGMLHAGLSLNIFKKWAPYEQNMVIMPGFCVQGTVGHKILNGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQYCEPKNVLLVHGEAQKMEFLKDKIEKEFKISCYMPANGETCTINTPIKIPIDVSLRLLKAEAVRYNALPPDPKRRRVVNGILCVKDNRLSLLDIDEVCDEIGINRHIIRFTSTVRF--EDPGPAIKTAEKLMALLLEKL-EGWTITISDGNISV-ESVLIKVEGDDDSTKNIYVSWTNQDEDLGSYILGLLQSM 593          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|913322587|ref|XP_013192519.1| (PREDICTED: integrator complex subunit 11 [Amyelois transitella])

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 413/599 (68.95%), Postives = 493/599 (82.30%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVSNVSFCHQDEQLGEFVLNIVRSIADK 602
            +I++TPLGAGQDVGRSC+L+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T  +D VIISHFHLDHCGALPYM+EMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGE+NFFTS MIK+C+KKV AV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATT+RDSKRCRERDFLKKVH+CVE+GGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D++YI NPG MVVFATPGMLH GLSL IF++W   E NM+IMPG+CV GTVGHKILNG +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI YCEPKNV+LVHGE  KMEFLK KIE E  + CFMPANGET  I+ P  +   VS  ++K E +KY   PPDPKR R+++G++ +KD  LS+LD +++ +E GI  H IR+T  V F  E   P    A+KL   +   L D ++I++S+  I + E+V+ KIE DE      VS+ +QDE LG ++L +++S+  +
Sbjct:    3 DIKITPLGAGQDVGRSCILLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSQIDCVIISHFHLDHCGALPYMSEMVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGEANFFTSQMIKDCIKKVTAVTLHQSVMVDNELEIKAYYAGHVLGAAMFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTIRDSKRCRERDFLKKVHECVEKGGKVLIPVFALGRAQELCILLETYWERMNLKYPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKSYIDNPGAMVVFATPGMLHAGLSLNIFKKWAPYEQNMVIMPGFCVQGTVGHKILNGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQYCEPKNVLLVHGEAQKMEFLKDKIEKEFKIDCFMPANGETCVINTPTKIPVDVSLRLLKAEAVKYNALPPDPKRRRVVNGILCVKDNRLSLLDIDEVCDEIGINRHIIRFTSTVRF--EDPGPAVKTAEKLKALLEGKL-DGWTITISEGNISV-ESVLIKIEGDESTKSIYVSWTNQDEDLGSYILGLLQSMVQE 595          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|646708854|gb|KDR15001.1| (Integrator complex subunit 11 [Zootermopsis nevadensis])

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 413/598 (69.06%), Postives = 499/598 (83.44%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIE-NDEGKVVSNVSFCHQDEQLGEFVLNIVRSIA 600
            EI++TPLGAGQDVGRSC+L+S+GGKN+MLDCGMHMG+NDERRFPDF++I   P  PLT ++D VIISHFHLDHCGALPY TEMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFTS  IK+CMKKVVAV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKK+H+CV+RGGKVLIPVFALGRAQELCILLETYW+RMNLKVP++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D+AYI NPG MVVFATPGMLH GLSL IF++W  NE NM+IMPG+CV GTVGHK+LNG +K+EF   +TVEVKMSVQYMSFSAHADAKGIMQLI YC+PKNVMLVHGE AKMEFLK KI+ E  ++C+MPANGET  +S  +T+   VS  ++K E  K+   PPDPKR R++HGV+VMKD ++ ++D +   +E GI  H +R+T  +  R E   P S  A+KL + I   L  D+ + L++  I + E+V+ K+E ++E +    VS+ +QDE+LG ++L +++++ 
Sbjct:    3 EIKITPLGAGQDVGRSCILLSMGGKNIMLDCGMHMGFNDERRFPDFTYI--APDGPLTSYIDCVIISHFHLDHCGALPYFTEMVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTSQNIKDCMKKVVAVTLHQSVMVDGHLEIKAYYAGHVLGAAMFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKIHECVDRGGKVLIPVFALGRAQELCILLETYWERMNLKVPVYFAVGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGFCVVGTVGHKVLNGAKKIEFENRQTVEVKMSVQYMSFSAHADAKGIMQLIQYCQPKNVMLVHGEAAKMEFLKEKIKKEFDLECYMPANGETCVVSTSMTIPLDVSLKLLKTEAQKHNSLPPDPKRPRVMHGVLVMKDSSMCLMDVDDACKEAGINRHLVRFTSTL--RMEDPGPASKTAEKLLHLIKTRL-KDWHVQLTEGSISV-ESVLVKVEGSEEEQKNVYVSWDNQDEELGSYILGLLKTMG 594          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|943953930|ref|XP_014359882.1| (PREDICTED: integrator complex subunit 11 [Papilio machaon] >gi|930673520|gb|KPJ14009.1| Integrator complex subunit 11 [Papilio machaon])

HSP 1 Score: 876.315 bits (2263), Expect = 0.000e+0
Identity = 413/598 (69.06%), Postives = 490/598 (81.94%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSIA 600
            +I++TPLGAGQDVGRSC+L+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T  +D VIISHFHLDHCGALPYM+EMVGY+GPIYMTHPTKAIAPILLEDMR++ VERKGESNFFTS MIK+C+KKV AV LHQ + VD  LEIKAYYAGHVLGAAMF V+VGN+S+VYTGDYNMTPDRHLGAAWIDKCRPDL+ITESTYATT+RDSKRCRERDFLKKVH+CVE+GGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D++YI NPG MVVFATPGMLH GLSL IF++W   E NM+IMPG+CV GTVGHKILNG +K+EF   + V+VKM+V+YMSFSAHADAKGIMQLI YCEPKNV+LVHGE  KMEFLK KIE E  + C+MPANGET+TIS P  +   VS  ++K E ++Y  +PPDPKR R++HG++ +KD  LS LD +++  E GI  H IR+T  V F  E   P    A+KL   +   L   +SI++SD  I + E+V+ K E D     +  VS+  QDE LG ++L +++S+A
Sbjct:    3 DIKITPLGAGQDVGRSCILLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSQIDCVIISHFHLDHCGALPYMSEMVGYTGPIYMTHPTKAIAPILLEDMRKLIVERKGESNFFTSQMIKDCIKKVTAVTLHQSVMVDNELEIKAYYAGHVLGAAMFWVRVGNQSVVYTGDYNMTPDRHLGAAWIDKCRPDLMITESTYATTIRDSKRCRERDFLKKVHECVEKGGKVLIPVFALGRAQELCILLETYWERMNLKYPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKSYIDNPGAMVVFATPGMLHAGLSLNIFKKWAPYEQNMLIMPGFCVQGTVGHKILNGAKKVEFENRQVVDVKMAVEYMSFSAHADAKGIMQLIQYCEPKNVLLVHGEAQKMEFLKDKIEKEFKINCYMPANGETSTISTPTKIPIDVSLRLLKAESVRYNAQPPDPKRRRIVHGILCVKDNRLSFLDIDEVCNEIGINRHVIRFTSTVRF--EDSGPAVKTAEKLKALLEEKL-QGWSITISDGNISV-ESVLIKFEGDNDNTKNIYVSWTSQDEDLGSYILGLLQSMA 594          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|357624104|gb|EHJ75000.1| (hypothetical protein KGM_18742 [Danaus plexippus])

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 413/597 (69.18%), Postives = 496/597 (83.08%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSI 599
            EI++TPLGAGQDVGRSC+L+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T  +D VIISHFHLDHCGALPYM+EMVGY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFTS MIK+C+KKV AV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+CVE+GGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D++YI NPG MVVFATPGMLH GLSL IF++W   E NM+IMPG+CV GTVGHKILNG +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI YCEPKNV+LVHGE  KMEFLK KIE E  + C+MPANGETA I+ P  +   VS  ++K E ++Y  +PPDPKR R++HGV+ +KD  LS LD +++ +E GI  H IR+T  V F ++  S +   A+KL   ++  L   +SI++SD  I + E+V+ K+E ++    S  VS+ +QDE LG ++L +++S+
Sbjct:    3 EIKITPLGAGQDVGRSCILLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSQIDCVIISHFHLDHCGALPYMSEMVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTSQMIKDCIKKVTAVTLHQSVMVDNELEIKAYYAGHVLGAAMFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVEKGGKVLIPVFALGRAQELCILLETYWERMNLKYPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKSYIDNPGAMVVFATPGMLHAGLSLNIFKKWAPYEQNMLIMPGFCVQGTVGHKILNGAKKIEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQYCEPKNVLLVHGEAQKMEFLKDKIEKEFKISCYMPANGETAIINTPTKIPIDVSLRLLKAEAVRYNAQPPDPKRRRVVHGVLCVKDNRLSFLDIDEMCDEIGINRHIIRFTSTVRF-DDAGSAIKT-AEKLKTLLAEKL-QGWSITISDGNISV-ESVLIKVEGEDDNTKSIYVSWTNQDEDLGSYILGLLQSM 593          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|1069810122|ref|XP_018328877.1| (PREDICTED: integrator complex subunit 11 [Agrilus planipennis])

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 413/599 (68.95%), Postives = 497/599 (82.97%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIE-NDEGKVVSNVSFCHQDEQLGEFVLNIVRSIAD 601
            EI++TPLGAGQDVGRSC+L+S+GGKN+MLDCGMHMGYNDERRFPDFSFI   P  P+TP++D VIISHFHLDHCGALPYM+EMVGYSGPIYMTHPTKAIAPILLEDMR+V+VERKG+ NFFTS MIKECMKKV+AV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+C++RGGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP DR YI NPGPMVVFATPGMLH GLSL IF++W +NE NM+I+PG+CV GTVGHKILNG RK+EF   + +EVKMSV+YMSFSAHADAKGIMQLI YCEP+NVMLVHGE AKMEFLK KI+ E  ++CF PANGET  I+ P+ +   VS  ++K E  K++  P + KR R+LHGV++MKD +  ++D ++  +E GI  H IR+T  V   +    P  A A KL+  I   LP  +S++ +D  I + E+V+ K+E +DE +    VS+ +QDE LG ++L ++ S+++
Sbjct:    3 EIKITPLGAGQDVGRSCILLSMGGKNIMLDCGMHMGYNDERRFPDFSFI--CPEGPITPYIDCVIISHFHLDHCGALPYMSEMVGYSGPIYMTHPTKAIAPILLEDMRKVSVERKGDQNFFTSQMIKECMKKVIAVTLHQSVMVDNDLEIKAYYAGHVLGAAMFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECIDRGGKVLIPVFALGRAQELCILLETYWERMNLKAPVYFAVGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDRQYIDNPGPMVVFATPGMLHAGLSLHIFKKWSSNESNMVILPGFCVQGTVGHKILNGARKIEFEGRQIIEVKMSVEYMSFSAHADAKGIMQLIQYCEPRNVMLVHGEPAKMEFLKGKIKQEFNLECFNPANGETCVINTPVRIPIDVSLPLLKAEAKKFSALPSESKRQRVLHGVLLMKDNSTCLMDVDEACKEAGITRHVIRFTSTVHVNDP--GPAMATAHKLHLLIKDRLP-MWSVTFTDGSISL-ESVLVKVEGDDEEQKSVFVSWTNQDEGLGSYILGLLNSMSN 595          
BLAST of EMLSAG00000000010 vs. nr
Match: gi|768411962|ref|XP_011566586.1| (PREDICTED: integrator complex subunit 11 [Plutella xylostella])

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 407/599 (67.95%), Postives = 494/599 (82.47%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPDDFSISLSDKEIFISETVICKIENDEGKVVS-NVSFCHQDEQLGEFVLNIVRSIAD 601
            +I++TPLGAGQDVGRSC+L+S+GGKN+MLDCGMHMGYNDERRFPDFS+I   P  P+T  +D VIISHFHLDHCGALPYM+EM+GY+GPIYMTHPTKAIAPILLEDMR+VAVERKGESNFFTS MIK+C+KKV AV LHQ + VD  LEIKAYYAGHVLGAAMF ++VG++S+VYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVH+CVE+GGKVLIPVFALGRAQELCILLETYW+RMNLK P++F+ GLTEKA NYYKMFITWTN+KIRKTFV+RNMFDFK IKP D+ YI NPG MVVFATPGMLH GLSL IF++W   E NM+IMPG+CV GTVGHKILNG +K+EF   + VEVKM+V+YMSFSAHADAKGIMQLI YCEPKNV+LVHGE  KMEFLK KIE E  + C+MPANGET TI+ P  +   +S  ++K E ++Y  +PPDPKR R++HG++ +KD  +S+LD +++ EE GI  H IR+T  V F +    P    A+KL   +   L   +SI++SD  I + E+V+ K+E ++    +  VS+ +QDE LG ++L +++++ +
Sbjct:    3 DIKITPLGAGQDVGRSCILLSMGGKNIMLDCGMHMGYNDERRFPDFSYI--VPEGPITSQIDCVIISHFHLDHCGALPYMSEMIGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTSQMIKDCIKKVTAVTLHQSVMVDNDLEIKAYYAGHVLGAAMFWIRVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVEKGGKVLIPVFALGRAQELCILLETYWERMNLKYPVYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFDFKHIKPFDKTYIDNPGAMVVFATPGMLHAGLSLNIFKKWAPYEQNMVIMPGFCVQGTVGHKILNGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQYCEPKNVLLVHGEAQKMEFLKEKIEQEFKINCYMPANGETCTINTPTKVPIDISLRLLKAESVRYNAQPPDPKRRRVIHGILCVKDNRMSLLDIDEVCEEIGISRHVIRFTSTVRFDD--SGPAVKTAEKLKTLLEEKL-QGWSITISDGNISV-ESVLIKVEGEDDSTKNIYVSWTNQDEDLGSYILGLLQAMVE 595          
BLAST of EMLSAG00000000010 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold719_size106944-snap-gene-0.30 (protein:Tk04736 transcript:maker-scaffold719_size106944-snap-gene-0.30-mRNA-1 annotation:"integrator complex subunit 11")

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 443/614 (72.15%), Postives = 510/614 (83.06%), Query Frame = 0
Query:    4 EIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTP------------GAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEHGVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDLPD-DFSISLSDKEI-FISETVICKIE---NDEGKVVSNVSFCHQDEQLGEFVLNIVRSIA 600
            +I VTPLGAGQDVGRSCLLV IGGK++MLDCGMHMGYND+RRFPDFS+I  T                LT H+DAVIISHFHLDHCGALP+MTEMVGY+GPIYMTHPTKAIAPILLEDMRRVAVERKGE+NFFTSAM+K+CMKKV+AV+LHQ+++V E +E+KAYYAGHVLGAAMFQV+VGN+SIVYTGDYNMTPDRHLGAAWIDKCRPDLLI+ESTYATT+RDSKRCRERDFLKKVHDCVE+GGKVLIPVFALGRAQELCILLETYW+RMNLKVPI+FS GLTEKA NYYKMFITWTNEKIRKTFVERNMF+FK I   DRAYI NPGPMVVFATPGMLH GLSL IFEEWC+ ELNMIIMPGYCVAGTVGHKILNG RKLEF KGK VEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGE  KMEFLK KI+ EHGV+CFMPANGETA I CP+++   VSS +I+ E  +YAL+PPDPKRAR LHGV+VM+D TL ++  E+   + GI  HTIR+T  +P  +    P+ A   ++   +   L   DF + L + E+  ++ +V+ K+E   +D+      VS+ +QDE LG  ++ ++++I 
Sbjct:    3 DITVTPLGAGQDVGRSCLLVRIGGKHIMLDCGMHMGYNDDRRFPDFSYITGTTLEDVTNVGVAKTNGILTEHIDAVIISHFHLDHCGALPFMTEMVGYNGPIYMTHPTKAIAPILLEDMRRVAVERKGETNFFTSAMVKDCMKKVIAVNLHQIVKVGEDIELKAYYAGHVLGAAMFQVRVGNQSIVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHDCVEKGGKVLIPVFALGRAQELCILLETYWERMNLKVPIYFSMGLTEKANNYYKMFITWTNEKIRKTFVERNMFEFKHITGFDRAYIHNPGPMVVFATPGMLHAGLSLHIFEEWCSGELNMIIMPGYCVAGTVGHKILNGARKLEFKKGKPVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEAGKMEFLKQKIKQEHGVECFMPANGETAVIPCPVSIPATVSSQLIQSEAAQYALRPPDPKRARFLHGVLVMQDNTLKLMSAEEACADLGIPQHTIRFTSTIPLSD--AGPVEATQTRVNALLKNHLASTDFEVQLHEGELSVLNSSVLLKVEQNADDDALKDVMVSWTNQDEALGSSLMTLIQNIG 614          
BLAST of EMLSAG00000000010 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold495_size155559-processed-gene-0.4 (protein:Tk09235 transcript:snap_masked-scaffold495_size155559-processed-gene-0.4-mRNA-1 annotation:"cleavage and polyadenylation specificity factor subunit 3")

HSP 1 Score: 332.413 bits (851), Expect = 2.345e-105
Identity = 192/552 (34.78%), Postives = 300/552 (54.35%), Query Frame = 0
Query:    3 EEIRVTPLGAGQDVGRSCLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVYTGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMN--LKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVERNMFDFKFIKPLDRA-YIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKILNGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQAKMEFLKAKIESEH------GVQCFMPANGETATISCPITLEGCVSSSIIKKEHLKYALKPPDPKRARLLHGVIVMKDETLSILDPEKIAEEFGIQSHTIRYTLNVPFRNEVQSPLSAVAQKLYNAISRDL 545
            +++ + PLGAGQ+VGRSC ++    K ++LDCG+H G N     P    IE          +D ++ISHFHLDH GALP+  +   + G  +MTH TKAI   LL D  +V+     E   ++   ++  M+K+  ++ H+   V+  ++  AY AGHVLGAAMF +++    ++YTGD++   DRHL AA +   RPD+LI E+TY T + + +  RE  F   +H+ V RGG+ LIPVFALGRAQEL ++L+ YW       ++PI++++ L +K    Y+ F+   N+KIR+     N F FK I  L    +  + GP V+ A+PGM+  GLS  +FE WCT+  N  I+ GYCV GT+   IL+   ++    G+ + +K+ V Y+SFSAH D K     I   +P +V+LVHGE  +M  LK+ +  E+       +  + P N    T++  +   G   + ++    ++   KP D  R   + GV+V ++    IL    + +   +   T+    +V +    Q     + Q L + +S DL
Sbjct:   22 DKMTIRPLGAGQEVGRSCHILEFKDKRVLLDCGIHPGLNGMDALPFVDMIE-------ADKIDLLLISHFHLDHAGALPWFLQKTTFKGKCFMTHATKAIYRWLLSDFIKVS-NIATEQMLYSEQDLETSMEKIDTLNFHEEKEVN-GIKFWAYNAGHVLGAAMFMIEIAGVRVLYTGDFSREEDRHLMAAELPTLRPDVLIVEATYGTHIHEKREDREHRFTSTIHEIVNRGGRCLIPVFALGRAQELLLILDEYWAAHPELHEIPIYYASSLAKKCMAVYQTFVNAMNDKIRRQIAVSNPFVFKHISNLKGIDHFDDIGPCVILASPGMMQSGLSRELFESWCTDSKNGCIVAGYCVEGTLAKHILSEPEEITAMNGQRLPLKLQVSYISFSAHTDYKQTSGFIRALKPPHVILVHGEANEMSRLKSALIREYEADPDTNIDFYNPRN----TVAVDLYFRGEKMAKVVGNLAME---KPIDDHR---VSGVLVKRNFNYHILAANDLQKYTDMTISTVTQRQSVYYEGSFQ-----LLQFLVSQLSGDL 549          
BLAST of EMLSAG00000000010 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold281_size224178-snap-gene-1.30 (protein:Tk10995 transcript:maker-scaffold281_size224178-snap-gene-1.30-mRNA-1 annotation:"cleavage and polyadenylation specificity factor subunit 2")

HSP 1 Score: 132.109 bits (331), Expect = 1.902e-32
Identity = 115/467 (24.63%), Postives = 203/467 (43.47%), Query Frame = 0
Query:    1 MTEEIRVTPLGAGQDVGRS------CLLVSIGGKNLMLDCGMHMGYNDERRFPDFSFIEDTPGAPLTPHLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLEDMRRVAVERKGESNFFTSAMIKECMKKVVAVHLHQVIRVD---ESLEIKAYYAGHVLGAAMFQ-VKVGNRSIVYTGDYNMTPDRHLGAAWIDKC-RPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYW---DRMNLKVPIFFSTGLTEKATNYYKMFITWTNEKIRKTFVER--NMFDFKFIKPLDRAYIQN--PGPMVVFATPGMLHGGLSLAIFEEWCTNELNMIIMPGYCVAGTVGHKIL-NGTRKLEFSKGKTVEVKMSVQYMSFSAHADAKGIMQLISYCEPKNVMLVHGEQA--KMEFLKAKIESEHGVQCFMPANGET 446
            MT  I+  PL  G     S      C L+ +     + DCG    +       D + + +     +   +DAV++S+  + H G LPY+   +G S PIY T P   +  + + D+ +     + +   FT   + +  + +  +  +Q I++    E + I    AGH++G ++++ VK G   IVY  D+N   ++HL  + I+K  RP L IT+   A+  +  +R R+   +  +   +   G VL+ V   GR  EL  +++  W   D   +   +     ++     + K  I W ++K+ + F  R  N F FK +K        N  P P VV A+   L  G S  +F  WC    N II+      GT+ H ++ NGT ++       +E+K  ++          +   +L S  +   +M+   E +  +ME    K   +H +   + A G+T
Sbjct:   18 MTSIIKFRPLSGGVMPADSDACPPHCYLLEVDQFTFLCDCGWDAQF-------DMNIMNEIKA--VINKIDAVLLSYPDIGHLGGLPYVVSTLGLSCPIYATVPIYKMGQMFMYDLYQARYNME-DFKLFTLDEVDKTFEMITQLKYNQTIQLKGKGEGIAITPIPAGHMIGGSIWKIVKEGEEDIVYAVDFNHKKEQHLNGSDIEKIQRPSLFITDGFNASYRQLRRRDRDEKLMTNILQTLRNNGNVLVCVDTAGRVLELAHMIDHLWQIQDSGLIAYSLALLNNMSFNVIEFAKSQIEWMSDKLMRNFEGRRNNPFQFKHLKLCHSMAEVNKVPSPKVVLASMTDLECGFSRDLFLNWCGKPQNNIIITSRTGEGTLAHDLITNGTNRV-----LNLEIKKRIKLTGAELEEHRRKERELASKSKQSEMMMEDDESSDEEMETGGTKGPIKHDIIMKVNAPGKT 469          
BLAST of EMLSAG00000000010 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold731_size105367-snap-gene-0.13 (protein:Tk04426 transcript:maker-scaffold731_size105367-snap-gene-0.13-mRNA-1 annotation:"integrator complex subunit 9")

HSP 1 Score: 61.2326 bits (147), Expect = 5.169e-10
Identity = 86/424 (20.28%), Postives = 151/424 (35.61%), Query Frame = 0
Query:   17 GRSCLLVSIGGKNLMLDCGMHMGYN----------------------------------DERRFPDFSFIEDTP--GAPLTP-----HLDAVIISHFHLDHCGALPYMTEMVGYSGPIYMTHPTKAIAPILLED-MRRVAVERKGESNF-------------------------FTSAMIKECMKKVVAVHLHQVIRVDESLEIKAYYAGHVLGAAMFQVKVGNRSIVY-TGDYNMTPDRHLGAAWIDKCRPDLLITESTYATTVRDSKRCRERDFLKKVHDCVERGGKVLIPVFALGRAQELCILLETYWDRMNL-KVPIFFSTGLTEKATNYYKMFITW-TNEKIRKTFVE------------------RNMFDFKFIKPLDRAYIQNPGPMVVFATPGMLHGGLSLAIFEEWCTNELNMII 352
             + C ++   G  LMLDCG+ +G                                     E   P+  F++  P  G P T       +D ++IS++      +LPY+TE  G+ G I++T PT     + +E+ +  +    KG+S +                         F    ++ C+ KV  V   +   V   LE+    +G+ LG++ + +      I Y +G   +T   H         R    +  +    T + +      +F K V +   +GG VL+P +  G   +L   L    D   L  +P+FF + + + +  Y  +   W +  K  + ++                   R++ D  F       Y Q   P V+F     L  G  +   E W +N  N I+
Sbjct:   74 NKPCYILHFKGLTLMLDCGLDIGAALNFLPLPLVQSQKLQQLGAYAAKDDQDPAIEGELKEANIPNHVFVDSMPEFGVPDTSMVDMSEVDCILISNYTC--MLSLPYITEETGFKGMIFLTEPTLHFGRMFMEETIEYIERSTKGQSAYRWKDLHQRLPSPLCDADNPQAWRIIFNREKMESCLSKVHMVGYSEKKDVFGLLEVSPVSSGYCLGSSNWIISSPFERIAYISGSSTLT--THPCPMEQAPLRNADCVILTALTQTPQTNADMMIGEFCKTVVETTRQGGNVLVPCYPSGIVYDLFECLAGQMDVSGLSNIPMFFVSPVADSSLAYSNILAEWLSTSKQNRVYIPDEPFPHGSLARSGRLKSFRSLHDENF----SHEYRQ---PCVMFCGHPSLRFGDVIHFIELWGSNPNNTIV 486          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000010 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-0.000e+066.44symbol:IntS11 "Integrator 11" species:7227 "Drosop... [more]
-0.000e+066.39symbol:CPSF3L "Integrator complex subunit 11" spec... [more]
-0.000e+066.22symbol:CPSF3L "Integrator complex subunit 11" spec... [more]
-0.000e+065.33symbol:Cpsf3l "cleavage and polyadenylation specif... [more]
-0.000e+065.33symbol:Cpsf3l "Integrator complex subunit 11" spec... [more]
-0.000e+065.33symbol:Cpsf3l "cleavage and polyadenylation specif... [more]
-0.000e+065.60symbol:CPSF3L "Uncharacterized protein" species:96... [more]
-0.000e+065.27symbol:CPSF3L "Integrator complex subunit 11" spec... [more]
-0.000e+064.93symbol:CPSF3L "Uncharacterized protein" species:98... [more]
-0.000e+064.43symbol:CPSF3L "Integrator complex subunit 11" spec... [more]

Pages

back to top
BLAST of EMLSAG00000000010 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 6
Match NameE-valueIdentityDescription
gi|592769975|gb|GAXK01184593.1|0.000e+070.17TSA: Calanus finmarchicus comp135388_c0_seq1 trans... [more]
gi|592906641|gb|GAXK01051734.1|6.155e-10537.62TSA: Calanus finmarchicus comp29218_c1_seq1 transc... [more]
gi|592908501|gb|GAXK01049874.1|3.063e-3930.10TSA: Calanus finmarchicus comp31353_c1_seq1 transc... [more]
gi|592800312|gb|GAXK01154256.1|3.583e+038.71TSA: Calanus finmarchicus comp7557129_c0_seq1 tran... [more]
gi|592894649|gb|GAXK01063726.1|5.775e+031.25TSA: Calanus finmarchicus comp375224_c1_seq1 trans... [more]
gi|592815984|gb|GAXK01138584.1|7.179e+025.00TSA: Calanus finmarchicus comp102705_c1_seq1 trans... [more]
back to top
BLAST of EMLSAG00000000010 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 4
Match NameE-valueIdentityDescription
EMLSAP000000000100.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1003:5798... [more]
EMLSAP000000072822.394e-10136.31pep:novel supercontig:LSalAtl2s:LSalAtl2s409:12927... [more]
EMLSAP000000118438.427e-3927.18pep:novel supercontig:LSalAtl2s:LSalAtl2s831:28181... [more]
EMLSAP000000113155.482e-721.51pep:novel supercontig:LSalAtl2s:LSalAtl2s77:664263... [more]
back to top
BLAST of EMLSAG00000000010 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|75026622|sp|Q9VAH9.1|INT11_DROME0.000e+066.44RecName: Full=Integrator complex subunit 11[more]
gi|75571225|sp|Q5ZIH0.1|INT11_CHICK0.000e+066.39RecName: Full=Integrator complex subunit 11; Short... [more]
gi|81904239|sp|Q9CWS4.1|INT11_MOUSE0.000e+065.33RecName: Full=Integrator complex subunit 11; Short... [more]
gi|119371245|sp|Q3MHC2.1|INT11_RAT0.000e+065.33RecName: Full=Integrator complex subunit 11; Short... [more]
gi|118572558|sp|Q5NVE6.2|INT11_PONAB0.000e+065.44RecName: Full=Integrator complex subunit 11; Short... [more]
gi|118572557|sp|Q5TA45.2|INT11_HUMAN0.000e+065.27RecName: Full=Integrator complex subunit 11; Short... [more]
gi|82192739|sp|Q503E1.1|INT11_DANRE0.000e+064.55RecName: Full=Integrator complex subunit 11; Short... [more]
gi|118572556|sp|Q2YDM2.2|INT11_BOVIN0.000e+064.43RecName: Full=Integrator complex subunit 11; Short... [more]
gi|74856745|sp|Q54YL3.1|INT11_DICDI0.000e+063.54RecName: Full=Integrator complex subunit 11 homolo... [more]
gi|332278175|sp|Q8GUU3.2|CPS3B_ARATH0.000e+050.57RecName: Full=Cleavage and polyadenylation specifi... [more]

Pages

back to top
BLAST of EMLSAG00000000010 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EAA13845.40.000e+067.43AGAP009923-PA [Anopheles gambiae str. PEST][more]
gb|EFA06334.1|0.000e+067.89Cleavage and polyadenylation specificity factor 73... [more]
XP_016767931.10.000e+067.78PREDICTED: integrator complex subunit 11 [Apis mel... [more]
AAF56931.10.000e+066.44integrator 11 [Drosophila melanogaster][more]
EFX68345.10.000e+066.45hypothetical protein DAPPUDRAFT_218302 [Daphnia pu... [more]
EFX79332.10.000e+066.67hypothetical protein DAPPUDRAFT_304859 [Daphnia pu... [more]
gb|EEC05985.1|0.000e+066.50cleavage and polyadenylation specificity factor, p... [more]
gb|KFM62469.1|0.000e+064.02Integrator complex subunit 11, partial [Stegodyphu... [more]
EEB14934.10.000e+064.27Endoribonuclease YSH1, putative [Pediculus humanus... [more]
gb|KPM11411.1|0.000e+071.10integrator complex subunit 11-like protein [Sarcop... [more]

Pages

back to top
BLAST of EMLSAG00000000010 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|1133438477|ref|XP_019875551.1|0.000e+069.57PREDICTED: LOW QUALITY PROTEIN: integrator complex... [more]
gi|762149648|ref|XP_011412767.1|0.000e+069.62PREDICTED: integrator complex subunit 11-like [Cra... [more]
gi|512914556|ref|XP_004928171.1|0.000e+068.84PREDICTED: integrator complex subunit 11 [Bombyx m... [more]
gi|914569041|gb|KOB72797.1|0.000e+069.35Cleavage and polyadenylation specificity factor [O... [more]
gi|913322587|ref|XP_013192519.1|0.000e+068.95PREDICTED: integrator complex subunit 11 [Amyelois... [more]
gi|646708854|gb|KDR15001.1|0.000e+069.06Integrator complex subunit 11 [Zootermopsis nevade... [more]
gi|943953930|ref|XP_014359882.1|0.000e+069.06PREDICTED: integrator complex subunit 11 [Papilio ... [more]
gi|357624104|gb|EHJ75000.1|0.000e+069.18hypothetical protein KGM_18742 [Danaus plexippus][more]
gi|1069810122|ref|XP_018328877.1|0.000e+068.95PREDICTED: integrator complex subunit 11 [Agrilus ... [more]
gi|768411962|ref|XP_011566586.1|0.000e+067.95PREDICTED: integrator complex subunit 11 [Plutella... [more]

Pages

back to top
BLAST of EMLSAG00000000010 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 4
Match NameE-valueIdentityDescription
maker-scaffold719_size106944-snap-gene-0.300.000e+072.15protein:Tk04736 transcript:maker-scaffold719_size1... [more]
snap_masked-scaffold495_size155559-processed-gene-0.42.345e-10534.78protein:Tk09235 transcript:snap_masked-scaffold495... [more]
maker-scaffold281_size224178-snap-gene-1.301.902e-3224.63protein:Tk10995 transcript:maker-scaffold281_size2... [more]
maker-scaffold731_size105367-snap-gene-0.135.169e-1020.28protein:Tk04426 transcript:maker-scaffold731_size1... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1003supercontigLSalAtl2s1003:5798..7615 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteIntegrator complex subunit 11
Logic nameensemblgenomes
Descriptionaugustus_masked-LSalAtl2s1003-processed-gene-0.0
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000010 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000010EMLSAT00000000010-695857Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1003:5798..7615-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000010-682776 ID=EMLSAG00000000010-682776|Name=EMLSAG00000000010|organism=Lepeophtheirus salmonis|type=gene|length=1818bp|location=Sequence derived from alignment at LSalAtl2s1003:5798..7615- (Lepeophtheirus salmonis)
ATGACGGAAGAGATTCGAGTGACTCCTCTGGGAGCAGGACAAGATGTGGG TCGTAGCTGCCTTCTGGTTTCCATTGGAGGTAAGAATTTGATGCTGGACT GTGGGATGCACATGGGCTACAACGACGAACGGCGCTTTCCGGATTTTTCC TTTATCGAGGATACGCCTGGAGCTCCCCTCACGCCCCACCTGGATGCTGT CATTATTTCCCATTTCCACCTGGACCACTGCGGGGCTCTTCCTTACATGA CGGAAATGGTGGGCTACTCCGGACCCATTTACATGACCCATCCCACCAAA GCCATTGCTCCCATTCTTCTTGAGGACATGAGGCGTGTTGCTGTGGAACG GAAGGGAGAATCCAACTTCTTCACTTCTGCTATGATTAAGGAGTGTATGA AAAAAGTAGTTGCCGTGCATTTGCATCAAGTGATCCGTGTGGATGAGTCC CTAGAAATCAAAGCCTACTATGCTGGACATGTGCTAGGAGCAGCAATGTT CCAAGTCAAGGTTGGAAACCGCTCCATCGTATATACAGGGGACTATAATA TGACTCCAGATCGGCATCTAGGAGCAGCTTGGATTGATAAGTGTCGACCA GATTTACTTATTACTGAAAGCACATATGCTACTACGGTTCGGGACTCTAA ACGTTGTCGTGAAAGAGATTTTTTAAAAAAAGTTCATGATTGTGTTGAAA GAGGTGGTAAAGTCCTTATTCCTGTTTTTGCCCTTGGAAGGGCACAAGAA CTTTGTATTTTACTTGAAACCTATTGGGATCGAATGAATCTAAAGGTTCC TATATTTTTTTCAACGGGTCTTACAGAAAAAGCAACCAACTATTATAAAA TGTTTATAACGTGGACAAACGAGAAGATAAGAAAAACCTTTGTTGAGAGA AATATGTTTGATTTCAAGTTCATCAAACCATTAGACAGGGCGTATATTCA AAACCCAGGTCCTATGGTTGTATTTGCCACACCTGGTATGTTGCATGGAG GACTCAGTTTAGCCATTTTTGAAGAATGGTGTACCAATGAACTCAATATG ATAATTATGCCTGGCTACTGTGTTGCTGGAACAGTGGGACATAAGATTCT TAACGGCACTCGCAAGTTGGAGTTTTCAAAAGGAAAAACTGTTGAAGTCA AAATGAGTGTTCAATACATGAGTTTTAGTGCTCATGCTGACGCCAAAGGT ATAATGCAACTCATATCATATTGTGAACCTAAAAATGTGATGCTTGTTCA CGGGGAACAAGCAAAAATGGAATTTTTGAAAGCTAAAATCGAATCAGAGC ATGGTGTACAGTGTTTTATGCCCGCAAATGGGGAAACAGCTACCATTTCT TGCCCAATCACCCTTGAAGGCTGTGTTTCTTCATCCATTATTAAAAAAGA ACATTTGAAATATGCTCTTAAACCTCCAGATCCCAAGCGAGCCCGGCTAC TTCACGGTGTTATTGTCATGAAGGATGAAACCTTATCTATCCTTGATCCA GAAAAAATAGCTGAAGAGTTTGGTATTCAGTCACATACCATTCGATATAC ACTAAATGTTCCATTCAGAAATGAAGTCCAATCACCTCTCTCGGCTGTAG CTCAAAAACTTTACAATGCTATTTCTCGCGATCTTCCTGACGATTTTTCT ATATCACTCTCTGACAAAGAAATATTTATATCTGAAACTGTAATCTGTAA GATCGAGAATGATGAGGGCAAAGTTGTGTCAAATGTTTCATTTTGCCATC AGGATGAACAGTTGGGGGAATTTGTTTTAAACATCGTGAGAAGTATCGCT GATAAATTCAAAGATTAA
back to top
Add to Basket