EMLSAG00000000015, EMLSAG00000000015-682781 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000015
Unique NameEMLSAG00000000015-682781
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:MEF2D "Myocyte-specific enhancer factor 2D" species:9606 "Homo sapiens" [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IEA] [GO:0046983 "protein dimerization activity" evidence=IEA] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 GO:GO:0005634 GO:GO:0006355 GO:GO:0003677 GO:GO:0006351 SUPFAM:SSF55455 EMBL:AL365181 HOGENOM:HOG000230620 EMBL:AL139412 UniGene:Hs.314327 UniGene:Hs.744524 HGNC:HGNC:6997 ChiTaRS:MEF2D EMBL:BC032479 ProteinModelPortal:Q05BX2 Ensembl:ENST00000475587 Uniprot:Q05BX2)

HSP 1 Score: 185.652 bits (470), Expect = 9.060e-56
Identity = 88/125 (70.40%), Postives = 102/125 (81.60%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPEND 125
            MGRKKIQI RI+DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFN  NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG  G DSPE D +  L  SP   +  +  + E D
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELD 125          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:Mef2 "Myocyte enhancer factor 2" species:7227 "Drosophila melanogaster" [GO:0007519 "skeletal muscle tissue development" evidence=IMP] [GO:0005634 "nucleus" evidence=ISS;NAS;IDA] [GO:0007498 "mesoderm development" evidence=IEP;IMP] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISS] [GO:0016202 "regulation of striated muscle tissue development" evidence=TAS] [GO:0006355 "regulation of transcription, DNA-templated" evidence=NAS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS] [GO:0030707 "ovarian follicle cell development" evidence=TAS] [GO:0007507 "heart development" evidence=TAS] [GO:0007517 "muscle organ development" evidence=IMP] [GO:0003677 "DNA binding" evidence=IDA] [GO:0046983 "protein dimerization activity" evidence=IEA] [GO:0007520 "myoblast fusion" evidence=IMP] [GO:0048747 "muscle fiber development" evidence=IMP] [GO:0007496 "anterior midgut development" evidence=IMP] [GO:0010468 "regulation of gene expression" evidence=IMP] [GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IDA] [GO:0032968 "positive regulation of transcription elongation from RNA polymerase II promoter" evidence=IDA] [GO:0045475 "locomotor rhythm" evidence=IMP] [GO:0019915 "lipid storage" evidence=IMP] [GO:0052576 "carbohydrate storage" evidence=IMP] [GO:0019730 "antimicrobial humoral response" evidence=IMP] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 EMBL:AE013599 GO:GO:0005634 GO:GO:0007507 GO:GO:0007498 GO:GO:0003677 GO:GO:0030707 GO:GO:0001077 GO:GO:0019915 GO:GO:0048747 GO:GO:0007520 GO:GO:0045475 eggNOG:COG5068 SUPFAM:SSF55455 GO:GO:0019730 GO:GO:0032968 GO:GO:0007519 GO:GO:0016202 GO:GO:0052576 InterPro:IPR022102 Pfam:PF12347 GeneTree:ENSGT00390000011828 EMBL:U03292 EMBL:U07422 EMBL:X83527 EMBL:U19493 EMBL:AY061096 EMBL:AY061589 EMBL:AY118311 RefSeq:NP_477018.1 RefSeq:NP_477019.1 RefSeq:NP_477020.1 RefSeq:NP_477021.1 RefSeq:NP_995789.1 UniGene:Dm.7054 ProteinModelPortal:P40791 SMR:P40791 BioGrid:61860 IntAct:P40791 MINT:MINT-994108 STRING:7227.FBpp0087529 PaxDb:P40791 EnsemblMetazoa:FBtr0088443 GeneID:36032 KEGG:dme:Dmel_CG1429 CTD:36032 FlyBase:FBgn0011656 HOGENOM:HOG000263901 InParanoid:Q95RW1 KO:K09263 OrthoDB:EOG7CRTQ1 PhylomeDB:P40791 SignaLink:P40791 GenomeRNAi:36032 NextBio:796455 PRO:PR:P40791 Bgee:P40791 GO:GO:0007496 Uniprot:P40791)

HSP 1 Score: 194.512 bits (493), Expect = 6.971e-55
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:MEF2D "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IEA] [GO:0046983 "protein dimerization activity" evidence=IEA] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 GO:GO:0005634 GO:GO:0045944 GO:GO:0000981 GO:GO:0000977 GO:GO:0007512 SUPFAM:SSF55455 InterPro:IPR022102 Pfam:PF12347 GeneTree:ENSGT00390000011828 OrthoDB:EOG793B7D TreeFam:TF314067 EMBL:AADN03008416 Ensembl:ENSGALT00000023483 ArrayExpress:H9L0K8 Uniprot:H9L0K8)

HSP 1 Score: 190.274 bits (482), Expect = 1.334e-54
Identity = 88/119 (73.95%), Postives = 102/119 (85.71%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQD 119
            MGRKKIQI RI+DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFN  NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG  G DSPE D D  ++ SP    +M+D
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGDDSIDQSP----LMED 115          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:MEF2A "Myocyte-specific enhancer factor 2A" species:9913 "Bos taurus" [GO:0000002 "mitochondrial genome maintenance" evidence=ISS] [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=ISS] [GO:0000165 "MAPK cascade" evidence=ISS] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=ISS] [GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS] [GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IEA] [GO:0001085 "RNA polymerase II transcription factor binding" evidence=IEA] [GO:0001105 "RNA polymerase II transcription coactivator activity" evidence=IEA] [GO:0003682 "chromatin binding" evidence=ISS] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0005634 "nucleus" evidence=ISS] [GO:0006915 "apoptotic process" evidence=IEA] [GO:0019901 "protein kinase binding" evidence=IEA] [GO:0033613 "activating transcription factor binding" evidence=ISS] [GO:0035035 "histone acetyltransferase binding" evidence=ISS] [GO:0042826 "histone deacetylase binding" evidence=ISS] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISS] [GO:0046332 "SMAD binding" evidence=ISS] [GO:0046982 "protein heterodimerization activity" evidence=IEA] [GO:0048311 "mitochondrion distribution" evidence=ISS] [GO:0048813 "dendrite morphogenesis" evidence=ISS] [GO:0055005 "ventricular cardiac myofibril assembly" evidence=ISS] [GO:0061337 "cardiac conduction" evidence=ISS] [GO:0070375 "ERK5 cascade" evidence=ISS] [GO:0071277 "cellular response to calcium ion" evidence=ISS] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 GO:GO:0005634 GO:GO:0006915 GO:GO:0045944 GO:GO:0003682 GO:GO:0003705 GO:GO:0001077 GO:GO:0000122 GO:GO:0000790 GO:GO:0048813 GO:GO:0000981 GO:GO:0071277 GO:GO:0000002 GO:GO:0000977 GO:GO:0046332 eggNOG:COG5068 SUPFAM:SSF55455 GO:GO:0001105 GO:GO:0042826 GO:GO:0035035 GO:GO:0048311 GO:GO:0061337 GO:GO:0033613 InterPro:IPR022102 Pfam:PF12347 EMBL:BC133487 RefSeq:NP_001077107.1 UniGene:Bt.25066 ProteinModelPortal:A2VDZ3 SMR:A2VDZ3 Ensembl:ENSBTAT00000014074 GeneID:407231 KEGG:bta:407231 CTD:4205 GeneTree:ENSGT00390000011828 HOVERGEN:HBG053944 InParanoid:A2VDZ3 KO:K09260 OMA:RMDTWVT OrthoDB:EOG793B7D TreeFam:TF314067 NextBio:20818481 ArrayExpress:A2VDZ3 GO:GO:0070375 GO:GO:0055005 Uniprot:A2VDZ3)

HSP 1 Score: 191.815 bits (486), Expect = 2.879e-54
Identity = 107/176 (60.80%), Postives = 128/176 (72.73%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+   VT    + SA +Y N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPSALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:MEF2C "Myocyte-specific enhancer factor 2C" species:9606 "Homo sapiens" [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IEA] [GO:0046983 "protein dimerization activity" evidence=IEA] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 GO:GO:0005634 GO:GO:0006355 GO:GO:0003677 GO:GO:0006351 SUPFAM:SSF55455 InterPro:IPR022102 Pfam:PF12347 HOGENOM:HOG000230620 EMBL:AC008525 EMBL:AC008835 HGNC:HGNC:6996 ChiTaRS:MEF2C ProteinModelPortal:D6R942 SMR:D6R942 Ensembl:ENST00000506716 NextBio:35492831 ArrayExpress:D6R942 Bgee:D6R942 Uniprot:D6R942)

HSP 1 Score: 183.726 bits (465), Expect = 6.001e-54
Identity = 89/131 (67.94%), Postives = 104/131 (79.39%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQ 131
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G +SP+ D  Y L     P    +      +F NM++
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENKGCESPDPDSSYALT----PRTEEKYKKINEEFDNMIK 127          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:Mef2a "Myocyte-specific enhancer factor 2A" species:10116 "Rattus norvegicus" [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=ISS] [GO:0000165 "MAPK cascade" evidence=ISS] [GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=ISS] [GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IDA] [GO:0003682 "chromatin binding" evidence=ISS] [GO:0005634 "nucleus" evidence=ISS;IDA] [GO:0005654 "nucleoplasm" evidence=TAS] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=IDA] [GO:0006915 "apoptotic process" evidence=IEA] [GO:0033613 "activating transcription factor binding" evidence=ISS] [GO:0035035 "histone acetyltransferase binding" evidence=ISS] [GO:0042826 "histone deacetylase binding" evidence=ISS] [GO:0043565 "sequence-specific DNA binding" evidence=IDA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IMP] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA] [GO:0046332 "SMAD binding" evidence=ISS] [GO:0046983 "protein dimerization activity" evidence=IEA] [GO:0048813 "dendrite morphogenesis" evidence=IMP] [GO:0070375 "ERK5 cascade" evidence=ISS] [GO:0071277 "cellular response to calcium ion" evidence=IDA] Reactome:REACT_109458 InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 RGD:1359360 GO:GO:0005654 GO:GO:0006915 GO:GO:0071333 GO:GO:0045944 GO:GO:0003682 GO:GO:0000122 GO:GO:0048813 GO:GO:0000981 GO:GO:0071277 GO:GO:0000977 GO:GO:0046332 SUPFAM:SSF55455 GO:GO:0042826 GO:GO:0035035 GO:GO:0033613 InterPro:IPR022102 Pfam:PF12347 CTD:4205 GeneTree:ENSGT00390000011828 HOVERGEN:HBG053944 KO:K09260 GO:GO:0070375 EMBL:DQ323505 EMBL:BC081907 RefSeq:NP_001014057.1 RefSeq:XP_006229403.1 UniGene:Rn.162435 ProteinModelPortal:Q2MJT0 SMR:Q2MJT0 MINT:MINT-1346606 PhosphoSite:Q2MJT0 PRIDE:Q2MJT0 Ensembl:ENSRNOT00000072915 GeneID:309957 KEGG:rno:309957 NextBio:661512 PRO:PR:Q2MJT0 Genevestigator:Q2MJT0 Uniprot:Q2MJT0)

HSP 1 Score: 191.045 bits (484), Expect = 6.587e-54
Identity = 103/176 (58.52%), Postives = 126/176 (71.59%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-------VTGNHSATTYDNGSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+       VT  ++ +  + GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:Mef2a "myocyte enhancer factor 2a" species:10116 "Rattus norvegicus" [GO:0000002 "mitochondrial genome maintenance" evidence=IEA;ISO] [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA;ISO;ISS] [GO:0000165 "MAPK cascade" evidence=ISO;ISS] [GO:0000790 "nuclear chromatin" evidence=IEA;ISO] [GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=ISO;ISS] [GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISO;IDA] [GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IEA;ISO] [GO:0001085 "RNA polymerase II transcription factor binding" evidence=IEA;ISO] [GO:0001105 "RNA polymerase II transcription coactivator activity" evidence=IEA;ISO] [GO:0003677 "DNA binding" evidence=ISO] [GO:0003682 "chromatin binding" evidence=IEA;ISO;ISS] [GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISO] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA;ISO] [GO:0005634 "nucleus" evidence=ISO;ISS;IDA] [GO:0005654 "nucleoplasm" evidence=TAS] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0006351 "transcription, DNA-templated" evidence=ISO] [GO:0006355 "regulation of transcription, DNA-templated" evidence=ISO] [GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISO;IDA] [GO:0006915 "apoptotic process" evidence=IEA] [GO:0007507 "heart development" evidence=ISO] [GO:0019901 "protein kinase binding" evidence=IEA;ISO] [GO:0033613 "activating transcription factor binding" evidence=IEA;ISO;ISS] [GO:0035035 "histone acetyltransferase binding" evidence=IEA;ISO;ISS] [GO:0042826 "histone deacetylase binding" evidence=ISO;ISS] [GO:0043565 "sequence-specific DNA binding" evidence=IEA;ISO;IDA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=ISO;IMP] [GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=ISO;IDA] [GO:0046332 "SMAD binding" evidence=IEA;ISO;ISS] [GO:0046982 "protein heterodimerization activity" evidence=IEA;ISO] [GO:0046983 "protein dimerization activity" evidence=IEA] [GO:0048311 "mitochondrion distribution" evidence=IEA;ISO] [GO:0048813 "dendrite morphogenesis" evidence=IMP] [GO:0055005 "ventricular cardiac myofibril assembly" evidence=IEA;ISO] [GO:0061337 "cardiac conduction" evidence=IEA;ISO] [GO:0070375 "ERK5 cascade" evidence=IEA;ISO;ISS] [GO:0071277 "cellular response to calcium ion" evidence=ISO;IDA] [GO:0071333 "cellular response to glucose stimulus" evidence=IEP] [GO:0005730 "nucleolus" evidence=ISO] Reactome:REACT_109458 InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 RGD:1359360 GO:GO:0005654 GO:GO:0006915 GO:GO:0071333 GO:GO:0045944 GO:GO:0003682 GO:GO:0000122 GO:GO:0048813 GO:GO:0000981 GO:GO:0071277 GO:GO:0000977 GO:GO:0046332 SUPFAM:SSF55455 GO:GO:0042826 GO:GO:0035035 GO:GO:0033613 InterPro:IPR022102 Pfam:PF12347 CTD:4205 GeneTree:ENSGT00390000011828 HOVERGEN:HBG053944 KO:K09260 GO:GO:0070375 EMBL:DQ323505 EMBL:BC081907 RefSeq:NP_001014057.1 RefSeq:XP_006229403.1 UniGene:Rn.162435 ProteinModelPortal:Q2MJT0 SMR:Q2MJT0 MINT:MINT-1346606 PhosphoSite:Q2MJT0 PRIDE:Q2MJT0 Ensembl:ENSRNOT00000072915 GeneID:309957 KEGG:rno:309957 NextBio:661512 PRO:PR:Q2MJT0 Genevestigator:Q2MJT0 Uniprot:Q2MJT0)

HSP 1 Score: 191.045 bits (484), Expect = 6.587e-54
Identity = 103/176 (58.52%), Postives = 126/176 (71.59%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-------VTGNHSATTYDNGSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+       VT  ++ +  + GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:Mef2a "Myocyte-specific enhancer factor 2A" species:10116 "Rattus norvegicus" [GO:0000002 "mitochondrial genome maintenance" evidence=IEA] [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IEA] [GO:0001085 "RNA polymerase II transcription factor binding" evidence=IEA] [GO:0001105 "RNA polymerase II transcription coactivator activity" evidence=IEA] [GO:0003682 "chromatin binding" evidence=IEA] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0019901 "protein kinase binding" evidence=IEA] [GO:0033613 "activating transcription factor binding" evidence=IEA] [GO:0035035 "histone acetyltransferase binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0046332 "SMAD binding" evidence=IEA] [GO:0046982 "protein heterodimerization activity" evidence=IEA] [GO:0048311 "mitochondrion distribution" evidence=IEA] [GO:0055005 "ventricular cardiac myofibril assembly" evidence=IEA] [GO:0061337 "cardiac conduction" evidence=IEA] [GO:0070375 "ERK5 cascade" evidence=IEA] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 RGD:1359360 GO:GO:0043565 GO:GO:0003682 GO:GO:0003705 GO:GO:0001077 GO:GO:0000122 GO:GO:0000790 GO:GO:0000002 SUPFAM:SSF55455 GO:GO:0001105 GO:GO:0048311 GO:GO:0061337 InterPro:IPR022102 Pfam:PF12347 GeneTree:ENSGT00390000011828 OMA:RMDTWVT OrthoDB:EOG793B7D GO:GO:0070375 GO:GO:0055005 EMBL:AABR06006109 EMBL:AABR06006110 EMBL:AABR06006111 EMBL:AABR06006112 EMBL:AABR06006113 EMBL:AABR06006114 Ensembl:ENSRNOT00000070864 Uniprot:M0R6R7)

HSP 1 Score: 191.045 bits (484), Expect = 6.917e-54
Identity = 103/176 (58.52%), Postives = 126/176 (71.59%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-------VTGNHSATTYDNGSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+       VT  ++ +  + GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:MEF2C "Myocyte-specific enhancer factor 2C" species:9606 "Homo sapiens" [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0006351 "transcription, DNA-templated" evidence=IEA] [GO:0006355 "regulation of transcription, DNA-templated" evidence=IEA] [GO:0046983 "protein dimerization activity" evidence=IEA] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 GO:GO:0005634 GO:GO:0006355 GO:GO:0003677 GO:GO:0006351 SUPFAM:SSF55455 InterPro:IPR022102 Pfam:PF12347 HOGENOM:HOG000230620 EMBL:AC008525 EMBL:AC008835 HGNC:HGNC:6996 ChiTaRS:MEF2C ProteinModelPortal:D6RC63 SMR:D6RC63 Ensembl:ENST00000513252 NextBio:35493763 ArrayExpress:D6RC63 Bgee:D6RC63 Uniprot:D6RC63)

HSP 1 Score: 184.111 bits (466), Expect = 7.305e-54
Identity = 85/107 (79.44%), Postives = 96/107 (89.72%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPL 107
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G +SP+ D  Y L
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKENKGCESPDPDSSYAL 107          
BLAST of EMLSAG00000000015 vs. GO
Match: - (symbol:MEF2A "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0000002 "mitochondrial genome maintenance" evidence=IEA] [GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA] [GO:0000790 "nuclear chromatin" evidence=IEA] [GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IEA] [GO:0001085 "RNA polymerase II transcription factor binding" evidence=IEA] [GO:0001105 "RNA polymerase II transcription coactivator activity" evidence=IEA] [GO:0003682 "chromatin binding" evidence=IEA] [GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IEA] [GO:0019901 "protein kinase binding" evidence=IEA] [GO:0033613 "activating transcription factor binding" evidence=IEA] [GO:0035035 "histone acetyltransferase binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding" evidence=IEA] [GO:0046332 "SMAD binding" evidence=IEA] [GO:0046982 "protein heterodimerization activity" evidence=IEA] [GO:0048311 "mitochondrion distribution" evidence=IEA] [GO:0055005 "ventricular cardiac myofibril assembly" evidence=IEA] [GO:0061337 "cardiac conduction" evidence=IEA] [GO:0070375 "ERK5 cascade" evidence=IEA] InterPro:IPR002100 Pfam:PF00319 PRINTS:PR00404 PROSITE:PS00350 PROSITE:PS50066 SMART:SM00432 GO:GO:0043565 GO:GO:0003682 GO:GO:0003705 GO:GO:0001077 GO:GO:0000122 GO:GO:0000790 GO:GO:0000002 SUPFAM:SSF55455 GO:GO:0001105 GO:GO:0048311 GO:GO:0061337 InterPro:IPR022102 Pfam:PF12347 GeneTree:ENSGT00390000011828 OMA:RMDTWVT TreeFam:TF314067 GO:GO:0070375 GO:GO:0055005 EMBL:AAEX03002251 ProteinModelPortal:F6XZU9 Ensembl:ENSCAFT00000017166 Uniprot:F6XZU9)

HSP 1 Score: 190.66 bits (483), Expect = 7.494e-54
Identity = 103/176 (58.52%), Postives = 126/176 (71.59%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-------VTGNHSATTYDNGSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+       VT  ++ +  + GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592871805|gb|GAXK01085757.1| (TSA: Calanus finmarchicus comp78922_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 208.379 bits (529), Expect = 3.066e-59
Identity = 101/125 (80.80%), Postives = 108/125 (86.40%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPEND 125
            MGRKKI I RISDERNRQVTFTKRKFGLMKKAYELSVLCDCEI+VIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESI+RKG+GGPDSPE +  Y + D         D++P ND
Sbjct:  452 MGRKKISIQRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESIHRKGMGGPDSPEHEDTYHIGDD--------DHSPRND 802          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592757359|gb|GAXK01197054.1| (TSA: Calanus finmarchicus comp1123791_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 200.675 bits (509), Expect = 3.167e-56
Identity = 93/105 (88.57%), Postives = 98/105 (93.33%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDY 105
            MGRKKI I RISDERNRQVTFTKRKFGLMKKAYELSVLCDCEI+VIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTN DILE+I+RKG+ GPDSP+ D  Y
Sbjct:  146 MGRKKISIARISDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNSDILETIHRKGLAGPDSPDLDDTY 460          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592772973|gb|GAXK01181595.1| (TSA: Calanus finmarchicus comp128420_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 169.474 bits (428), Expect = 5.316e-45
Identity = 79/103 (76.70%), Postives = 94/103 (91.26%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK-GIGGPDSPEGD 102
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMDKVLLKYTEY++PHES TNK+I++++N+K   GG  SP GD
Sbjct:  383 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDKVLLKYTEYNEPHESLTNKNIIDALNKKESKGGLGSPCGD 691          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592772974|gb|GAXK01181594.1| (TSA: Calanus finmarchicus comp128420_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 169.474 bits (428), Expect = 5.359e-45
Identity = 79/103 (76.70%), Postives = 94/103 (91.26%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK-GIGGPDSPEGD 102
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMDKVLLKYTEY++PHES TNK+I++++N+K   GG  SP GD
Sbjct:  383 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDKVLLKYTEYNEPHESLTNKNIIDALNKKESKGGLGSPCGD 691          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592772975|gb|GAXK01181593.1| (TSA: Calanus finmarchicus comp128420_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 169.474 bits (428), Expect = 5.413e-45
Identity = 79/103 (76.70%), Postives = 94/103 (91.26%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK-GIGGPDSPEGD 102
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMDKVLLKYTEY++PHES TNK+I++++N+K   GG  SP GD
Sbjct:  383 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDKVLLKYTEYNEPHESLTNKNIIDALNKKESKGGLGSPCGD 691          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592772976|gb|GAXK01181592.1| (TSA: Calanus finmarchicus comp128420_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 169.474 bits (428), Expect = 5.456e-45
Identity = 79/103 (76.70%), Postives = 94/103 (91.26%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK-GIGGPDSPEGD 102
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMDKVLLKYTEY++PHES TNK+I++++N+K   GG  SP GD
Sbjct:  383 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDKVLLKYTEYNEPHESLTNKNIIDALNKKESKGGLGSPCGD 691          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592893183|gb|GAXK01065192.1| (TSA: Calanus finmarchicus comp2229642_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 70.8626 bits (172), Expect = 3.157e-13
Identity = 36/84 (42.86%), Postives = 54/84 (64.29%), Query Frame = 0
Query:    6 IQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVI------IFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKD 83
            ++I RIS +R RQ TF KRK GL+KKA EL+VLCDC+I++I      I     K+  Y++ D+D ++ +Y   + P E+ TN +
Sbjct:  416 VKIERISGDRTRQNTFHKRKLGLIKKAIELTVLCDCDIAIIMRSGPTIMCPEGKMSAYSNKDLDSLISQYM-AEPPIETYTNAE 664          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592893184|gb|GAXK01065191.1| (TSA: Calanus finmarchicus comp2229642_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 71.633 bits (174), Expect = 5.342e-13
Identity = 36/84 (42.86%), Postives = 53/84 (63.10%), Query Frame = 0
Query:    6 IQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVI------IFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKD 83
            ++I RIS +R RQ TF KRK GL+KKA EL+VLCDC+I++I      I     K+  Y++ D+D ++ +Y   + P E  TN +
Sbjct:  674 VKIERISGDRTRQNTFHKRKLGLIKKAIELTVLCDCDIAIIMRSGPTIMCPEGKMSAYSNKDLDAMIAEYM-TEPPQEHYTNAE 922          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592769620|gb|GAXK01184948.1| (TSA: Calanus finmarchicus comp6434714_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 56.6102 bits (135), Expect = 4.875e-9
Identity = 32/89 (35.96%), Postives = 54/89 (60.67%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNS------HNKLFQYASTDMDKVLLKYTEYDQPHESQTNKD 83
            M   K++I RI+ +R+RQ TF KRK GL+KKA EL+VL DC+ ++I+ ++        +   Y + D+ +++ +Y   + P E  TN +
Sbjct:   63 MPPTKVKIERIAGDRSRQNTFHKRKLGLIKKAIELTVLTDCDCAIILRSAPTVMCPEGRFSAYCNKDLHELIGQYMT-EPPSEYYTNAE 326          
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Match: gi|592817228|gb|GAXK01137340.1| (TSA: Calanus finmarchicus comp164293_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 54.299 bits (129), Expect = 3.513e-7
Identity = 22/65 (33.85%), Postives = 41/65 (63.08%), Query Frame = 0
Query:    2 GRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVL 66
            GR KI++  I ++  R  TF+KRK G+MKKAYELS L   ++ +++ +    ++ +A+  +  ++
Sbjct:  801 GRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 995          
BLAST of EMLSAG00000000015 vs. L. salmonis peptides
Match: EMLSAP00000000015 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:5890:19048:1 gene:EMLSAG00000000015 transcript:EMLSAT00000000015 description:"maker-LSalAtl2s1004-snap-gene-0.21")

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNYVTGNHSATTYDNGSSLVHHMHQPQTTTALMTQQQQSQQQQQQQSNNSLIRMLEMGNGNFINQQPSPIPIHQPNGNNKATNNEQQPSSSSPDSLNSSSSPPNDKDILNLHHXRPIHNIQSGLFGSMNTPSSAPPPQMFNPFQQTTNTTDFTNLTDLRIAHPAISQWLQQAGSVHPPGPNPPGSRSPIKEEPMSPNRGSPNSGGSSDYAPL 361
            MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNYVTGNHSATTYDNGSSLVHHMHQPQTTTALMTQQQQSQQQQQQQSNNSLIRMLEMGNGNFINQQPSPIPIHQPNGNNKATNNEQQPSSSSPDSLNSSSSPPNDKDILNLHHXRPIHNIQSGLFGSMNTPSSAPPPQMFNPFQQTTNTTDFTNLTDLRIAHPAISQWLQQAGSVHPPGPNPPGSRSPIKEEPMSPNRGSPNSGGSSDYAPL
Sbjct:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNYVTGNHSATTYDNGSSLVHHMHQPQTTTALMTQQQQSQQQQQQQSNNSLIRMLEMGNGNFINQQPSPIPIHQPNGNNKATNNEQQPSSSSPDSLNSSSSPPNDKDILNLHHXRPIHNIQSGLFGSMNTPSSAPPPQMFNPFQQTTNTTDFTNLTDLRIAHPAISQWLQQAGSVHPPGPNPPGSRSPIKEEPMSPNRGSPNSGGSSDYAPL 361          
BLAST of EMLSAG00000000015 vs. L. salmonis peptides
Match: EMLSAP00000008484 (pep:novel supercontig:LSalAtl2s:LSalAtl2s51:944140:953887:-1 gene:EMLSAG00000008484 transcript:EMLSAT00000008484 description:"maker-LSalAtl2s51-snap-gene-10.7")

HSP 1 Score: 76.6406 bits (187), Expect = 7.679e-16
Identity = 33/39 (84.62%), Postives = 36/39 (92.31%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLC 39
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELS L 
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSSLS 39          
BLAST of EMLSAG00000000015 vs. L. salmonis peptides
Match: EMLSAP00000002665 (pep:novel supercontig:LSalAtl2s:LSalAtl2s153:855176:863745:1 gene:EMLSAG00000002665 transcript:EMLSAT00000002665 description:"maker-LSalAtl2s153-augustus-gene-8.12")

HSP 1 Score: 54.6842 bits (130), Expect = 1.425e-8
Identity = 22/61 (36.07%), Postives = 39/61 (63.93%), Query Frame = 0
Query:    2 GRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDM 62
            GR KI++  I ++  R  TF+KRK G+MKKAYELS L   ++ +++ +    ++ +A+  +
Sbjct:  146 GRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKL 206          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|353526326|sp|P40791.3|MEF2_DROME (RecName: Full=Myocyte-specific enhancer factor 2; Short=D-mef2; AltName: Full=MADS domain transcription factor)

HSP 1 Score: 194.512 bits (493), Expect = 5.116e-56
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|238685487|sp|A2VDZ3.1|MEF2A_BOVIN (RecName: Full=Myocyte-specific enhancer factor 2A)

HSP 1 Score: 191.815 bits (486), Expect = 1.947e-55
Identity = 107/176 (60.80%), Postives = 128/176 (72.73%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+   VT    + SA +Y N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPSALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|123779534|sp|Q2MJT0.1|MEF2A_RAT (RecName: Full=Myocyte-specific enhancer factor 2A)

HSP 1 Score: 191.045 bits (484), Expect = 4.551e-55
Identity = 103/176 (58.52%), Postives = 126/176 (71.59%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-------VTGNHSATTYDNGSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+       VT  ++ +  + GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|1170908|sp|Q02078.1|MEF2A_HUMAN (RecName: Full=Myocyte-specific enhancer factor 2A; AltName: Full=Serum response factor-like protein 1)

HSP 1 Score: 191.045 bits (484), Expect = 5.794e-55
Identity = 103/176 (58.52%), Postives = 126/176 (71.59%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-------VTGNHSATTYDNGSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+       VT  ++ +  + GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|2500878|sp|Q03413.1|MEF2D_XENLA (RecName: Full=Myocyte-specific enhancer factor 2D homolog; AltName: Full=Serum response factor-like protein 1; Short=SL-1)

HSP 1 Score: 190.274 bits (482), Expect = 9.077e-55
Identity = 88/119 (73.95%), Postives = 102/119 (85.71%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQD 119
            MGRKKIQI RI+DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFN  NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG  G DSPE D D  ++ SP    +M+D
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGDDSIDQSP----LMED 115          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|229484897|sp|A2ICN5.2|MEF2A_PIG (RecName: Full=Myocyte-specific enhancer factor 2A)

HSP 1 Score: 189.889 bits (481), Expect = 1.427e-54
Identity = 103/176 (58.52%), Postives = 125/176 (71.02%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-------VTGNHSATTYDNGSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES TN DI+E++N+K   G DSP+ D  Y L     P+   +      +F NM+     RN+++   + GL  QN+       VT  ++ +  + GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESGTNSDIVEALNKKEHRGCDSPDPDTSYVLT----PHTEEKYKKINEEFDNMM-----RNHKI---APGLPPQNFSMSVTVPVTSPNALSYTNPGSSLV 164          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|148886628|sp|Q60929.2|MEF2A_MOUSE (RecName: Full=Myocyte-specific enhancer factor 2A)

HSP 1 Score: 189.119 bits (479), Expect = 2.078e-54
Identity = 85/105 (80.95%), Postives = 97/105 (92.38%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDY 105
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DY 104          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|75062031|sp|Q5REW7.1|MEF2A_PONAB (RecName: Full=Myocyte-specific enhancer factor 2A)

HSP 1 Score: 189.119 bits (479), Expect = 2.340e-54
Identity = 85/105 (80.95%), Postives = 97/105 (92.38%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDY 105
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DY 104          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|82224805|sp|Q9W6U8.1|MEF2A_CHICK (RecName: Full=Myocyte-specific enhancer factor 2A)

HSP 1 Score: 188.348 bits (477), Expect = 5.276e-54
Identity = 85/105 (80.95%), Postives = 97/105 (92.38%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDY 105
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DY 104          
BLAST of EMLSAG00000000015 vs. SwissProt
Match: gi|81886909|sp|O89038.1|MEF2D_RAT (RecName: Full=Myocyte-specific enhancer factor 2D)

HSP 1 Score: 187.963 bits (476), Expect = 7.696e-54
Identity = 86/111 (77.48%), Postives = 97/111 (87.39%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSP 111
            MGRKKIQI RI+DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFN  NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG  G DSPE D +  L  SP
Sbjct:    1 MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSP 111          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: AAM71042.1 (myocyte enhancer factor 2, isoform B [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 8.438e-57
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: AAS64881.1 (myocyte enhancer factor 2, isoform F [Drosophila melanogaster])

HSP 1 Score: 194.512 bits (493), Expect = 9.720e-57
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: AAM71043.1 (myocyte enhancer factor 2, isoform C [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 1.035e-56
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: AAF58872.1 (myocyte enhancer factor 2, isoform A [Drosophila melanogaster])

HSP 1 Score: 194.897 bits (494), Expect = 1.149e-56
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: AGB93374.1 (myocyte enhancer factor 2, isoform G [Drosophila melanogaster])

HSP 1 Score: 194.126 bits (492), Expect = 1.666e-56
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: AAM71044.1 (myocyte enhancer factor 2, isoform D [Drosophila melanogaster])

HSP 1 Score: 194.512 bits (493), Expect = 2.480e-56
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: gb|KFM79371.1| (Myocyte-specific enhancer factor 2A, partial [Stegodyphus mimosarum])

HSP 1 Score: 188.348 bits (477), Expect = 5.682e-56
Identity = 95/145 (65.52%), Postives = 112/145 (77.24%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK----GIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLN 141
            MGRKKIQI+RI+DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++++K       G DSPE D +Y L     P    + N    +F+ M+Q    RN QLN
Sbjct:    1 MGRKKIQISRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALSKKEHKNSTNGCDSPEPDQEYALT----PRTESKYNKINEEFEMMMQ----RNVQLN 137          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: AGB93375.1 (myocyte enhancer factor 2, isoform H [Drosophila melanogaster])

HSP 1 Score: 194.512 bits (493), Expect = 7.960e-56
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: gb|EFA11312.2| (Myocyte-specific enhancer factor 2-like Protein [Tribolium castaneum])

HSP 1 Score: 189.119 bits (479), Expect = 2.334e-55
Identity = 93/156 (59.62%), Postives = 118/156 (75.64%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK----GIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY 152
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMDKVLLKYTEY++PHES TNK+I+E++N+K    G+  PDSPE + +Y L     P    + +  + +FQ MLQ+     NQ+N     + + NY
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDKVLLKYTEYNEPHESLTNKNIIEALNKKEHKNGVMSPDSPEPETEYQLT----PRTEAKYSKIDEEFQMMLQR-----NQINGQRVSMSSSNY 147          
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Match: gb|EEC01598.1| (DNA-binding protein, putative, partial [Ixodes scapularis])

HSP 1 Score: 185.267 bits (469), Expect = 1.203e-54
Identity = 94/144 (65.28%), Postives = 110/144 (76.39%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMD-YPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHS 143
            MGRKKIQI+RI+DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E  ++    G DSPE D D Y L     P    + +    +F+ M+Q    R+ QLN S
Sbjct:    1 MGRKKIQISRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEKEHKNSTNGCDSPEPDPDQYSLT----PRSEAKYSKINEEFELMMQ----RSAQLNGS 136          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|16769836|gb|AAL29137.1| (SD04091p [Drosophila melanogaster] >gi|220942214|gb|ACL83650.1| Mef2-PE, partial [synthetic construct] >gi|220952426|gb|ACL88756.1| Mef2-PE [synthetic construct] >gi|1067112775|gb|AOQ03397.1| Mef2-RE, partial [synthetic construct])

HSP 1 Score: 192.971 bits (489), Expect = 5.245e-57
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|701315202|ref|XP_009978079.1| (PREDICTED: myocyte-specific enhancer factor 2A isoform X1 [Tauraco erythrolophus])

HSP 1 Score: 198.749 bits (504), Expect = 1.023e-55
Identity = 113/191 (59.16%), Postives = 134/191 (70.16%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLN-------DSPPPNE--MMQDNTPEN------DFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY LN       DSP P+   ++  +T E       +F NM++         NH   GL  QN+   VT    N +  TY N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DYALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMR---------NHKIPGLPAQNFSMSVTVPVSNPNTLTYSNPGSSLV 181          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|697036514|ref|XP_009580626.1| (PREDICTED: myocyte-specific enhancer factor 2A isoform X1 [Fulmarus glacialis])

HSP 1 Score: 199.134 bits (505), Expect = 1.067e-55
Identity = 113/191 (59.16%), Postives = 134/191 (70.16%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLN-------DSPPPNE--MMQDNTPEN------DFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY LN       DSP P+   ++  +T E       +F NM++         NH   GL  QN+   VT    N +  TY N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DYALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMR---------NHKIPGLPAQNFSMSVTVPVSNPNTLTYSNPGSSLV 181          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|699655205|ref|XP_009897303.1| (PREDICTED: myocyte-specific enhancer factor 2A isoform X4 [Picoides pubescens])

HSP 1 Score: 198.749 bits (504), Expect = 1.090e-55
Identity = 113/191 (59.16%), Postives = 134/191 (70.16%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLN-------DSPPPNE--MMQDNTPEN------DFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY LN       DSP P+   ++  +T E       +F NM++         NH   GL  QN+   VT    N +  TY N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DYALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMR---------NHKIPGLPAQNFSMSVTVPVSNPNTLTYSNPGSSLV 181          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|700378445|ref|XP_009943766.1| (PREDICTED: myocyte-specific enhancer factor 2A [Opisthocomus hoazin])

HSP 1 Score: 198.749 bits (504), Expect = 1.101e-55
Identity = 113/191 (59.16%), Postives = 134/191 (70.16%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLN-------DSPPPNE--MMQDNTPEN------DFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY LN       DSP P+   ++  +T E       +F NM++         NH   GL  QN+   VT    N +  TY N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DYALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMR---------NHKIPGLPAQNFSMSVTVPVSNPNTLTYSNPGSSLV 181          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|704486392|ref|XP_010074457.1| (PREDICTED: myocyte-specific enhancer factor 2A isoform X1 [Pterocles gutturalis])

HSP 1 Score: 198.749 bits (504), Expect = 1.633e-55
Identity = 113/191 (59.16%), Postives = 134/191 (70.16%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLN-------DSPPPNE--MMQDNTPEN------DFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY LN       DSP P+   ++  +T E       +F NM++         NH   GL  QN+   VT    N +  TY N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DYALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMR---------NHKIPGLPAQNFSMSVTVPVSNPNTLTYSNPGSSLV 181          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|939259992|ref|XP_014249839.1| (PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939259994|ref|XP_014249840.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939259996|ref|XP_014249841.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939259998|ref|XP_014249842.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939260000|ref|XP_014249843.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939260002|ref|XP_014249844.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939260004|ref|XP_014249845.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939260006|ref|XP_014249846.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939260008|ref|XP_014249847.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939260010|ref|XP_014249848.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius] >gi|939260012|ref|XP_014249849.1| PREDICTED: myocyte-specific enhancer factor 2 [Cimex lectularius])

HSP 1 Score: 195.282 bits (495), Expect = 1.685e-55
Identity = 94/149 (63.09%), Postives = 118/149 (79.19%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK----GIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSST 145
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMDKVLLKYTEY++PHES TNK+I+E++N+K    G   PDSPEGD +Y L     P    + N  + +FQ M+Q+N   NN++ + S+
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDKVLLKYTEYNEPHESLTNKNIIEALNKKEHKNGACSPDSPEGDSEYQLT----PRTEAKYNKIDEEFQMMMQRNQLSNNRVGNQSS 145          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|699627066|ref|XP_009885340.1| (PREDICTED: myocyte-specific enhancer factor 2A isoform X1 [Charadrius vociferus])

HSP 1 Score: 198.364 bits (503), Expect = 1.733e-55
Identity = 113/191 (59.16%), Postives = 134/191 (70.16%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLN-------DSPPPNE--MMQDNTPEN------DFQNMLQQNNARNNQLNHSSTGLQNQNY---VT---GNHSATTYDN-GSSLV 169
            MGRKKIQITRI DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++ +KG+ G +SP+ D DY LN       DSP P+   ++  +T E       +F NM++         NH   GL  QN+   VT    N +  TY N GSSLV
Sbjct:    1 MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDAD-DYALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMR---------NHKIPGLPAQNFSMSVTVPVSNPNTLTYSNPGSSLV 181          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|1028916278|gb|ANF06986.1| (myocyte enhancer factor 2 a variant [Litopenaeus vannamei])

HSP 1 Score: 196.438 bits (498), Expect = 1.790e-55
Identity = 103/168 (61.31%), Postives = 123/168 (73.21%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK----GIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY-VTGNHSATTYD 163
            MGRKKIQI+RI+DERNRQVTFTKRKFGLMKKAYELSVLCDCEI++IIFNS NKLFQYASTDMDKVLLKYTEY++PHES+TN DI+E++N+K    G+  PDSP+G+ DY L     P    + N  + +F  M+Q+N    N       GL N N  VT   + T YD
Sbjct:    1 MGRKKIQISRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEPHESRTNNDIVEALNKKEHKNGLQSPDSPDGEQDYTLT----PRTEAKYNKIDEEFTLMMQRNQI--NGGTRQPVGLNNYNMAVTVPVNNTAYD 162          
BLAST of EMLSAG00000000015 vs. nr
Match: gi|1036949727|ref|XP_017120134.1| (PREDICTED: myocyte-specific enhancer factor 2 isoform X10 [Drosophila elegans])

HSP 1 Score: 193.741 bits (491), Expect = 2.250e-55
Identity = 89/133 (66.92%), Postives = 109/133 (81.95%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRKGIGGPDSPEGDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQN 133
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMD+VLLKYTEY++PHES TNK+I+E  N+ G+  PDSPE + DY L     P    + N  + +FQNM+Q+N
Sbjct:    1 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDRVLLKYTEYNEPHESLTNKNIIEKENKNGVMSPDSPEAETDYTLT----PRTEAKYNKIDEEFQNMMQRN 129          
BLAST of EMLSAG00000000015 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold505_size153196-snap-gene-0.23 (protein:Tk05997 transcript:maker-scaffold505_size153196-snap-gene-0.23-mRNA-1 annotation:"myocyte-specific enhancer factor 2-like")

HSP 1 Score: 183.726 bits (465), Expect = 4.554e-53
Identity = 91/155 (58.71%), Postives = 118/155 (76.13%), Query Frame = 0
Query:    1 MGRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVLLKYTEYDQPHESQTNKDILESINRK--GIGGPDSPE-GDMDYPLNDSPPPNEMMQDNTPENDFQNMLQQNNARNNQLNHSSTGLQNQNY 152
            MGRKKIQI+RI+DERNRQVTF KRKFG+MKKAYELSVLCDCEI++IIF+S NKL+QYASTDMDKVLLKYTEY++PHES TNK+I++++N+K    G P SP+ GD D  +  +  P    + N  + +FQ M+ +N++  N+       L NQN+
Sbjct:   28 MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSSNKLYQYASTDMDKVLLKYTEYNEPHESLTNKNIIDALNKKEHKGGNPGSPDGGDSDGEIETNLTPRTEAKYNKIDEEFQIMMHRNHSNGNR------ALSNQNF 176          
BLAST of EMLSAG00000000015 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold280_size224562-snap-gene-1.17 (protein:Tk08832 transcript:maker-scaffold280_size224562-snap-gene-1.17-mRNA-1 annotation:"serum response factor")

HSP 1 Score: 56.6102 bits (135), Expect = 3.352e-9
Identity = 22/65 (33.85%), Postives = 41/65 (63.08%), Query Frame = 0
Query:    2 GRKKIQITRISDERNRQVTFTKRKFGLMKKAYELSVLCDCEISVIIFNSHNKLFQYASTDMDKVL 66
            GR KI++  I ++  R  TF+KRK G+MKKAYELS L   ++ +++ +    ++ +A+  +  ++
Sbjct:  125 GRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 189          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000015 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-9.060e-5670.40symbol:MEF2D "Myocyte-specific enhancer factor 2D"... [more]
-6.971e-5566.92symbol:Mef2 "Myocyte enhancer factor 2" species:72... [more]
-1.334e-5473.95symbol:MEF2D "Uncharacterized protein" species:903... [more]
-2.879e-5460.80symbol:MEF2A "Myocyte-specific enhancer factor 2A"... [more]
-6.001e-5467.94symbol:MEF2C "Myocyte-specific enhancer factor 2C"... [more]
-6.587e-5458.52symbol:Mef2a "Myocyte-specific enhancer factor 2A"... [more]
-6.587e-5458.52symbol:Mef2a "myocyte enhancer factor 2a" species:... [more]
-6.917e-5458.52symbol:Mef2a "Myocyte-specific enhancer factor 2A"... [more]
-7.305e-5479.44symbol:MEF2C "Myocyte-specific enhancer factor 2C"... [more]
-7.494e-5458.52symbol:MEF2A "Uncharacterized protein" species:961... [more]

Pages

back to top
BLAST of EMLSAG00000000015 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 13
Match NameE-valueIdentityDescription
gi|592871805|gb|GAXK01085757.1|3.066e-5980.80TSA: Calanus finmarchicus comp78922_c0_seq1 transc... [more]
gi|592757359|gb|GAXK01197054.1|3.167e-5688.57TSA: Calanus finmarchicus comp1123791_c0_seq1 tran... [more]
gi|592772973|gb|GAXK01181595.1|5.316e-4576.70TSA: Calanus finmarchicus comp128420_c0_seq4 trans... [more]
gi|592772974|gb|GAXK01181594.1|5.359e-4576.70TSA: Calanus finmarchicus comp128420_c0_seq3 trans... [more]
gi|592772975|gb|GAXK01181593.1|5.413e-4576.70TSA: Calanus finmarchicus comp128420_c0_seq2 trans... [more]
gi|592772976|gb|GAXK01181592.1|5.456e-4576.70TSA: Calanus finmarchicus comp128420_c0_seq1 trans... [more]
gi|592893183|gb|GAXK01065192.1|3.157e-1342.86TSA: Calanus finmarchicus comp2229642_c0_seq2 tran... [more]
gi|592893184|gb|GAXK01065191.1|5.342e-1342.86TSA: Calanus finmarchicus comp2229642_c0_seq1 tran... [more]
gi|592769620|gb|GAXK01184948.1|4.875e-935.96TSA: Calanus finmarchicus comp6434714_c0_seq1 tran... [more]
gi|592817228|gb|GAXK01137340.1|3.513e-733.85TSA: Calanus finmarchicus comp164293_c0_seq1 trans... [more]

Pages

back to top
BLAST of EMLSAG00000000015 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 3
Match NameE-valueIdentityDescription
EMLSAP000000000150.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1004:5890... [more]
EMLSAP000000084847.679e-1684.62pep:novel supercontig:LSalAtl2s:LSalAtl2s51:944140... [more]
EMLSAP000000026651.425e-836.07pep:novel supercontig:LSalAtl2s:LSalAtl2s153:85517... [more]
back to top
BLAST of EMLSAG00000000015 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|353526326|sp|P40791.3|MEF2_DROME5.116e-5666.92RecName: Full=Myocyte-specific enhancer factor 2; ... [more]
gi|238685487|sp|A2VDZ3.1|MEF2A_BOVIN1.947e-5560.80RecName: Full=Myocyte-specific enhancer factor 2A[more]
gi|123779534|sp|Q2MJT0.1|MEF2A_RAT4.551e-5558.52RecName: Full=Myocyte-specific enhancer factor 2A[more]
gi|1170908|sp|Q02078.1|MEF2A_HUMAN5.794e-5558.52RecName: Full=Myocyte-specific enhancer factor 2A;... [more]
gi|2500878|sp|Q03413.1|MEF2D_XENLA9.077e-5573.95RecName: Full=Myocyte-specific enhancer factor 2D ... [more]
gi|229484897|sp|A2ICN5.2|MEF2A_PIG1.427e-5458.52RecName: Full=Myocyte-specific enhancer factor 2A[more]
gi|148886628|sp|Q60929.2|MEF2A_MOUSE2.078e-5480.95RecName: Full=Myocyte-specific enhancer factor 2A[more]
gi|75062031|sp|Q5REW7.1|MEF2A_PONAB2.340e-5480.95RecName: Full=Myocyte-specific enhancer factor 2A[more]
gi|82224805|sp|Q9W6U8.1|MEF2A_CHICK5.276e-5480.95RecName: Full=Myocyte-specific enhancer factor 2A[more]
gi|81886909|sp|O89038.1|MEF2D_RAT7.696e-5477.48RecName: Full=Myocyte-specific enhancer factor 2D[more]

Pages

back to top
BLAST of EMLSAG00000000015 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 24
Match NameE-valueIdentityDescription
AAM71042.18.438e-5766.92myocyte enhancer factor 2, isoform B [Drosophila m... [more]
AAS64881.19.720e-5766.92myocyte enhancer factor 2, isoform F [Drosophila m... [more]
AAM71043.11.035e-5666.92myocyte enhancer factor 2, isoform C [Drosophila m... [more]
AAF58872.11.149e-5666.92myocyte enhancer factor 2, isoform A [Drosophila m... [more]
AGB93374.11.666e-5666.92myocyte enhancer factor 2, isoform G [Drosophila m... [more]
AAM71044.12.480e-5666.92myocyte enhancer factor 2, isoform D [Drosophila m... [more]
gb|KFM79371.1|5.682e-5665.52Myocyte-specific enhancer factor 2A, partial [Steg... [more]
AGB93375.17.960e-5666.92myocyte enhancer factor 2, isoform H [Drosophila m... [more]
gb|EFA11312.2|2.334e-5559.62Myocyte-specific enhancer factor 2-like Protein [T... [more]
gb|EEC01598.1|1.203e-5465.28DNA-binding protein, putative, partial [Ixodes sca... [more]

Pages

back to top
BLAST of EMLSAG00000000015 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|16769836|gb|AAL29137.1|5.245e-5766.92SD04091p [Drosophila melanogaster] >gi|220942214|g... [more]
gi|701315202|ref|XP_009978079.1|1.023e-5559.16PREDICTED: myocyte-specific enhancer factor 2A iso... [more]
gi|697036514|ref|XP_009580626.1|1.067e-5559.16PREDICTED: myocyte-specific enhancer factor 2A iso... [more]
gi|699655205|ref|XP_009897303.1|1.090e-5559.16PREDICTED: myocyte-specific enhancer factor 2A iso... [more]
gi|700378445|ref|XP_009943766.1|1.101e-5559.16PREDICTED: myocyte-specific enhancer factor 2A [Op... [more]
gi|704486392|ref|XP_010074457.1|1.633e-5559.16PREDICTED: myocyte-specific enhancer factor 2A iso... [more]
gi|939259992|ref|XP_014249839.1|1.685e-5563.09PREDICTED: myocyte-specific enhancer factor 2 [Cim... [more]
gi|699627066|ref|XP_009885340.1|1.733e-5559.16PREDICTED: myocyte-specific enhancer factor 2A iso... [more]
gi|1028916278|gb|ANF06986.1|1.790e-5561.31myocyte enhancer factor 2 a variant [Litopenaeus v... [more]
gi|1036949727|ref|XP_017120134.1|2.250e-5566.92PREDICTED: myocyte-specific enhancer factor 2 isof... [more]

Pages

back to top
BLAST of EMLSAG00000000015 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 2
Match NameE-valueIdentityDescription
maker-scaffold505_size153196-snap-gene-0.234.554e-5358.71protein:Tk05997 transcript:maker-scaffold505_size1... [more]
maker-scaffold280_size224562-snap-gene-1.173.352e-933.85protein:Tk08832 transcript:maker-scaffold280_size2... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1004supercontigLSalAtl2s1004:5890..19048 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteMyocyte-specific enhancer factor 2
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1004-snap-gene-0.21
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000015 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000015EMLSAT00000000015-695862Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1004:5890..19048+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000015-682781 ID=EMLSAG00000000015-682781|Name=EMLSAG00000000015|organism=Lepeophtheirus salmonis|type=gene|length=13159bp|location=Sequence derived from alignment at LSalAtl2s1004:5890..19048+ (Lepeophtheirus salmonis)
ATTTGTATATGTTGTTAAGAGTGTGTTGACCTTCCTGATATCTGCTTCTC CTGCTCTCTCTCTCTCCTTTTCTTTTATTTCTTGCTCCTTCTTTTGCTGT TGCTGCTGCTAATTTCTTTCTTTCTCTTTTTCCTTTAATAACAAAAATAC AAAATTACACATTTTAGTATTTATTTCGTCTCGAAGGAAGGGGTCCTTTG CCGAATTATTCCAATTTTAAACAAGTGCTTAAAATAAAACAACTGGAAAA AACAAGTGACATTAAGTTCGTCGTTTTTTTCTCTTCATCCTCTCTACTAG GTAAGCATGGTCTTTCATTTTGCTGTTGTTTGTGACGCCATCATTATTAT TTTTATTATTCTACTGACTGAATATTATGTGGAATTTATTATAATTACAT ACAACATAGGCCACGTTTCTGGCTAAGTAGGAGTTGAGGAGACAATTTTA ATTTAAGCATGAATTTTATTGTATATTATACTCTCCTCCGAATGAGCCTT TTTGAAAAACCGGAAATTGAACTGTCGTAGTTAAAATTTAATATATTTTT TTATTTATTATTTATTTGATAAACATGAGAGAAAAGCTAATTTAAATAAT GATCTTCATATATGTATCACATATTTTGTAGTAATAATATATGTGCCTAC ACATATGTAGCGTTTCACCTTTTTATAGCCTCAAGGTAATGAAAGACATC TAAACAACTCTTTCTCCATGTGATCAAAACTAAATTGTTTATTACTAACA TCTATGTTAGTAGATCAAAATCCCTTCTTTGAAATTCTTCTCCTTCTCTT ATTTCGTTGAATCATAATACCATTCAAAATATTTGACCTGAGCGTTATGA CCTTTCTTCTTGTAATTAATTCCCTTCCCTTAGAAATGTGCGTTTGAGTA TTATTTTTTTTTTACTCAGTCTAAAAGAATGACTATCATAATTTTGTTTT AACTTTCTTTCTTTATCTTTTTTTACACGTCTTCATTTATAGCCTCTTAA AGCAGCTCCCTGTATTTCTCACAGTGTCGTTGTTTTAACCCTTATAAAAA TCATCAGCATTTATTTAGTAACAAAAAAGAATGAATTTACGATTCTTTGT ACATATATGATATTTTTTAAATAGTCTAGACATGTACATATGTGCTATAA AAATATAATCTCAGGAACTTATTACTACAGCCAACAATTCCANNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATATTAAAAAACAAATAAG TAATCCATAGAAACGCTCATAACTAACTGTCATTTATTGATGTTGATTCA TATCCTTGCGGATTGCAAAGGGAGTCCTTGATTGTGAGTTTGACTTATAA GCAAACTCCTTTAATTCAAATCCTTTATATGTAGTATATTCAAAATTCCC GCCTCTTTTTTAATTTTNNNNNNNNNNNNNNNNNNNNNNNACTTTATATA AATTGACAGCAAAAAGTTGGTACTGAACTTTTCCCACAAAAAAATAAAAC AAAATGCGCCATTCAAATCCTTTTCGCCTCCATATTAGGTCATCATTTGC AGCTGTCATTGATGAATTTTTATTTATTTAACTGTATGTAAATGATGCCA ACAACGACTACAAAANTTCGTTTTTTTTTTGTTGAGTTTAGAAATAATCC GAAAAAGAGTAGTAGTTTGTTCTGTGGTAGAGCTCTTTTATTCGCTCTAA CACAGGTAAAAAAAAATCCTGTAGATTGCTAGCATTTTCGTTTTACAATC CTTTCTTTTGTGGGTTCCTCAATAGATCATGATGGGTTATAAGATTTTTA ATCCTTCAAAATCGGTACATCTGTAATAAACCTCTCTCTCTCTCTTATTT AAGGAAGCGAGCAAAATGTCCACGATTAGAGAGATTGTAATTTAATATGG AAGATTTTTTTATTTTTAAGGAACTCTTGATTGTTTTTTCATAAATTATA ATGAGAGTGGATAATGAATATATGAATGATAAGATAATATCTCTAAATTT CCCATCGTCCTTTTCGAGTCAAGGACCTGGAGGGTCTAACAGATATATCC GTACAAAGTTTGACTTCATCAAGATGTATAATGATGGCGTTACTGGTAAT GCAGATCGTGTGTATTTGTTAGCTGTACCCGTTTTTTTTTTTTTAAATTG GTTATCTGAATAAGGTATTTTCTTTTCTTTAGCTATTAGACTCAATTATA TTCAAAACCTGATTAAACATTTGTGTGTGCTCATAAAAGACTGAGAGTAA CCTTGAGATTTGTAGCTGAGTTACAACTGTAAGTCCTTGTTGGACTCCCG AGTAGAATTGAGGATCACCATCAGAGTAATTCTTGCAAATACCTTGTTTA TTTCCTTCTCATCCTCCTCCTCCCTTGTCAGAGGTAATTGATGCTGATAT CCTCCAAAACATTCTTCAAATTGTCAAGGTTACAAGATCGACGTCGGAGT AACTCCACCCATTATCATTGCTCATGCTAACTCAAACTATATATTTTAAA GCAACCCACCTATTTCTACTATTAAATAGAACAGCGACTCCCAACTGGGG CTACGCGAAGACTTAATGCACTGCGGTGTACCATAAAGGGCTCCGTGAGA TTATCTAGGTCATCAAATAATGTATTTTTTTAAAAGTCTTAAAAAAAATC CTGAATCCAAATATTCAAGTAATATAAGTTTTTTCATCCCAATATACGTA TAGGGTCGCTGTAGTGTTGTTAAGATTGGGAATCACTGAATGTCATAATG ATGTAATTGGCTGACTATGAGTTTCTCCCACCCCTTTTTGGTCAAAATAT TAAGAGCATTGCTAGATTAAAGAGCGGTACGGCGGACAACTTCTCGAGTC CCTTGCTTTATGTACTTATAACAAATGATCCTTAAGAATATATTTTTAAA TTAGCGAATAAGAAATCCGTGAATTCTTAAATTGACTGCGCCCCGCATAT TCTGAAACCAGGAGTACTTGAGAAATGATGTAATTATGAGGGCTACGTAA TAAGTGGAATGATTATAAATCCGGGTTCCAAGGGAGTAGTGTCGTAATAA TTAGGGGCCATTCTGCGGCCACTTTTGCTTAATATTTATAGTTATCACAA TAGAATAATCCTCTTGGCTTAAAAAAATTAATGTAATAATTATTTGTTAA AATTTTATACCAACCCAAAAAATGTAACTTTAAAATTAATTTTTGTTTGC CTTTGTTATTTATAAAAATGACAAAAACATTCTGTCAAAAATTCAGCCCC TCTCATAATACTTACACTCCCTTCCCTCCAGGGACGCTCCTAATGACGTC ACCGTATATAAAATGGGCCCCATTTGAAAAATACATTATAACAACGGTGG TTTCAAGATTTCATTAGGGGTGTTATTGTTATCAAAGAGTCCCTCCAGGT CAAATTAATTTATGTAGGTATATCATATTAAAACATCATTTGTGAGAGCA TTTTCACTGACGTCATAAATTGCATCGTAATTGCAGGAGACGCCATCTTA AAATTGATATTTTTACTACCTAAATGGACACATTTCCTAAGAAACTTGAT AGTACTTCATCAAATGATTTTAAAAATATAAAAAAAATTAACACCTGCAC TAAATACTACTTGATGACAATGATATAATCAGTGATATTTGAATTAAATC AAAGTCATATGTACTGAAATCCATATGCAGTGTCTAAATTTCTACAATTA TTAATATTTTTTGATCGATTAGGTCGAGAAAAGTTGGGTAATTAGAGAAA AATATTTTATTATTTCAATCACTTGAAATTGTTAACGTCGTCAAAACATT TAGAATCTCAGATTCATCTGGAGTTTACTTAGGAAAGGGGTCCATATCAG ATTCTCAAAGGGGTTCGTGGCTCACTAAAAGGTTGAGAATCCCTGTTATC AAGAATAAATGTAAATGTATATCCCTTTGATGAGATGGTTTTCCCTTACA TACCAAAGTCATTTACACCCAGTTGCTAAAAGTTAACCGGAAGTTATCTA CCGCACTTCATTCTCTGGGAGGGTTTATCTTAGAGAAAATATAGAGCGAT AGAGTATTTTTGGAGGAGGTTTGTAGGGATTAAAGTTAAAGTCAGCTGTT TTTGGGATATTTATATTCATATATTTTTTCTCATTTGTTATTTTCTTGAT TTCCAAAAAATATATAATATGTATGTGGTAAGTATATAAATAACGTGGGC ATACAACAGTTGACGTGAACTTACGCGACATTAACACCCTCGAGCAATCT ATACCAATTTATGCGGTTTATTTTTAAGAAATATGTAGTGTGTCTACATA AATAGATATTGTCCCTTGTAAGTACTAAACTATCAAATGGTCATTTTATA TTGTGACGATTAATTGTGGCTGMTTTAAGCACAATTAGCGGCACATCCAT AGGCTGAATAAGGATAATTTGGTAATAGAAATCGACGATTATTTATAAAA GAATACAAATTTATCATATACATAAGACACTTTACATATGTGGTGCGTCA ACATAAAAGCAATCTTAACAAAAATCAAAAATAAGAGAAAATCTTCATTT TTTCTCTTCGTATTATAATATTTCATATACATATTTGACTTTGTAATCAA ATTTCTGGGATAAGTGCAGATAACCAAGACTTTAATCTATATCTTAGGAT CTTTATTTGATTTAAGTGACTTGTATTGTCCCCGATATGGTCCTTTTTAA ATAAAATCTATTAATTTGTTATTATTTTATTGTGACGATCAATTTTGGGC TAGAAAAGTTATTCTATATTGTTTTTGTGTTGATAGGCTACATATTATGA ATAGCAGAAAAGTATCTTTGCAGAATCAATCTCCTACCTAACTATGGGTT ACATAGATGGATAGTTACTTTGCATTCATGCAAGAAGTATAATAGACTTA TATGTATATTATACACTAGCTATGTTGCTTCTCTTGATTAAAATGTATAC CTACTTTAAGAAAATGAACCTTTTCCGGGAAATTACAATAATTATGACAG GAAAATAATACGTATATATAAAATCATAAAAGTACTTTTTTTTTAATACT TATATTTTATTTAGAAAGAGTTGTTAATTTCTAAATAAAAAAACCTAACT AAAAAAATAATAACGATCATTATTTCACTACGTGTATATTTGTAATTAAA TGGATATTTATGCCCTATGAGGTTGAGTGACTTGTTAATTTATATTATAC CTCGGCAGATCATTAAGAGGAAGAAGAAGACAATATTTCTTTATTTTATT ATATTGCACTGTCGTAAATATGTTATTTGACGGATAATTATATGTGTGTA TCTGTGTGTTATTGCTGCTGCTTAAATACACATATTAGAGTGGTCACTAA TTTTAGAATAAAATAGTATGAACGGAACCCATTTACAGTATGAATAGGGC ATCACTCAAAACAGTTTTAACTTCAATCTAAGTCTATTTTACTTAATTTT AGTATGAGGTTGCGAGAATACACATATTTATTTCAGATATCCTCCGAGCA ATATTTCACTAAATTTAGAATTCTATAAAATATGAGCTGGCTCTATTTTT GTAAAAATAAAATAACTTAAAAATCATGTTGTAATCCTGTCAATTTGAGA AATGTTTGCGTGGAGAGCAGCTTAGCTTTCATCACGTTTTATTAGATCAT CTGCAAGCAGCTGTGAGAAGAAAGGAATAATCATGAATCCTTCACCGTAT CCATTTTTTTCTGAAATTTTTTTTTTTGGTTAGGAGAATTTTTTTTTTCA TTATGGCAAATTGTGGAGGAGATTAAAAAACTTAATATTTCTAAAAAATT TAATTTTCTGTGAATAGCTAAGGATTTTTTCCAAAAAATTGAATATTTTG AATTTTTTTCCAAAAAATTTAATTTTTTCTGAATAGCTGTGGATTTTTGC CTTTTTTCAAAAAATTTTATAAATGAAATTTCCATCTTGAATTTTTTTTT TCTAAAAAATTTAATTTTCTCTGAAGCGATTTTTTGAAATTTTTTTTACA CAAAATTTAATTTTTTTTTGATTAGCTATGGATTTTTTTTAATTTTATGT GAACAGCTGTGGACTTTTTTTATTATTTGTGAATGGCTGTAGATTTTTAA ATTTAAATAAAAGAAAAAAAAAACCCTCTTCAAATTGCTTCCGCTTTTTT TATGGTATATTTTATACACCTATGGAAATAATAGTATCTAAGGTGTTCAA ATAAGATTTGACATTATTTGTGACACATCCAATCATGATCTTTAATTCTT CCCACTCTTCCTCATTAGAAGATGAAATAAATGAAATAAATGACTTTGGG TCTTCAAACGTGTACCCTTTTCCAATATTTTTTAGCAAGAACAGTTTCCC TTTCTAAATTCAAATAATAACGATATATTACTATTGACTTGGGTCCTTTA AGCTCTGAAGTAAGCCTAAGTGAGTACTATATACTTAAATGGCCTCTATT CGAGAATTAAATAATATAAATAACATCGTTGTAACATGAAAAGACTTCTA AATAGAAAAAATATTGCACGTGTTTAGCTCATATTTTATATAACTTTGTC TATGTTGATGTGAGACGGCAACTGAGTCATTGTTAAATGATCACAGTTCC CCAAATAAACAACAATGATATCTAAAAGTGTTGCCTACGCACTAATATTG TATCAATTTGATTGTAACCATGACTCAAAATCCTTCATTCTTGATGCATT TTAAAAGTTGTTGATGTTTTTTTAGATACTGTATCAGTTTTCGATTTGCT TTGTTGACTGTTTGTTCGGAGCATATCTAAAATCAATAAATTATCCCAAC CTCATAGTATAATTACTCAAAGTTTTTAAAATGGCTTTAGCGAATTTTGG AAAGACTTGTGGTGAAGACAACATTATTATTGTGTCCTGGGACATGACAC ATTCATAATTTATTTCAAAACTAGTGATCACTCTAATATACACATATGTG TCTTATATTATTTTAATATAACGAATTATATTTTTGGTTAATTAACGTTA AAATAATATGTTTATTGTAATCAATTTATTTAAATTTTTTATATCGAAGT AGGAAATAAAAAGTTAAAACCTAGGGACATACATTGAATTGTGTTGTTCA TCGTCATGAGACTAAATTAATGGTTTGTTTCTATATATTTCAAGGTACTT AGCTTGACTACCATTAATATATGTGGGAATCAACATAAAAGTAATCTTGG ACAAAAATCAAGAAAAAGAGTAATTTCCAATTCATTTTATTGGACCTACA GTCCAACATTTCATAGACATATTTGGGTCAATGATAGGCTTTATATACAA ATTTAGTATATCCAAGAGTTTAGGCTATAGTTTAAAACCTTTATTTGATT TAAGAGACCCTTATTGGCTCCATATGGCCTTTTTAACAATAAAATATATC AATTTGTAATTTTTGTATTGTGAAAATTAATTTTGGCTAATTAAATTGGA ATTTGCGACACACCCAAGGGAATAATATGTTGATGGAAATTTACGATAGT TTGTATAGGAATACAAATGTAATTCGCACTTAATTTTGAGAAATTTTATT CCAGCTTGCTTTTGTGTTGACGGGCCACATGTATGTATTGTTCATTGTGT GTATTTTTAGGGTGGTTTGTTACCCAACTATACATTTATTATGTATTTTT GACGTGTCAACACGAAAGCAAGTTAGAATGATTTTTCTCAAAATGGAGTG TGGTTTACTTTTTTATTTCTACCTACAAATTATTGGTATTAACCCCTTGG AGATGCCGCAAATTGAATTTAAAGTAGCCAAAATTGATCGTCACTATAGA GGAATGATAAATTAATGCATTTCATTTGAAACTGGGGTAATATCGGAGCC TAAATAAGTCCCCATGTACCATGATGTTTATTTTCTTTAACACTAGGAAG TAAAAATCCTTCTTTATGACAATGAAATGACATCCACTTCCATTACCCCC CATTTTTCTATTTCAATTTACCCCTGTTCCCCGACCACTGCACTACATTG TCAGTTTTTTAATCTGTTTATGAATAACGAATTAATAAAATCTATTTAAC AGATAATAGTACATTTTTGCAAGCACAATATCTGATATTCAGCGCTAAAC TCTGCTGTCTGGTTTAAAATTATAATAAAGTCTAATTTTTCATAGATATA TAGCTATTTTATTGTGCTAAGATATGATATAGTTGACTAAAAATGTTGTA CTACTTATAACCATTGTTGTAATTTTATCAGTTAAAAGCTAATATGCTGG ATTGCACACCATTACAGCTAATAGTCACAATGTATCTCACTTTATAGACT TACACATTAGAGCTTCCATGTTGTGTCCGACAACTCCACTTATGTAACAC AGCTGACGATTTAAGATTTTAACTTTTGGGATTTGACAGATTTTKCCTTG CTGTATTTTKAAGCCACATTGCATGGTTTTGCACTGAATAAAGTCAGAGC ACATTGGAGTTAGCATATTTTCGCTACTGAAATATTAAAAAAATGTTGAC TTTTGGCAAAAAAATAAAAATAAATAATAATTGTAGAATCAGAATTTCCA TCATGAAAAATCATCATTAGCCAGTTAGGATATTTTTGCGTTGGGTCAAT AATATTTTTATGAAATATTAGGTTGTATTCAGTGGCGTTGCTAGCCCCTT TTTAAGGGGACAGGAAGCAGAGGTAGAGAAAAAGTTTCTAAAGCCTCCCA ATTTTTCTTAAAAAACCTTATATATATCTTAATATTTATTTATAAATATG TTATTGGCGTTACCACATATGGAATCCAAAATGGTTGAACGGATCAGTCG GAAATTTAGCAAGTAGACGTATAAAATAACCAAGCATGTCCTTATGATAT TGTTTTGGGCCTTTGAGGTCATTAAGAGTCTGTTTTTGAATGGAATAAAA CCTCATTTTCCGTCTCTCTTTCTATAACTCTCATTCTCTCTGTATCTTTC TGCGTCCCTCTCTGTCTTATTTCTTCTACTTTCATTCTTTGTATTCTCTT ACATTCAGCCCTCCAACACGGCCACCCTCTGCTATTACATATATATATAT ATATGTAATAAACCTATTTATATGAGTATGGTAATAATTTTGGGGACTAT GCCCCTGGCTGTATGTATTACATAAGATATATGAAGTAAAATAATGAATT TGTATTTTTTCCTTTTCTTGATTTATGTTCAAGATTGTTTTTATGTTGAC GCACCCTGTAGATGGTATTAAATTAAACACTCATTCCTTGAGAATTTATG AGCTCTTCTCATAAAGTCTAATAATAATAATATTAAAATACCTATATATT TTATATACTACTGCCTCTGACGAATAAGGTCAAAGTGCAAAGAAAAGGGG AAGAAGATATATATCTCTCTCTACCTTTAATGACAATAATATGTGTGTGC CATATTTTCTAATTTGTATTTCCATACTATTTTCCTGTACAAAGAGTTAT TTACTAACCTTTACCTACTCATTTCAGGATCTCTCATTTTAAGCCACCGG ATTACATCCTCACACAAGAGTGAACTGACTCTTATCCCTTTTTATCCACG TCTATTACCTAAACAATATCAATTCAATACATTCTATCTGTAATTAATAA ACATGGGACGGAAAAAGATACAAATCACTCGTATATCTGACGAACGGAAT CGACAAGTCACTTTTACAAAGCGTAAATTCGGTCTCATGAAAAAGGCCTA TGAACTATCAGTTCTCTGTGATTGCGAGATTTCTGTCATCATTTTCAATT CTCATAATAAGCTGTTTCAATATGCTTCCACGGATATGGATAAAGTGCTT CTCAAGTATACAGGTAYGGCGTAGGACCTTTTATTTATTGGTATGTCATT TTTTTATATGTATATATTTTGTTCCAGAGTATGATCAGCCTCACGAGTCG CAAACGAATAAAGACATACTTGAATCTATTAATCGGAAGGGAATCGGTGG MCCCGATTCTCCAGAAGGGGACATGGACTATCCTCTGAATGATTCGCCTC CTCCCAATGAAATGATGCAGGATAATACTCCAGAGAACGACTTTCAAAAC ATGCTTCAACAAAACAATGCCAGGAATAATCAGCTTAATCATTCCTCCAC CGGTAATGACTTTTTTGCAGTGTTGGATTTGAGTTATTTATAACTATATA GCATGGCCGTCTTCAGGATTATATTTTTTTGGGGAGTTGGGTAGGAAGGT TGGCTTTAGGAATTTTTTTGAAAAAAATCCAAAAACTAGAATTTGGTCAA AAAACTAGAATTTGGTCAAAAAACTTTCAAAAATCCATAGCTATTNNNNN NNNNTTTCAAAAATTAATTTTTTTTGAATTTTTTTAATCTAAGCGTTGAA AAAATTTAAATTTTTTGGAGAAAAAAAATTATAGTGAAAAGCAAAAATTC CTTTTTTTTTTTTTTGTGGGGAGTGAGGAGGCTACATCCCCTCCMGCAAA CCCCCTGTGGACGCCCCTGTAGAGTCATAGAGTTGTATTCTTGAGCATTC AGTTATATCTAGTGTTATGTCCGTCCCTATTGGGGACTGAAGACTGCAGT CCCTTTCAGTTCAGTCCCGCATATCAATCCTAAAAACAAATAAAGTTCAT TCCTTAATGACATCACTCAACTTTATTTACACTTTGGTTGTACGAGTACT CAAACTTTCGGCTCCAGATCCGAAACCAAAATTAGACCTATACTTGTTTC CAATTTTATAAACATTTTACCCGATTTCGGGACCTAAATTAAATAGGATT AAGATTACATTTTTACTAAATACTGATCCCGAAAGAATCAATAACCTAAT GTTATTTAGTATTAGAACATAACTATTAGTTATTATAATTATTGTTATGA TAACATGACGTTTATTTAATCTCCCAACTTCTCATTCAAAAAGGAACACA GAGAGGGCCAAAATCAATAAATGGCAGGCCAATTCTTCCAACTGGAATTA TTGTTCAATAATAGGGTATGACTGTTCACAGCTTATTAAGGACTAATGCG TAAGAACACTAATTAGAGGGAAAAAAAGAAGAACATTGACTGCTGAAAAT TAAATGCTGTTTATATTATTGTATGTGTGAGCACGTTGTTACCTTGCTAA TACGAAAATTACAGTTTATTTTGTTGTTTACTGTCGATGTTTTTTCTTCT TTTCTCCTAATCCGGGTTCTGAATGTTGATTGGTTGATTAATAATTCGCT ACTTTTAAACTGTGAACAATTATCAACAATAATTGAACAAAAGTTCCATA CCTGGGAAGAATTGTCTAACTGCCGACTTATTTTGGGCCTTTTTAATTGT TTATTTTCGCAACAAAAAGGTTGCATTATACAATAAAGATAACGCCGTGT GGAGTAACGACGTTATGCAACTGTTTTTGTAGATATTACGAATTTTAATA ACTAATCAAGATAAATAGAGTTTACGTTCGATATGGGCAATATCTTTTTT ATAACTAGAATTATGTATTAAGCAATGTTTAAAGAACTTTAAGATCTTCA ATATCCCTCATATCTTTTTTATGATCTGTAAAAGTTCGCATACTCGAAGC TGGTTCGTGTCTCGGATCTTTTCAGATTTTATAAGTTTACTTATATCGTA CATGGTTACTTTGGATCCGGATCCAAGACCCCTCCTAACTTTAAATCTAT TTTCTTTTTTTCGATTAATTTCGACTATTTGATTAAATTAACCCATACCT TAATATTTCTTATTTTGATCATCCGACTTGGAATTGAGTCGAGTTTTTCA AATAATATTTCAGACGAGTTAAATGAATTTCAGAAAATGGTTTACTTAAA TAAAGTTGAGTTTTTTTCAAGTTCGAAAATACTCAAATCCAATCAAATTA TATCTTATGTCTTTCTGTCTGTAATTTCCATCTAATATATCCTCTGATCA TCCCTTTAGGCCTTCAGAATCAAAACTACGTGACAGGGAATCACAGTGCT ACTACATATGACAACGGCTCCTCTCTCGTTCATCACATGCACCAGCCTCA AACAACAACAGCACTCATGACACAACAGCAACAGTCTCAACAACAGCAAC AACAGCAATCGAACAACTCTCTAATTAGGATGTTAGAAATGGGAAACGGC AACTTTATTAATCAACAACCATCCCCCATCCCAATTCACCAGCCCAACGG AAATAATAAAGCGACAAATAATGAACAACAGCCCAGCAGCTCAAGCCCTG ACTCCCTCAATAGCTCATCCTCTCCGCCAAACGACAAAGATATCCTGAAT CTTCATCATCMCCGGCCCATCCATAACATTCAGTCCGGCCTCTTTGGAAG CATGAATACGCCGTCCTCTGCTCCTCCTCCGCAAATGTTTAATCCCTTTC AACAAACAACCAACACCACAGATTTCACTAATTTGACAGATTTACGAATT GCTCATCCAGCTATATCACAATGGCTTCAGCAGGCAGGCTCTGTACATCC TCCTGGGCCGAATCCACCAGGTAGTCGTTCTCCTATCAAAGAAGAACCAA TGTCACCGAATCGTGGGAGTCCTAACTCGGGAGGGAGTTCGGATTATGCA CCTCTGTAGATGGGGGTCATGATGAATAAAGGTCTTGGCAGGAAATGAGA CAAAYCAGCCGATTAGACAAAAAACATACATTCCTGTACTTAGTTTTTTT TGTTTTAGAAAAAAATATGTATAATGAGAATTTTCTCTTTCTTTTACATA GTGACTTTGTTTCTCTAGAATCTTAGACTCAATTATTGCATCAATCCATT AGACATACAACTTTTTTTTTCTTTTTTGGGGGTTAGTCGATTATTTTTTA TTTTGTGTCGTCTAATGTGTAGTTTTAAATTATTCATTAAAGTAATAGAA TAGCAAATTATGGAATAAAAATTTCTGAATTGTTAATGCCAAATAGATGG CGCTCTGCGGATTACCATTTATATACAATAATAGATATTTTTTAATACCT TTTTTTGCTTTGCTTTACACCTAATCACCTACCTCATGCCATCATCATTC TTTCATTTCTAAGATGATATTTGTTTCAACGTTATTTCATATTTACCATA ATTATTCTATATTTTTATTTATTTTTCCCAATTTTTTAAATTTACATATG ACAGCTCATATTTACTTTTATACAATTTGTAAATACATACATTCATATAC ACATTAGAA
back to top
Add to Basket