EMLSAG00000000131, EMLSAG00000000131-682897 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592913786|gb|GAXK01044589.1| (TSA: Calanus finmarchicus comp242954_c1_seq5 transcribed RNA sequence) HSP 1 Score: 31.187 bits (69), Expect = 1.415e-1 Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 13 LTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDIL 50 L PW K+ +M+ AA+AV T+L+VVC VG C + +++ Sbjct: 415 LDPWNKVMVMAGAAAAVAITILMVVCFVGEGCLVYEVI 528
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592913788|gb|GAXK01044587.1| (TSA: Calanus finmarchicus comp242954_c1_seq3 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.397e-1 Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 13 LTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDIL 50 L PW K+ +M+ AA+AV T+L+VVC VG C + +++ Sbjct: 1462 LDPWNKVMVMAGAAAAVAITILMVVCFVGEGCLVYEVI 1575
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592913790|gb|GAXK01044585.1| (TSA: Calanus finmarchicus comp242954_c1_seq1 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.406e-1 Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 13 LTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDIL 50 L PW K+ +M+ AA+AV T+L+VVC VG C + +++ Sbjct: 1504 LDPWNKVMVMAGAAAAVAITILMVVCFVGEGCLVYEVI 1617
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592913787|gb|GAXK01044588.1| (TSA: Calanus finmarchicus comp242954_c1_seq4 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.739e-1 Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 13 LTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDIL 50 L PW K+ +M+ AA+AV T+L+VVC VG C + +++ Sbjct: 1104 LDPWNKVMVMAGAAAAVAITILMVVCFVGEGCLVYEVI 1217
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592913789|gb|GAXK01044586.1| (TSA: Calanus finmarchicus comp242954_c1_seq2 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 2.873e-1 Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 0 Query: 13 LTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDIL 50 L PW K+ +M+ AA+AV T+L+VVC VG C + +++ Sbjct: 1495 LDPWNKVMVMAGAAAAVAITILMVVCFVGEGCLVYEVI 1608
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592892885|gb|GAXK01065490.1| (TSA: Calanus finmarchicus comp5668_c21_seq27 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 1.968e+0 Identity = 14/43 (32.56%), Postives = 24/43 (55.81%), Query Frame = 0 Query: 31 FTLLLVVCIVGRHCWINDILRKRG----------NINVDIYVL 63 F L++ VC +GR I +++ ++G NI++DIY L Sbjct: 403 FALMMFVCFIGRSSLIFNLVYQKGVLHIEFLHRLNISLDIYCL 531
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592892898|gb|GAXK01065477.1| (TSA: Calanus finmarchicus comp5668_c21_seq14 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.258e+0 Identity = 14/43 (32.56%), Postives = 24/43 (55.81%), Query Frame = 0 Query: 31 FTLLLVVCIVGRHCWINDILRKRG----------NINVDIYVL 63 F L++ VC +GR I +++ ++G NI++DIY L Sbjct: 403 FALMMFVCFIGRSSLIFNLVYQKGVLHIEFLHRLNISLDIYCL 531
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592892899|gb|GAXK01065476.1| (TSA: Calanus finmarchicus comp5668_c21_seq13 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.260e+0 Identity = 14/43 (32.56%), Postives = 24/43 (55.81%), Query Frame = 0 Query: 31 FTLLLVVCIVGRHCWINDILRKRG----------NINVDIYVL 63 F L++ VC +GR I +++ ++G NI++DIY L Sbjct: 403 FALMMFVCFIGRSSLIFNLVYQKGVLHIEFLHRLNISLDIYCL 531
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592834901|gb|GAXK01122643.1| (TSA: Calanus finmarchicus comp3624488_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 5.059e+0 Identity = 13/36 (36.11%), Postives = 21/36 (58.33%), Query Frame = 0 Query: 29 VGFTLLLVVCIVGR--HCWINDILRKRGNINVDIYV 62 VGFTLL I+ H W+ ++ K N+N+ I++ Sbjct: 951 VGFTLLHDFVILDNISHQWVEKVITKIENVNISIHI 1058
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Match: gi|592841933|gb|GAXK01115611.1| (TSA: Calanus finmarchicus comp4122163_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 5.676e+0 Identity = 14/35 (40.00%), Postives = 18/35 (51.43%), Query Frame = 0 Query: 11 PGLTPWEKITIMSIAASAVGFTLLLVVCIV-GRHC 44 L K+ + I S V F LLL+ C+V RHC Sbjct: 108 SSLLQNSKLKSLPILMSMVAFCLLLISCLVMSRHC 212
BLAST of EMLSAG00000000131 vs. L. salmonis peptides
Match: EMLSAP00000000131 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1020:102801:104296:-1 gene:EMLSAG00000000131 transcript:EMLSAT00000000131 description:"snap-LSalAtl2s1020-processed-gene-0.52") HSP 1 Score: 128.257 bits (321), Expect = 3.336e-40 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0 Query: 1 MSVSPTSTIPPGLTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDILRKRGNINVDIYVL 63 MSVSPTSTIPPGLTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDILRKRGNINVDIYVL Sbjct: 1 MSVSPTSTIPPGLTPWEKITIMSIAASAVGFTLLLVVCIVGRHCWINDILRKRGNINVDIYVL 63 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000131 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000131 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 10
BLAST of EMLSAG00000000131 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000131 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000131 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000131 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000131 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1020:102801..104296- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000131-682897 ID=EMLSAG00000000131-682897|Name=EMLSAG00000000131|organism=Lepeophtheirus salmonis|type=gene|length=1496bp|location=Sequence derived from alignment at LSalAtl2s1020:102801..104296- (Lepeophtheirus salmonis)back to top Add to Basket
|