EMLSAG00000000147, EMLSAG00000000147-682913 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000147
Unique NameEMLSAG00000000147-682913
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592865464|gb|GAXK01092098.1| (TSA: Calanus finmarchicus comp77098_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 73.9442 bits (180), Expect = 5.048e-16
Identity = 43/98 (43.88%), Postives = 59/98 (60.20%), Query Frame = 0
Query:    1 MKLLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHGF-WSQPRT--ERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIV 95
            + +L +   +AS  A   +Q W  LRTTF + PF GF + QPRT  E +A   G+ KIS C D   F G+RY+  + H +++ I+D  GYIAG QSIV
Sbjct:    3 LNVLSLACLVASATA---AQKWPGLRTTFGVNPFGGFFYPQPRTIAEAEAEGSGWHKISSCGDGGKFLGNRYVEQFGH-SLILIFDDAGYIAGSQSIV 284          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592865465|gb|GAXK01092097.1| (TSA: Calanus finmarchicus comp77098_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 73.9442 bits (180), Expect = 6.647e-16
Identity = 43/98 (43.88%), Postives = 59/98 (60.20%), Query Frame = 0
Query:    1 MKLLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHGF-WSQPRT--ERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIV 95
            + +L +   +AS  A   +Q W  LRTTF + PF GF + QPRT  E +A   G+ KIS C D   F G+RY+  + H +++ I+D  GYIAG QSIV
Sbjct:    3 LNVLSLACLVASATA---AQKWPGLRTTFGVNPFGGFFYPQPRTIAEAEAEGSGWHKISSCGDGGKFLGNRYVEQFGH-SLILIFDDAGYIAGSQSIV 284          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592908602|gb|GAXK01049773.1| (TSA: Calanus finmarchicus comp31018_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 67.3958 bits (163), Expect = 3.387e-13
Identity = 36/77 (46.75%), Postives = 49/77 (63.64%), Query Frame = 0
Query:   19 SQNWHALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIV 95
            +Q W AL+TTFS+ PF GF SQPRT  +A + G+  ++ C+    F G RY    D  ++V IYD  GYIAG QS++
Sbjct: 1060 AQKWPALKTTFSINPFSGFNSQPRTSSEAEAAGWELLASCD--GKFLGHRYANPADF-SLVLIYDDAGYIAGSQSVI 1281          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592928774|gb|GAXK01029771.1| (TSA: Calanus finmarchicus comp932928_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 57.7658 bits (138), Expect = 4.376e-10
Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 0
Query:   18 GSQNWHALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGI--SNDLSSQP 109
             ++NW    TTF       F  +PRT  +AR  G++K+S C+    F G RY  + D P+ + IYD  GYIAG+QS+V  V+ +  S +L+ QP
Sbjct:   65 ATENWPNFSTTFP-----HFHLEPRTTSEAREAGWMKLSSCD--GKFLGHRYAKHSD-PSKILIYDDAGYIAGVQSVV-PVKNVHPSVNLTLQP 319          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592865463|gb|GAXK01092099.1| (TSA: Calanus finmarchicus comp77098_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 39.2762 bits (90), Expect = 2.859e-4
Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 0
Query:   54 KISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIV 95
            KIS C D   F G+RY+  Y   +++ I+D  GYIAG QSIV
Sbjct:    1 KISSCGDGGKFLGNRYV-TYFGASLILIFDDAGYIAGSQSIV 123          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592764598|gb|GAXK01189970.1| (TSA: Calanus finmarchicus comp263214_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 30.8018 bits (68), Expect = 7.860e-1
Identity = 15/49 (30.61%), Postives = 23/49 (46.94%), Query Frame = 0
Query:   23 HALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIP 71
            H L TT +  PF   WS+   E + R K    +S+ ND+  +     +P
Sbjct:   84 HRLYTTMAYTPFPLKWSEITPEEKRRVKAAWPVSNINDLVRYENGMVLP 230          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592764594|gb|GAXK01189974.1| (TSA: Calanus finmarchicus comp263214_c1_seq6 transcribed RNA sequence)

HSP 1 Score: 30.0314 bits (66), Expect = 1.304e+0
Identity = 15/49 (30.61%), Postives = 23/49 (46.94%), Query Frame = 0
Query:   23 HALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIP 71
            H L TT +  PF   WS+   E + R K    +S+ ND+  +     +P
Sbjct:   84 HRLYTTMAYTPFPLKWSEITPEEKRRVKAAWPVSNINDLVRYENGMVLP 230          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592764596|gb|GAXK01189972.1| (TSA: Calanus finmarchicus comp263214_c1_seq4 transcribed RNA sequence)

HSP 1 Score: 30.0314 bits (66), Expect = 1.364e+0
Identity = 15/49 (30.61%), Postives = 23/49 (46.94%), Query Frame = 0
Query:   23 HALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIP 71
            H L TT +  PF   WS+   E + R K    +S+ ND+  +     +P
Sbjct:   84 HRLYTTMAYTPFPLKWSEITPEEKRRVKAAWPVSNINDLVRYENGMVLP 230          
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Match: gi|592883730|gb|GAXK01074645.1| (TSA: Calanus finmarchicus comp2284731_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 27.7202 bits (60), Expect = 8.806e+0
Identity = 11/32 (34.38%), Postives = 18/32 (56.25%), Query Frame = 0
Query:   35 HGFWSQPRTERQARSKGYIKISDCNDINAFPG 66
            H  W  PR   +  S GYI+  + +++NA+ G
Sbjct:  179 HEKWETPRDSWKTTSDGYIEAFEIDNLNAYTG 274          
BLAST of EMLSAG00000000147 vs. L. salmonis peptides
Match: EMLSAP00000000147 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1022:45727:49241:1 gene:EMLSAG00000000147 transcript:EMLSAT00000000147 description:"snap_masked-LSalAtl2s1022-processed-gene-0.19")

HSP 1 Score: 228.794 bits (582), Expect = 2.679e-78
Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 0
Query:    1 MKLLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGISNDLSSQPY 110
            MKLLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGISNDLSSQPY
Sbjct:    1 MKLLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGISNDLSSQPY 110          
BLAST of EMLSAG00000000147 vs. L. salmonis peptides
Match: EMLSAP00000009656 (pep:novel supercontig:LSalAtl2s:LSalAtl2s620:108361:109875:1 gene:EMLSAG00000009656 transcript:EMLSAT00000009656 description:"augustus_masked-LSalAtl2s620-processed-gene-1.1")

HSP 1 Score: 164.081 bits (414), Expect = 7.891e-51
Identity = 75/97 (77.32%), Postives = 86/97 (88.66%), Query Frame = 0
Query:    1 MKLLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQ 97
            MKLLL F FL SLGAV  +++W++LRTTFSLLPF GFWSQPR E++ARS+GY KISDC+D  +FPG+RYIPNYDHPNIV IYDVNGYIAGIQSIVDQ
Sbjct:    1 MKLLLTFSFLVSLGAVNAAZDWYSLRTTFSLLPFTGFWSQPRLEKEARSEGYTKISDCSDGESFPGNRYIPNYDHPNIVLIYDVNGYIAGIQSIVDQ 97          
BLAST of EMLSAG00000000147 vs. L. salmonis peptides
Match: EMLSAP00000001381 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1231:63552:64820:1 gene:EMLSAG00000001381 transcript:EMLSAT00000001381 description:"maker-LSalAtl2s1231-snap-gene-0.11")

HSP 1 Score: 51.6026 bits (122), Expect = 3.154e-9
Identity = 27/67 (40.30%), Postives = 40/67 (59.70%), Query Frame = 0
Query:   51 GYIKISDCNDIN-AFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQ------VRGISNDLSSQPY 110
            G++++  CN  +  +PG R+I N  + NI+ IYD+NG IAGIQS+V++       R   ND   Q Y
Sbjct:    1 GWLQVGXCNQSDRTYPGERFIRNVKYNNIILIYDINGKIAGIQSVVEKRFDNNPFRNYENDSMYQHY 67          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|908444415|ref|XP_013080143.1| (PREDICTED: uncharacterized protein LOC106065788 [Biomphalaria glabrata])

HSP 1 Score: 77.0258 bits (188), Expect = 8.969e-15
Identity = 40/89 (44.94%), Postives = 58/89 (65.17%), Query Frame = 0
Query:   19 SQNWHALRTTFSLLPFHG--FWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGISNDL 105
             + W+AL+TT+   PF    F   PRTE +A  +G++KIS CN+ +AF GSRY+ + D+  +V ++D NGYIAGIQ+      G+SN L
Sbjct:   28 EKTWNALKTTWGANPFSSDNFVEMPRTEEKAIKEGFVKISGCNESSAFRGSRYVKSGDYA-VVLLFDANGYIAGIQT------GVSNHL 109          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|871210918|ref|XP_012944492.1| (PREDICTED: uncharacterized protein LOC101862243 [Aplysia californica])

HSP 1 Score: 69.707 bits (169), Expect = 5.524e-12
Identity = 40/100 (40.00%), Postives = 59/100 (59.00%), Query Frame = 0
Query:    1 MKLLLIFVFLASLGAVYGSQN---WHALRTTFSLLPFHG--FWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIV 95
            ++L ++   L S  A+  S +   W+ L+ T+ L PF    F   PRTE QA S+G+ KIS C+    F G+RY+   D+  +V +YDV GYIAGIQ+ +
Sbjct:    2 LRLAVLVCALCSSHALLFSTSGGLWNNLKVTWGLNPFSSSTFVGMPRTETQAISQGFKKISSCSTTGTFRGNRYVKGNDYA-VVLLYDVKGYIAGIQASI 100          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|762098513|ref|XP_011431649.1| (PREDICTED: uncharacterized protein LOC105331236 [Crassostrea gigas])

HSP 1 Score: 69.707 bits (169), Expect = 6.222e-12
Identity = 41/95 (43.16%), Postives = 57/95 (60.00%), Query Frame = 0
Query:    3 LLLIFVFLASLGAVYGSQN--WHALRTTFSLLPFHG--FWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQS 93
            ++LI       G + GS++  W  L+ T+ + PF    F + PRTE +A+S G+  IS C   N F G RY+ N D P ++ IYDVNGYIAGIQ+
Sbjct:    9 VILIVNITICHGWLLGSKSHPWDGLKVTWGINPFSSSSFVNMPRTESEAKSSGFTMISGCGHAN-FLGKRYMKNND-PAVILIYDVNGYIAGIQA 101          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|1040778374|gb|JAS04240.1| (hypothetical protein [Pinctada fucata] >gi|1040778376|gb|JAS04241.1| hypothetical protein [Pinctada fucata])

HSP 1 Score: 68.5514 bits (166), Expect = 1.567e-11
Identity = 40/87 (45.98%), Postives = 52/87 (59.77%), Query Frame = 0
Query:   22 WHALRTTFSLLPF--HGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGISNDLS 106
            W  L+ T+ L PF  + F + PRTE  A+ + ++KI DC+  N F G RY+ + D   IV IYD NGYIAGIQ+      GI NDL 
Sbjct:   32 WDGLKVTWGLNPFNKYNFDNLPRTESDAKHQKFVKIGDCSTTNKFLGRRYVKDNDLSAIV-IYDNNGYIAGIQA------GIPNDLK 111          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|472403387|gb|AGI41318.1| (hypothetical protein [Cerebratulus lacteus])

HSP 1 Score: 67.781 bits (164), Expect = 2.385e-11
Identity = 38/92 (41.30%), Postives = 54/92 (58.70%), Query Frame = 0
Query:    3 LLLIFVFLASLGAVYGSQNWHALRTTFSLLPFHG--FWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQ 92
            LLL FV  +    ++G  +W  L  T+   PF    F   PRTE  A+S G+ K+SDC++ + F G +Y+ N D   +V ++D NGYIAGIQ
Sbjct:    6 LLLTFVACSRAWDLFGGPSWDGLAVTWGPNPFSSVYFDQLPRTESAAQSDGWTKVSDCSENSFFRGKQYMKNNDAAAVV-LFDKNGYIAGIQ 96          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|871213961|ref|XP_012934569.1| (PREDICTED: uncharacterized protein LOC101848024 [Aplysia californica])

HSP 1 Score: 66.2402 bits (160), Expect = 8.374e-11
Identity = 37/100 (37.00%), Postives = 59/100 (59.00%), Query Frame = 0
Query:    3 LLLIFVFLASLGAV-------YGSQNWHALRTTFSLLPF--HGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQS 93
            +L     LA LGA        +  + W AL+ T++  PF  + F S PRTE  A+ +G+ KIS+C+    + G RY+   D+ ++V ++DVNG+IAG+Q+
Sbjct:    1 MLTWVALLALLGASQAFLLDSFRQEKWDALKVTWNANPFASNAFNSMPRTEADAQKQGFRKISECDTSAQWRGRRYVKGDDY-SVVLLFDVNGFIAGMQT 99          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|871219897|ref|XP_005094269.2| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101854855 [Aplysia californica])

HSP 1 Score: 65.855 bits (159), Expect = 1.457e-10
Identity = 40/101 (39.60%), Postives = 61/101 (60.40%), Query Frame = 0
Query:    1 MKLLLIFVFL-----ASLGAVYGSQNWHALRTTFSL-LPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIV 95
            ++L+L+   L     A +  + G + W+ LR T+ L +P H F + PRT   A   G+ KIS CN   A+ G+RY+ + D+  +V +YDVNGYIAGIQ+ +
Sbjct:    2 LRLMLLVCMLSVSAHALIDTILGDK-WNNLRVTWGLNIPKH-FNAMPRTSSDAVEAGFKKISSCNRHAAWRGNRYVKDNDYA-VVLLYDVNGYIAGIQTSI 99          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|871211157|ref|XP_005091074.2| (PREDICTED: uncharacterized protein LOC101846787 [Aplysia californica])

HSP 1 Score: 65.0846 bits (157), Expect = 2.154e-10
Identity = 39/95 (41.05%), Postives = 60/95 (63.16%), Query Frame = 0
Query:    3 LLLIFVFLASLGAVYGSQN-WHALRTTFSL-LPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIV 95
            +LL+ +F  S  A++ S N W+ LR T+ L +P H F + PRT   A  + + KIS C+    + G+RY+ + D+  +V +YDVNGYIAGIQ+ +
Sbjct:    5 VLLVCLFCVSAHALFISGNKWNNLRVTWGLNIPKH-FNAMPRTVSDAVKQNFKKISSCDKNAKWRGNRYVKDNDYA-VVLLYDVNGYIAGIQTSI 97          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|908496327|ref|XP_013060572.1| (PREDICTED: uncharacterized protein LOC106050172 [Biomphalaria glabrata])

HSP 1 Score: 63.1586 bits (152), Expect = 7.648e-10
Identity = 40/89 (44.94%), Postives = 52/89 (58.43%), Query Frame = 0
Query:    7 FVFLASLGAVYGSQNWHALRTTF--SLLPFHGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQS 93
             +F  S  AV     W  LRTT+  S+   + F SQPRT   A ++G+ K+S C   + + G RYI N DH  IV IYDV+G IAGIQ+
Sbjct:    4 LIFTCSADAVV----WDILRTTYGPSMTGVY-FQSQPRTRSDALAQGWTKLSGCEQGSKWRGERYIRNDDH-TIVLIYDVSGNIAGIQT 86          
BLAST of EMLSAG00000000147 vs. nr
Match: gi|919022695|ref|XP_013395237.1| (PREDICTED: uncharacterized protein LOC106162480 [Lingula anatina])

HSP 1 Score: 61.2326 bits (147), Expect = 5.980e-9
Identity = 39/101 (38.61%), Postives = 55/101 (54.46%), Query Frame = 0
Query:    4 LLIFVFLASLGA--VYGSQNWHALRTTFSLLPF-HGFWSQPRTERQARSKGYIKISDCNDINAFPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGI 101
            +L F  LAS  A    G   W  L+ TF + PF + F S PRT + A S G+   S C   + F G+RYI + D   ++ ++D NGYIAGIQ+ + +  G 
Sbjct:    7 VLAFGLLASGNAWLFGGGPQWDDLKVTFGINPFGNSFSSMPRTTKDAVSDGWKLDSKCGSNSQFMGNRYIKDGDTA-VMLLFDKNGYIAGIQAGIPKKAGT 106          
BLAST of EMLSAG00000000147 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold735_size104922-snap-gene-0.23 (protein:Tk08155 transcript:maker-scaffold735_size104922-snap-gene-0.23-mRNA-1 annotation:"protein gooseberry-like isoform x2")

HSP 1 Score: 74.3294 bits (181), Expect = 4.100e-17
Identity = 38/95 (40.00%), Postives = 59/95 (62.11%), Query Frame = 0
Query:   21 NWHALRTTFSLLP-FHGFWSQPRTERQARSKGYIKISDCNDINA-FPGSRYIPNYDHPNIVFIYDVNGYIAGIQSIVDQVRGISND---LSSQPY 110
             W  LRTT++ +P   GF  QPRT+ +   +G++++S C D N  FPG R++ + D  +IV ++D NG+IAGIQ+IV   + + +     SS PY
Sbjct:  505 EWPHLRTTWAPVPGLGGFHPQPRTDAELAEEGWVQLSSCGDSNPNFPGDRFVTSADDNDIVLVFDGNGFIAGIQTIVPMDKAMDDKYFGFSSSPY 599          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000147 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000147 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 9
Match NameE-valueIdentityDescription
gi|592865464|gb|GAXK01092098.1|5.048e-1643.88TSA: Calanus finmarchicus comp77098_c1_seq2 transc... [more]
gi|592865465|gb|GAXK01092097.1|6.647e-1643.88TSA: Calanus finmarchicus comp77098_c1_seq1 transc... [more]
gi|592908602|gb|GAXK01049773.1|3.387e-1346.75TSA: Calanus finmarchicus comp31018_c2_seq1 transc... [more]
gi|592928774|gb|GAXK01029771.1|4.376e-1039.36TSA: Calanus finmarchicus comp932928_c0_seq1 trans... [more]
gi|592865463|gb|GAXK01092099.1|2.859e-450.00TSA: Calanus finmarchicus comp77098_c1_seq3 transc... [more]
gi|592764598|gb|GAXK01189970.1|7.860e-130.61TSA: Calanus finmarchicus comp263214_c1_seq2 trans... [more]
gi|592764594|gb|GAXK01189974.1|1.304e+030.61TSA: Calanus finmarchicus comp263214_c1_seq6 trans... [more]
gi|592764596|gb|GAXK01189972.1|1.364e+030.61TSA: Calanus finmarchicus comp263214_c1_seq4 trans... [more]
gi|592883730|gb|GAXK01074645.1|8.806e+034.38TSA: Calanus finmarchicus comp2284731_c0_seq1 tran... [more]
back to top
BLAST of EMLSAG00000000147 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 3
Match NameE-valueIdentityDescription
EMLSAP000000001472.679e-78100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1022:4572... [more]
EMLSAP000000096567.891e-5177.32pep:novel supercontig:LSalAtl2s:LSalAtl2s620:10836... [more]
EMLSAP000000013813.154e-940.30pep:novel supercontig:LSalAtl2s:LSalAtl2s1231:6355... [more]
back to top
BLAST of EMLSAG00000000147 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000147 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000000147 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 11
Match NameE-valueIdentityDescription
gi|908444415|ref|XP_013080143.1|8.969e-1544.94PREDICTED: uncharacterized protein LOC106065788 [B... [more]
gi|871210918|ref|XP_012944492.1|5.524e-1240.00PREDICTED: uncharacterized protein LOC101862243 [A... [more]
gi|762098513|ref|XP_011431649.1|6.222e-1243.16PREDICTED: uncharacterized protein LOC105331236 [C... [more]
gi|1040778374|gb|JAS04240.1|1.567e-1145.98hypothetical protein [Pinctada fucata] >gi|1040778... [more]
gi|472403387|gb|AGI41318.1|2.385e-1141.30hypothetical protein [Cerebratulus lacteus][more]
gi|871213961|ref|XP_012934569.1|8.374e-1137.00PREDICTED: uncharacterized protein LOC101848024 [A... [more]
gi|871219897|ref|XP_005094269.2|1.457e-1039.60PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|871211157|ref|XP_005091074.2|2.154e-1041.05PREDICTED: uncharacterized protein LOC101846787 [A... [more]
gi|908496327|ref|XP_013060572.1|7.648e-1044.94PREDICTED: uncharacterized protein LOC106050172 [B... [more]
gi|919022695|ref|XP_013395237.1|5.980e-938.61PREDICTED: uncharacterized protein LOC106162480 [L... [more]

Pages

back to top
BLAST of EMLSAG00000000147 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 1
Match NameE-valueIdentityDescription
maker-scaffold735_size104922-snap-gene-0.234.100e-1740.00protein:Tk08155 transcript:maker-scaffold735_size1... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1022supercontigLSalAtl2s1022:45727..49241 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionsnap_masked-LSalAtl2s1022-processed-gene-0.19
Biotypeprotein_coding
EvidenceIEA
NotePREDICTED: uncharacterized protein LOC106065788 [Biomphalaria glabrata]
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000147 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000147EMLSAT00000000147-695994Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1022:45727..49241+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000147-682913 ID=EMLSAG00000000147-682913|Name=EMLSAG00000000147|organism=Lepeophtheirus salmonis|type=gene|length=3515bp|location=Sequence derived from alignment at LSalAtl2s1022:45727..49241+ (Lepeophtheirus salmonis)
TAAAAGTGCAGAATAATGAAACTCCTGCTTATATTCGTCTTTTTAGCCTC CCTGGTAAGAAATAAATATTCAATACTTTTTATATTGTCTCATTAAATAA ATGATATATAATTTCAGGGTGCAGTTTATGGCTCTCAAAACTGGCACGCC CTAAGGACAACCTTTAGTCTTCTTCCCTTCCATGGATTCTGGAGTCAACC TAGGACAGAGCGTCAAGCCAGATCCAAAGGATATATCAAGATCAGCGACT GCAATGATATCAATGCGTATGTAACATACCTCTGAACATTAGTAGTTACA TTATGGATTTAATCATTATTTTAGGTTCCCTGGGAGTCGTTACATTCCAA ACTATGATCACCCCAACATTGTTTTCATTTATGATGTAAATGGATATATT GCTGGAATTCAAAGTATTGTGGATCAGGTAAGAGGAATATCAAATGATTT ATCATCACAGCCCTACTAATATGTATGTCGTCCTGATTTAACCAATAAAA AAACTCAGGATCAGGGAAAAATCCCAACTTATTTTTTTAAAATCATGTAG ATGTTACGAGGAGGCTGGAAAATCGGCCATTTTGCAAAATGCCCGGGCAA TCTGTACAATTTCCAATAGAGTGGTCAATGTTTATTTTAAATTCCTTTAC AATGTCATTTAAAATGATTCTGAGTAATATTATTACTAAACAATTCATTG TAAGCAATTTGATCATTATGGATTTAATTAACATACAATTTCATTGAACT TAAAGTAGAATTTCTAATTAAAATTGTTGCAAAATCCAAGCGCATAGAGC GCTCATAATACGCACAAAGATTGAAATATATTTGAGAGTACCTCAATTTT TCTCGGACTCTCAAAAGGATGGCAGTTTTGCTTTATTAAGCAGTTTGTCC TTGAAAAATTATATTTATATTTAGTCATAAATTGGAATAAATTTGTATTT AATGGTTTTCTTTTATATAGACATTTTCCTATTATTTTTTCTTAATAGAT TATGTGGCCCATTCAAATATTTCAAGTTGCAATGCGGCCTATTATATTAA AAGGCTTGCCATCCCTGATCTAGTATCTTTTTATTATATTCAGGCTATAA AACTCGGCCTCAGGCAAAAGGTTTTGCAGGTGGACCAAAACCTATCGCTA ACATTATCTTGAGTATTAACGACCCCTTCGAAAATATATTATAATTCGCC CCAGCCCACAGATTATGCTAGTTAACCGCTTCTCCAGAAGGGGGATCAAA ATCTATCCCCACCACTTTCCTGAGTATCAAGGACCCTTTCTAATATCCTA GTGCAAGTGGACCTCTGGTCCAAAAGGTGTAGCATTACCCACCACCACCG CTGCCTTGATCACCAAGGACACCTTTCAATATCCTATAACTTACCCAGCC CATAGGCTGTGCAAGTGAACCACRGGTCCCTGGAGCTTACTTGATACCCT TAAATATTTTTCAATGTTTGTACGGATCATGAGCAGTTTACGCGTTTTTA TGATAAGGTGACAATTTCAAATTACTCGCAATCCTTTTATCTGACAATGT AAATGAAGTTGAAATGGTCATAGATCACCCTCTACTAGAGATGTTATAGA TTCCCCGGGCATTTTGCACATTTCCCACTCTAACGTGCATTTGTACATTG ACCAACTTTCCACATGGTCCGTAACATATGCATACCATAGACGTACTTGA GTCACTAGTAGTCTCCGCATTCAGATTTTTCGTGATACCTATAAACATTA GCTGGGTCATTCCACATCAAGTGTACAACCCCTCACGGCATGAACATCAC CGATGTTCATGATTTTTGGTGAGCTGGCTTTTCTATATGACAGTGTGTGA AATATTAGGGTTCTGTGKCTCACCTGGGTAGTTCTAGGCCCGCCACAAGT TGGTCCTGATGCGTAAGACCTGTGTTGTTTAGAAGGCCATAATTCCGCTC ATAGTGGCTCGATTTTAACACAAATTACGTTGAAAGATGCACGAGAACAC AAACTTTAACTTATATTCGATCGTAATCTTATTTTAATCAAAAATAAAAG TTTGGGGTTCTGGTGCGCCTTCAAAATGGCGCCCTGCCATGCAGCAACCC CGATTTTGTTTTAATTTTCGTAGAATACGTATCAGTATATGTTTCGTAAC ATATTCAAAATTCAGAGTGGGATCTTAATGGGATCTCTTCCAACAAGAGC ATTATTTAGAGTATATAGAACCGCTTTCATAGCATATCGGTATGATTTTT TTATATTTAAACTCGGTATTTACGGCCCTCATTTTATTTATGCAACTGTA TTTGGCCCCAATAAGGCCTTTCAACTATATAGTTTATCACTTCTTAATTC TGAGTCATTGTGACGATGCATTTTAACTACTTTAATTTGCAATTTGTGCA GTCTCTAAAAAATTAATCAGAATAATTAGTTGTTGATAGAAACGGACGAC TACAATTAGTTGCAGAATACAAATGGTGAATTCAGACTCCATCTTGAAAA AAAGTCATTTTAGTTTGCTTTTGTATTGAAAAGACCACATATATACAATT TTTTAAATATATTTATATAAAATTTATGACGTAGGCTGCCTGGGACAATG GCTAKGTAAACTTCCACAACAAATCAATGTATCAGCCAAGTACTATTAAT GGAAAAGATGTTTTCCTAACCACGGCTTATTTCGTGGACCCACAAATTAT TTGCTCAACTGGAAGAACTCCTTCTCAATACAAAACCCAAGGAACAGGAT ATACACTTATTTTCCAAAATGGAGAAGATATTTCCCAAAAGAACTTGATG GAAATACCTCTAATAGAAGAAAATTTGAAGGACTCTGTAAGTGTGCCACT ATAATTAGAGTAGTAAATAATTTTAGGCACTATTAGAATGTTTTAAAAAA TAACAACATAATATAAATAGACGCAATATCTAAACAGCTTTAGGGGGAGA AAAAAAACTCAGACGCTAGAAAATGCTTATAATTTACAATTTTCACTATA ATGTCCAAACTATTGTTATACTTGTATTATTTAGGATTTTTGGAACGAAC ATCTTTGTTTCATCAACATGGGCCAGCATTATTTTAATCTTCATTAAGAT CCCGAGGAGTCCTGTGAAAATCTTTTCCCTGTTCAACTCATTTATAAAGA AGGACTTCTCCATGGATTTGTTTGGCAACACTTTGGAACTCTTCCAGGAG ATTTGTAAGTAGTTGATATATTTGGGTGTTTCTGTTGGTGCTAACATGAT TTCTATTTAATTTCAACTCTAGCMGGGASCARCCRCCAGCWCTAGCCATT AGCAAAATCATTAAGGATCCTCCAACCTATATTTTGGATGCCATTGGTAC TGTTGGACTCAGCACCATGCACATTTACTTTAAAAACTACCTGTCTATTT GTAATTAATTTTACATTACATAATTGTAACAGACTGACATTTTAAATAAA TCAATGATTTTTTTTTAATCATCGTTTCTATTTATAATGCATATATCTAT TTGATGTCATATTTT
back to top
Add to Basket