EMLSAG00000000262, EMLSAG00000000262-683028 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000262 vs. GO
Match: - (symbol:Rpl17 "ribosomal protein L17" species:10090 "Mus musculus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0005622 "intracellular" evidence=IEA] [GO:0005840 "ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0015934 "large ribosomal subunit" evidence=IEA] [GO:0022625 "cytosolic large ribosomal subunit" evidence=ISO] [GO:0030529 "ribonucleoprotein complex" evidence=IEA] [GO:0044822 "poly(A) RNA binding" evidence=ISO] InterPro:IPR001063 InterPro:IPR005721 InterPro:IPR018260 Pfam:PF00237 PROSITE:PS00464 MGI:MGI:2448270 GO:GO:0006412 GO:GO:0003735 GO:GO:0015934 Gene3D:3.90.470.10 SUPFAM:SSF54843 eggNOG:COG0091 PANTHER:PTHR11593 TIGRFAMs:TIGR01038 HOVERGEN:HBG000955 HAMAP:MF_01331_A ChiTaRS:RPL17 EMBL:AK011133 EMBL:AK011132 UniGene:Mm.276337 ProteinModelPortal:Q9CPR4 SMR:Q9CPR4 IntAct:Q9CPR4 MINT:MINT-1870116 PhosphoSite:Q9CPR4 PaxDb:Q9CPR4 PRIDE:Q9CPR4 InParanoid:Q9CPR4 PRO:PR:Q9CPR4 CleanEx:MM_RPL17 Genevestigator:Q9CPR4 Uniprot:Q9CPR4) HSP 1 Score: 41.5874 bits (96), Expect = 8.441e-5 Identity = 18/31 (58.06%), Postives = 23/31 (74.19%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEK 31 M RRTY A RIN Y+S PC IE++L +KE+ Sbjct: 125 MRRRTYRAHGRINPYMSSPCHIEMILTEKEQ 155
BLAST of EMLSAG00000000262 vs. GO
Match: - (symbol:RPL17 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0022625 "cytosolic large ribosomal subunit" evidence=IEA] InterPro:IPR001063 InterPro:IPR005721 InterPro:IPR018260 Pfam:PF00237 PROSITE:PS00464 GO:GO:0006412 GO:GO:0003735 GO:GO:0022625 Gene3D:3.90.470.10 SUPFAM:SSF54843 OMA:MHIRKAN PANTHER:PTHR11593 TIGRFAMs:TIGR01038 GeneTree:ENSGT00390000014873 OrthoDB:EOG70GMHF TreeFam:TF300042 EMBL:CU915343 Ensembl:ENSSSCT00000027450 Uniprot:I3LT81) HSP 1 Score: 41.5874 bits (96), Expect = 8.504e-5 Identity = 18/31 (58.06%), Postives = 23/31 (74.19%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEK 31 M RRTY A RIN Y+S PC IE++L +KE+ Sbjct: 124 MRRRTYRAHGRINPYMSSPCHIEMILTEKEQ 154
BLAST of EMLSAG00000000262 vs. GO
Match: - (symbol:RPL17 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0015934 "large ribosomal subunit" evidence=IEA] InterPro:IPR001063 InterPro:IPR005721 InterPro:IPR018260 Pfam:PF00237 PROSITE:PS00464 GO:GO:0006412 GO:GO:0003735 GO:GO:0015934 Gene3D:3.90.470.10 SUPFAM:SSF54843 PANTHER:PTHR11593 TIGRFAMs:TIGR01038 GeneTree:ENSGT00390000014873 OrthoDB:EOG70GMHF TreeFam:TF300042 HAMAP:MF_01331_A EMBL:AC202795 Ensembl:ENSGALT00000004252 Uniprot:F1NG53) HSP 1 Score: 41.5874 bits (96), Expect = 8.908e-5 Identity = 18/31 (58.06%), Postives = 23/31 (74.19%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEK 31 M RRTY A RIN Y+S PC IE++L +KE+ Sbjct: 126 MRRRTYRAHGRINPYMSSPCHIEMILTEKEQ 156
BLAST of EMLSAG00000000262 vs. GO
Match: - (symbol:RGD1359290 "Ac2-210" species:10116 "Rattus norvegicus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] InterPro:IPR001063 InterPro:IPR005721 InterPro:IPR018260 Pfam:PF00237 PROSITE:PS00464 RGD:1359290 GO:GO:0006412 GO:GO:0003735 GO:GO:0022625 Gene3D:3.90.470.10 SUPFAM:SSF54843 eggNOG:COG0091 HOGENOM:HOG000205045 PANTHER:PTHR11593 TIGRFAMs:TIGR01038 GeneTree:ENSGT00390000014873 HOVERGEN:HBG000955 OrthoDB:EOG70GMHF TreeFam:TF300042 EMBL:AABR06065838 EMBL:AY321338 RefSeq:NP_001041363.1 UniGene:Rn.110865 STRING:10116.ENSRNOP00000034767 Ensembl:ENSRNOT00000029782 GeneID:360649 KEGG:rno:360649 UCSC:RGD:1359290 CTD:360649 InParanoid:Q7TPJ7 NextBio:673611 Genevestigator:Q7TPJ7 Uniprot:Q7TPJ7) HSP 1 Score: 41.5874 bits (96), Expect = 1.310e-4 Identity = 18/31 (58.06%), Postives = 23/31 (74.19%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEK 31 M RRTY A RIN Y+S PC IE++L +KE+ Sbjct: 94 MRRRTYRAHGRINLYMSSPCHIEMILTEKEQ 124
BLAST of EMLSAG00000000262 vs. GO
Match: - (symbol:RGD1359290 "Ribosomal_L22 domain containing protein RGD1359290" species:10116 "Rattus norvegicus" [GO:0003735 "structural constituent of ribosome" evidence=IEA] [GO:0006412 "translation" evidence=IEA] [GO:0015934 "large ribosomal subunit" evidence=IEA] InterPro:IPR001063 InterPro:IPR005721 InterPro:IPR018260 Pfam:PF00237 PROSITE:PS00464 RGD:1359290 GO:GO:0006412 GO:GO:0003735 GO:GO:0022625 Gene3D:3.90.470.10 SUPFAM:SSF54843 eggNOG:COG0091 HOGENOM:HOG000205045 PANTHER:PTHR11593 TIGRFAMs:TIGR01038 GeneTree:ENSGT00390000014873 HOVERGEN:HBG000955 OrthoDB:EOG70GMHF TreeFam:TF300042 EMBL:AABR06065838 EMBL:AY321338 RefSeq:NP_001041363.1 UniGene:Rn.110865 STRING:10116.ENSRNOP00000034767 Ensembl:ENSRNOT00000029782 GeneID:360649 KEGG:rno:360649 UCSC:RGD:1359290 CTD:360649 InParanoid:Q7TPJ7 NextBio:673611 Genevestigator:Q7TPJ7 Uniprot:Q7TPJ7) HSP 1 Score: 41.5874 bits (96), Expect = 1.310e-4 Identity = 18/31 (58.06%), Postives = 23/31 (74.19%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEK 31 M RRTY A RIN Y+S PC IE++L +KE+ Sbjct: 94 MRRRTYRAHGRINLYMSSPCHIEMILTEKEQ 124
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592785796|gb|GAXK01168772.1| (TSA: Calanus finmarchicus comp52_c0_seq1 transcribed RNA sequence) HSP 1 Score: 45.4394 bits (106), Expect = 1.472e-6 Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAF 33 M RRTY A RIN Y+S PC IE+ LV+KE+AF Sbjct: 156 MRRRTYRAHGRINPYMSSPCHIEICLVEKEQAF 254
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592851707|gb|GAXK01105837.1| (TSA: Calanus finmarchicus comp3760062_c0_seq1 transcribed RNA sequence) HSP 1 Score: 44.669 bits (104), Expect = 2.811e-6 Identity = 21/41 (51.22%), Postives = 25/41 (60.98%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTP 41 M RRTY A RIN Y+S PC +EV+L +KE V D P Sbjct: 100 MRRRTYRAHGRINPYMSTPCHLEVILSEKEDVVSKVKDDEP 222
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592849740|gb|GAXK01107804.1| (TSA: Calanus finmarchicus comp3992595_c0_seq1 transcribed RNA sequence) HSP 1 Score: 41.9726 bits (97), Expect = 1.735e-5 Identity = 18/28 (64.29%), Postives = 22/28 (78.57%), Query Frame = 0 Query: 3 RRTYLALRRINSYLSYPCQIEVVLVKKE 30 RRTY A RIN+Y+S PC +EVVL +KE Sbjct: 389 RRTYRAHGRINAYMSNPCHVEVVLSEKE 472
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592873162|gb|GAXK01084400.1| (TSA: Calanus finmarchicus comp5236245_c0_seq1 transcribed RNA sequence) HSP 1 Score: 38.891 bits (89), Expect = 1.304e-4 Identity = 20/58 (34.48%), Postives = 32/58 (55.17%), Query Frame = 0 Query: 3 RRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPEKEKVSIKNQKLQMNNLSA 60 RRTY A RIN Y+S PC +E++L +K + + ++K+ + Q+ N SA Sbjct: 53 RRTYRAHGRINPYMSSPCHVELILSQKAEPVAKAEEEG--QKKIGRRRQQRLKNGASA 220
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592814455|gb|GAXK01140113.1| (TSA: Calanus finmarchicus comp8780814_c0_seq1 transcribed RNA sequence) HSP 1 Score: 38.1206 bits (87), Expect = 3.190e-4 Identity = 15/28 (53.57%), Postives = 21/28 (75.00%), Query Frame = 0 Query: 3 RRTYLALRRINSYLSYPCQIEVVLVKKE 30 RRTY A RIN Y+S PC +E++L +K+ Sbjct: 136 RRTYRAHGRINPYMSSPCHVELILSQKQ 219
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592935984|gb|GAXK01022569.1| (TSA: Calanus finmarchicus comp7731594_c0_seq1 transcribed RNA sequence) HSP 1 Score: 35.8094 bits (81), Expect = 1.870e-3 Identity = 14/28 (50.00%), Postives = 19/28 (67.86%), Query Frame = 0 Query: 3 RRTYLALRRINSYLSYPCQIEVVLVKKE 30 RRTY A RI Y++ PC IE++L +E Sbjct: 261 RRTYRAHGRIGPYMASPCHIELILTPRE 344
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592886996|gb|GAXK01071379.1| (TSA: Calanus finmarchicus comp7339657_c0_seq1 transcribed RNA sequence) HSP 1 Score: 34.6538 bits (78), Expect = 5.333e-3 Identity = 14/27 (51.85%), Postives = 19/27 (70.37%), Query Frame = 0 Query: 3 RRTYLALRRINSYLSYPCQIEVVLVKK 29 RRTY A RIN Y++ PC IE+++ K Sbjct: 146 RRTYRAHGRINPYMASPCHIELIMETK 226
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592757562|gb|GAXK01196851.1| (TSA: Calanus finmarchicus comp5309723_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.9574 bits (71), Expect = 8.066e-2 Identity = 15/29 (51.72%), Postives = 19/29 (65.52%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKK 29 M RRTY A RIN+Y+ P I +V V+K Sbjct: 382 MRRRTYRAHGRINAYMRNPTHINLVCVEK 468
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592862549|gb|GAXK01095013.1| (TSA: Calanus finmarchicus comp2108352_c0_seq1 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 3.697e-1 Identity = 11/24 (45.83%), Postives = 16/24 (66.67%), Query Frame = 0 Query: 3 RRTYLALRRINSYLSYPCQIEVVL 26 RRTY A RI+ + S PC +E++ Sbjct: 190 RRTYRAHGRISRFASNPCHVELIC 261
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Match: gi|592874593|gb|GAXK01082969.1| (TSA: Calanus finmarchicus comp656107_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.365e+0 Identity = 12/23 (52.17%), Postives = 15/23 (65.22%), Query Frame = 0 Query: 41 PEKEKVSIKNQKLQMNNLSAHDE 63 PE K +KNQK Q +LSA+ E Sbjct: 72 PESYKYLLKNQKFQTQSLSANPE 140
BLAST of EMLSAG00000000262 vs. L. salmonis peptides
Match: EMLSAP00000000262 (pep:novel supercontig:LSalAtl2s:LSalAtl2s103:1234959:1237071:-1 gene:EMLSAG00000000262 transcript:EMLSAT00000000262 description:"snap_masked-LSalAtl2s103-processed-gene-12.0") HSP 1 Score: 138.658 bits (348), Expect = 2.880e-44 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPEKEKVSIKNQKLQMNNLSAHDEDNEI 67 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPEKEKVSIKNQKLQMNNLSAHDEDNEI Sbjct: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPEKEKVSIKNQKLQMNNLSAHDEDNEI 67
BLAST of EMLSAG00000000262 vs. L. salmonis peptides
Match: EMLSAP00000006484 (pep:novel supercontig:LSalAtl2s:LSalAtl2s354:78083:78928:-1 gene:EMLSAG00000006484 transcript:EMLSAT00000006484 description:"augustus_masked-LSalAtl2s354-processed-gene-0.5") HSP 1 Score: 65.0846 bits (157), Expect = 8.312e-15 Identity = 30/42 (71.43%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPE 42 M RRTY A RIN Y+S PC IEVVLV+KE+AF VPSDTPE Sbjct: 125 MRRRTYRAHGRINPYMSSPCHIEVVLVEKEQAFSKVPSDTPE 166
BLAST of EMLSAG00000000262 vs. nr
Match: gi|225714586|gb|ACO13139.1| (60S ribosomal protein L17 [Lepeophtheirus salmonis]) HSP 1 Score: 64.6994 bits (156), Expect = 2.264e-11 Identity = 30/42 (71.43%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPE 42 M RRTY A RIN Y+S PC IEVVLV+KE+AF VPSDTPE Sbjct: 125 MRRRTYRAHGRINPYMSSPCHIEVVLVEKEQAFSKVPSDTPE 166
BLAST of EMLSAG00000000262 vs. nr
Match: gi|225711442|gb|ACO11567.1| (60S ribosomal protein L17 [Caligus rogercresseyi]) HSP 1 Score: 59.3066 bits (142), Expect = 3.008e-9 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPE 42 M RRTY A RIN Y+S PC IEVVL++KE++F VP++TPE Sbjct: 125 MRRRTYRAHGRINPYMSSPCHIEVVLLEKEQSFSKVPTETPE 166
BLAST of EMLSAG00000000262 vs. nr
Match: gi|225718404|gb|ACO15048.1| (60S ribosomal protein L17 [Caligus clemensi]) HSP 1 Score: 55.8398 bits (133), Expect = 6.220e-8 Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPE 42 M RRTY A RIN Y+S PC IEVVLV+KE+AF V + PE Sbjct: 125 MRRRTYRAHGRINPYMSSPCHIEVVLVEKEQAFSKVAPEAPE 166
BLAST of EMLSAG00000000262 vs. nr
Match: gi|748384555|gb|KIH58838.1| (hypothetical protein ANCDUO_10947 [Ancylostoma duodenale]) HSP 1 Score: 50.8322 bits (120), Expect = 5.542e-7 Identity = 25/55 (45.45%), Postives = 32/55 (58.18%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAFFNVPSDTPEKEKVSIKNQKLQM 55 M RRTY A RIN Y+S PC IEV+L +KE D P +K S + Q+ Q+ Sbjct: 1 MRRRTYRAHGRINPYMSSPCHIEVILTEKEDVVAKPSDDIPRAKKESKRKQRRQL 55
BLAST of EMLSAG00000000262 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold505_size153196-snap-gene-0.21 (protein:Tk06001 transcript:maker-scaffold505_size153196-snap-gene-0.21-mRNA-1 annotation:"60s ribosomal protein l17") HSP 1 Score: 44.2838 bits (103), Expect = 2.496e-7 Identity = 21/33 (63.64%), Postives = 24/33 (72.73%), Query Frame = 0 Query: 1 MIRRTYLALRRINSYLSYPCQIEVVLVKKEKAF 33 M RRTY A RIN Y+S PC IEV LV+KE+ F Sbjct: 242 MRRRTYRAHGRINPYMSSPCHIEVCLVEKEQTF 274 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000262 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 25
Pagesback to top
BLAST of EMLSAG00000000262 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 11
Pagesback to top
BLAST of EMLSAG00000000262 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 2
BLAST of EMLSAG00000000262 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000262 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000262 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 4
BLAST of EMLSAG00000000262 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 1
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s103:1234959..1237071- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000262-683028 ID=EMLSAG00000000262-683028|Name=EMLSAG00000000262|organism=Lepeophtheirus salmonis|type=gene|length=2113bp|location=Sequence derived from alignment at LSalAtl2s103:1234959..1237071- (Lepeophtheirus salmonis)back to top Add to Basket
|