EMLSAG00000000393, EMLSAG00000000393-683159 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592931096|gb|GAXK01027457.1| (TSA: Calanus finmarchicus comp340638_c0_seq4 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.297e+0 Identity = 22/77 (28.57%), Postives = 37/77 (48.05%), Query Frame = 0 Query: 18 YRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEIINTL-----FFDITIFFYLVLVQYDH 89 YR +HIP LLK++ +K+ V+ +C W + F L E+ + + F+++ + YLV V DH Sbjct: 353 YREIHIPLLLKVD------DKI------------VQAHCKWVLVFGMLVEVYDMMAFSSSFYEVLVLHYLVCVWVDH 529
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592931097|gb|GAXK01027456.1| (TSA: Calanus finmarchicus comp340638_c0_seq3 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.323e+0 Identity = 22/77 (28.57%), Postives = 37/77 (48.05%), Query Frame = 0 Query: 18 YRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEIINTL-----FFDITIFFYLVLVQYDH 89 YR +HIP LLK++ +K+ V+ +C W + F L E+ + + F+++ + YLV V DH Sbjct: 395 YREIHIPLLLKVD------DKI------------VQAHCKWVLVFGMLVEVYDMMAFSSSFYEVLVLHYLVCVWVDH 571
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592931098|gb|GAXK01027455.1| (TSA: Calanus finmarchicus comp340638_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.423e+0 Identity = 22/77 (28.57%), Postives = 37/77 (48.05%), Query Frame = 0 Query: 18 YRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEIINTL-----FFDITIFFYLVLVQYDH 89 YR +HIP LLK++ +K+ V+ +C W + F L E+ + + F+++ + YLV V DH Sbjct: 353 YREIHIPLLLKVD------DKI------------VQAHCKWVLVFGMLVEVYDMMAFSSSFYEVLVLHYLVCVWVDH 529
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592931099|gb|GAXK01027454.1| (TSA: Calanus finmarchicus comp340638_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.437e+0 Identity = 22/77 (28.57%), Postives = 37/77 (48.05%), Query Frame = 0 Query: 18 YRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEIINTL-----FFDITIFFYLVLVQYDH 89 YR +HIP LLK++ +K+ V+ +C W + F L E+ + + F+++ + YLV V DH Sbjct: 395 YREIHIPLLLKVD------DKI------------VQAHCKWVLVFGMLVEVYDMMAFSSSFYEVLVLHYLVCVWVDH 571
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592911850|gb|GAXK01046525.1| (TSA: Calanus finmarchicus comp6449650_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.748e+0 Identity = 19/56 (33.93%), Postives = 30/56 (53.57%), Query Frame = 0 Query: 3 NYFVDILLSNDIFKLYRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVW 58 N +D L N+ +KL FLH+ + +INI H N+ ++K+ +SI R W Sbjct: 4 NDNLDFLSCNEQWKLDLFLHVYRASEINIVH---NQEVWIKNCGPSSIAARIPFSW 162
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592898026|gb|GAXK01060349.1| (TSA: Calanus finmarchicus comp1085429_c1_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.936e+0 Identity = 10/26 (38.46%), Postives = 18/26 (69.23%), Query Frame = 0 Query: 35 FANKMCYVKSNCRNSIKVRTYCVWDM 60 F NK +V+ NC +++RT+ +WD+ Sbjct: 1261 FRNK--FVQENCHRDVEIRTWDMWDI 1332
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592907285|gb|GAXK01051090.1| (TSA: Calanus finmarchicus comp7464170_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.482e+0 Identity = 11/31 (35.48%), Postives = 19/31 (61.29%), Query Frame = 0 Query: 23 IPKLLKININHFFANKMCYVKSNCRNSIKVR 53 I +LK+ ++ F N+M +K NC+ S+ R Sbjct: 26 IKSILKLKLSIFIENRMTIIKVNCQTSVSPR 118
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592794534|gb|GAXK01160034.1| (TSA: Calanus finmarchicus comp142628_c4_seq4 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 9.990e+0 Identity = 22/77 (28.57%), Postives = 41/77 (53.25%), Query Frame = 0 Query: 5 FVDILLSNDIFKLYRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEII---NTLFFDITI 78 F+ + N + K+ +L+ LK+N+ + +V + R+S KV ++ +W +CFLH I +TLF I++ Sbjct: 530 FLTLFTYNRVGKISFYLYHKFTLKMNLPQMTPH---HVPQSTRSS*KV-SWTIWALCFLHFFAFIVAGHTLFGYISL 748
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Match: gi|592794536|gb|GAXK01160032.1| (TSA: Calanus finmarchicus comp142628_c4_seq2 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 9.996e+0 Identity = 22/77 (28.57%), Postives = 41/77 (53.25%), Query Frame = 0 Query: 5 FVDILLSNDIFKLYRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEII---NTLFFDITI 78 F+ + N + K+ +L+ LK+N+ + +V + R+S KV ++ +W +CFLH I +TLF I++ Sbjct: 530 FLTLFTYNRVGKISFYLYHKFTLKMNLPQMTPH---HVPQSTRSS*KV-SWTIWALCFLHFFAFIVAGHTLFGYISL 748
BLAST of EMLSAG00000000393 vs. L. salmonis peptides
Match: EMLSAP00000000393 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1062:309188:316519:1 gene:EMLSAG00000000393 transcript:EMLSAT00000000393 description:"maker-LSalAtl2s1062-snap-gene-2.24") HSP 1 Score: 197.208 bits (500), Expect = 2.514e-66 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0 Query: 1 MKNYFVDILLSNDIFKLYRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEIINTLFFDITIFFYLVLVQYDHGKECRKDS 97 MKNYFVDILLSNDIFKLYRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEIINTLFFDITIFFYLVLVQYDHGKECRKDS Sbjct: 1 MKNYFVDILLSNDIFKLYRFLHIPKLLKININHFFANKMCYVKSNCRNSIKVRTYCVWDMCFLHLEEIINTLFFDITIFFYLVLVQYDHGKECRKDS 97 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000393 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000393 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 9
BLAST of EMLSAG00000000393 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000393 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000393 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000393 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000393 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1062:309188..316519+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000393-683159 ID=EMLSAG00000000393-683159|Name=EMLSAG00000000393|organism=Lepeophtheirus salmonis|type=gene|length=7332bp|location=Sequence derived from alignment at LSalAtl2s1062:309188..316519+ (Lepeophtheirus salmonis)back to top Add to Basket
|