EMLSAG00000000441, EMLSAG00000000441-683207 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000441
Unique NameEMLSAG00000000441-683207
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
C F40 PGES2 female
  1. PreAdult2
no visible phenotype
no visible phenotype
14.08.2012 - 11:00
24.09.2012 (All day)
Molecular characterization and knock-down of... more
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
Q F173 PGES female
  1. PreAdult2
-Missing-
-Missing-
10.06.2014 - 15:30
NAI F227, F226 F227, F226 unknown
  1. Nauplius1
-Missing-
-Missing-
03.11.2015 - 16:00
10.11.2015 (All day)
AF F264 441, 12943, 6733 female
  1. PreAdult2
-Missing-
-Missing-
27.04.2016 - 09:53
08.06.2016 - 09:53
AF F263 441, 12943 female
  1. PreAdult2
-Missing-
-Missing-
27.04.2016 - 09:53
08.06.2016 - 09:53
Homology
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:CELE_R11A8.5 "Protein R11A8.5" species:6239 "Caenorhabditis elegans" [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] InterPro:IPR004045 InterPro:IPR011767 Pfam:PF13417 PROSITE:PS00195 PROSITE:PS50404 GO:GO:0009055 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0045454 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 EMBL:Z70310 PROSITE:PS50405 eggNOG:NOG316980 HOGENOM:HOG000231901 KO:K05309 OMA:AMYFISK OrthoDB:EOG7060R5 GeneTree:ENSGT00390000000224 PIR:T24175 RefSeq:NP_501913.1 UniGene:Cel.12478 ProteinModelPortal:Q21925 SMR:Q21925 STRING:6239.R11A8.5 PaxDb:Q21925 PRIDE:Q21925 EnsemblMetazoa:R11A8.5 GeneID:177925 KEGG:cel:CELE_R11A8.5 UCSC:R11A8.5 CTD:177925 WormBase:R11A8.5 InParanoid:Q21925 NextBio:898984 PRO:PR:Q21925 Uniprot:Q21925)

HSP 1 Score: 92.4337 bits (228), Expect = 2.525e-21
Identity = 42/57 (73.68%), Postives = 47/57 (82.46%), Query Frame = 0
Query:  104 DKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPIL 160
            DK+ LKL LYQY TCPFCCKVRAFLDY G SY++VEVN V R +IK+S  YKKVPIL
Sbjct:   60 DKSNLKLRLYQYETCPFCCKVRAFLDYHGFSYEVVEVNPVTRSQIKFSTTYKKVPIL 116          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:Su(P) "Suppressor of ref(2)P sterility" species:7227 "Drosophila melanogaster" [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] InterPro:IPR002109 InterPro:IPR011767 Pfam:PF00462 PROSITE:PS00195 PROSITE:PS51354 GO:GO:0009055 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 eggNOG:NOG316980 OrthoDB:EOG7060R5 EMBL:AJ250307 EMBL:AJ011320 ProteinModelPortal:O77287 PRIDE:O77287 FlyBase:FBgn0004465 InParanoid:O77287 Uniprot:O77287)

HSP 1 Score: 92.8189 bits (229), Expect = 2.861e-21
Identity = 54/151 (35.76%), Postives = 84/151 (55.63%), Query Frame = 0
Query:   20 SPLASTSPRCYASSSSPSKMSTSP----RLALGGVSVA---GGLYALYNFWPTQSQSSQIVQMNPDS-EPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            +P A+ + R +A +         P    +LA+ G +V    G +Y +Y  W   S   +  +  P   + IP  +     Y +       P+D + L + L+Q+ TCPFCCKVRAFLDY GISY +VEV++V R++I+WS + KKVP+++I
Sbjct:   34 NPDAAFARRQFAVAVENGGGRKKPNGTFKLAVLGATVGAATGSVYTMYQRWTDGSSHKEHEETKPTRLDGIPAGVRITKRYVN-------PKDTSGLDIVLFQFQTCPFCCKVRAFLDYMGISYAVVEVDAVLRQDIRWS-SVKKVPMVLI 176          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:ptgesl "prostaglandin E synthase 2-like" species:7955 "Danio rerio" [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0050220 "prostaglandin-E synthase activity" evidence=IEA] [GO:0016829 "lyase activity" evidence=IEA;ISS] [GO:0043295 "glutathione binding" evidence=ISS] [GO:0020037 "heme binding" evidence=ISS] [GO:0006629 "lipid metabolic process" evidence=IEA] [GO:0006693 "prostaglandin metabolic process" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0006631 "fatty acid metabolic process" evidence=IEA] [GO:0001516 "prostaglandin biosynthetic process" evidence=IEA] [GO:0016853 "isomerase activity" evidence=IEA] [GO:0006633 "fatty acid biosynthetic process" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] InterPro:IPR002109 InterPro:IPR004045 InterPro:IPR011767 Pfam:PF13417 PROSITE:PS00195 PROSITE:PS51354 ZFIN:ZDB-GENE-040426-1063 GO:GO:0009055 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 PROSITE:PS50405 HOGENOM:HOG000231901 HOVERGEN:HBG069136 OMA:AMYFISK OrthoDB:EOG7060R5 TreeFam:TF314304 GeneTree:ENSGT00390000000224 EMBL:BX640472 ProteinModelPortal:B0S751 SMR:B0S751 Ensembl:ENSDART00000129882 PRO:PR:B0S751 ArrayExpress:B0S751 Uniprot:B0S751)

HSP 1 Score: 87.0409 bits (214), Expect = 2.963e-19
Identity = 41/57 (71.93%), Postives = 47/57 (82.46%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            T LKLTLYQY TCPFC KVRAFLDY  + Y+IVEVN V R+EIKWS  Y+KVPIL++
Sbjct:  104 TDLKLTLYQYKTCPFCSKVRAFLDYHRLPYEIVEVNPVMRQEIKWS-TYRKVPILMV 159          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:PTGES2 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IEA] [GO:0046903 "secretion" evidence=IEA] InterPro:IPR002109 InterPro:IPR004045 InterPro:IPR011767 Pfam:PF13417 PROSITE:PS00195 PROSITE:PS51354 GO:GO:0005829 GO:GO:0005739 GO:GO:0005634 GO:GO:0045893 GO:GO:0009055 GO:GO:0003677 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 GO:GO:0046903 PROSITE:PS50405 OMA:AMYFISK OrthoDB:EOG7060R5 TreeFam:TF314304 GeneTree:ENSGT00390000000224 EMBL:AADN03007335 Ensembl:ENSGALT00000007631 Uniprot:F1NG33)

HSP 1 Score: 83.1889 bits (204), Expect = 4.847e-18
Identity = 39/54 (72.22%), Postives = 47/54 (87.04%), Query Frame = 0
Query:  108 LKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            L+LTLYQY TCPFC KVRAFLDY G+ Y+IVEVN + RKEIK+S +Y+KVPIL+
Sbjct:   87 LQLTLYQYKTCPFCSKVRAFLDYHGLPYEIVEVNPIMRKEIKFS-SYRKVPILL 139          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:PTGES2 "Prostaglandin E synthase 2" species:9541 "Macaca fascicularis" [GO:0016829 "lyase activity" evidence=IDA] [GO:0020037 "heme binding" evidence=IDA] [GO:0043295 "glutathione binding" evidence=IDA] InterPro:IPR002109 Pfam:PF00462 PROSITE:PS00195 PROSITE:PS51354 UniPathway:UPA00662 GO:GO:0016021 GO:GO:0048471 GO:GO:0000139 GO:GO:0009055 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0020037 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 GO:GO:0016829 PROSITE:PS50405 GO:GO:0043295 GO:GO:0001516 GO:GO:0050220 HOVERGEN:HBG069136 EMBL:AB046026 EMBL:AB169647 EMBL:AY805118 UniGene:Mfa.2850 PDB:1Z9H PDB:2PBJ PDBsum:1Z9H PDBsum:2PBJ ProteinModelPortal:Q9N0A4 SMR:Q9N0A4 PRIDE:Q9N0A4 EvolutionaryTrace:Q9N0A4 Uniprot:Q9N0A4)

HSP 1 Score: 80.4925 bits (197), Expect = 5.729e-17
Identity = 37/56 (66.07%), Postives = 46/56 (82.14%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            ++L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   98 SRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVLRAEIKFS-SYRKVPILV 152          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:PTGES2 "Prostaglandin E synthase 2" species:9606 "Homo sapiens" [GO:0000139 "Golgi membrane" evidence=IEA] [GO:0001516 "prostaglandin biosynthetic process" evidence=IEA] [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IDA] [GO:0005829 "cytosol" evidence=IEA] [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016829 "lyase activity" evidence=ISS] [GO:0020037 "heme binding" evidence=ISS] [GO:0043295 "glutathione binding" evidence=ISS] [GO:0045454 "cell redox homeostasis" evidence=IEA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IEA] [GO:0046903 "secretion" evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm" evidence=IEA] [GO:0050220 "prostaglandin-E synthase activity" evidence=IEA] InterPro:IPR002109 InterPro:IPR004045 Pfam:PF13417 PROSITE:PS00195 PROSITE:PS51354 UniPathway:UPA00662 GO:GO:0016021 GO:GO:0005829 GO:GO:0005739 GO:GO:0005634 GO:GO:0048471 GO:GO:0045893 GO:GO:0000139 GO:GO:0009055 GO:GO:0003677 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0020037 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 GO:GO:0046903 GO:GO:0016829 EMBL:AL590708 PROSITE:PS50405 GO:GO:0043295 GO:GO:0001516 eggNOG:NOG316980 BRENDA:5.3.99.3 GO:GO:0050220 EMBL:AK024100 EMBL:AK223520 EMBL:BC009397 EMBL:BC009456 EMBL:BC011613 RefSeq:NP_001243264.1 RefSeq:NP_079348.1 RefSeq:NP_945176.1 UniGene:Hs.495219 ProteinModelPortal:Q9H7Z7 SMR:Q9H7Z7 BioGrid:123135 IntAct:Q9H7Z7 STRING:9606.ENSP00000345341 BindingDB:Q9H7Z7 ChEMBL:CHEMBL4411 PhosphoSite:Q9H7Z7 DMDM:73921741 PaxDb:Q9H7Z7 PRIDE:Q9H7Z7 DNASU:80142 Ensembl:ENST00000338961 GeneID:80142 KEGG:hsa:80142 UCSC:uc004bti.4 CTD:80142 GeneCards:GC09M130882 HGNC:HGNC:17822 HPA:HPA020631 MIM:608152 neXtProt:NX_Q9H7Z7 PharmGKB:PA33949 HOGENOM:HOG000231901 HOVERGEN:HBG069136 InParanoid:Q9H7Z7 KO:K05309 OMA:AMYFISK OrthoDB:EOG7060R5 TreeFam:TF314304 BioCyc:MetaCyc:HS07514-MONOMER ChiTaRS:PTGES2 GeneWiki:PTGES2 GenomeRNAi:80142 NextBio:70401 PRO:PR:Q9H7Z7 ArrayExpress:Q9H7Z7 Bgee:Q9H7Z7 CleanEx:HS_PTGES2 Genevestigator:Q9H7Z7 Uniprot:Q9H7Z7)

HSP 1 Score: 79.7221 bits (195), Expect = 1.157e-16
Identity = 37/56 (66.07%), Postives = 46/56 (82.14%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            ++L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   98 SRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFS-SYRKVPILV 152          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:Ptges2 "Protein Ptges2" species:10116 "Rattus norvegicus" [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IEA] [GO:0046903 "secretion" evidence=IEA] InterPro:IPR002109 InterPro:IPR004045 Pfam:PF13417 PROSITE:PS51354 RGD:1310836 GO:GO:0005829 GO:GO:0005739 GO:GO:0005634 GO:GO:0045893 GO:GO:0009055 GO:GO:0003677 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 GO:GO:0046903 EMBL:CH474001 CTD:80142 KO:K05309 OMA:AMYFISK OrthoDB:EOG7060R5 TreeFam:TF314304 GeneTree:ENSGT00390000000224 EMBL:AABR06022193 RefSeq:NP_001101302.1 UniGene:Rn.39290 Ensembl:ENSRNOT00000019184 GeneID:311865 KEGG:rno:311865 UCSC:RGD:1310836 NextBio:664369 PRO:PR:D4AE56 Uniprot:D4AE56)

HSP 1 Score: 78.5666 bits (192), Expect = 3.731e-16
Identity = 37/56 (66.07%), Postives = 45/56 (80.36%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
             +L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   97 NRLQLTLYQYKTCPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIKFS-SYRKVPILV 151          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:Ptges2 "prostaglandin E synthase 2" species:10116 "Rattus norvegicus" [GO:0003677 "DNA binding" evidence=IEA;ISO] [GO:0005634 "nucleus" evidence=IEA;ISO] [GO:0005739 "mitochondrion" evidence=IEA;ISO] [GO:0005829 "cytosol" evidence=IEA;ISO] [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IEA;ISO] [GO:0046903 "secretion" evidence=IEA;ISO] InterPro:IPR002109 InterPro:IPR004045 Pfam:PF13417 PROSITE:PS51354 RGD:1310836 GO:GO:0005829 GO:GO:0005739 GO:GO:0005634 GO:GO:0045893 GO:GO:0009055 GO:GO:0003677 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 GO:GO:0046903 EMBL:CH474001 CTD:80142 KO:K05309 OMA:AMYFISK OrthoDB:EOG7060R5 TreeFam:TF314304 GeneTree:ENSGT00390000000224 EMBL:AABR06022193 RefSeq:NP_001101302.1 UniGene:Rn.39290 Ensembl:ENSRNOT00000019184 GeneID:311865 KEGG:rno:311865 UCSC:RGD:1310836 NextBio:664369 PRO:PR:D4AE56 Uniprot:D4AE56)

HSP 1 Score: 78.5666 bits (192), Expect = 3.731e-16
Identity = 37/56 (66.07%), Postives = 45/56 (80.36%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
             +L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   97 NRLQLTLYQYKTCPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIKFS-SYRKVPILV 151          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:PTGES2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0003677 "DNA binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IEA] [GO:0046903 "secretion" evidence=IEA] InterPro:IPR002109 InterPro:IPR004045 Pfam:PF13417 PROSITE:PS51354 GO:GO:0005829 GO:GO:0005739 GO:GO:0005634 GO:GO:0045893 GO:GO:0009055 GO:GO:0003677 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0055114 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 GO:GO:0046903 PROSITE:PS50405 OMA:AMYFISK OrthoDB:EOG7060R5 TreeFam:TF314304 GeneTree:ENSGT00390000000224 EMBL:AAEX03006858 Ensembl:ENSCAFT00000031972 Uniprot:F1P9X4)

HSP 1 Score: 78.1814 bits (191), Expect = 4.599e-16
Identity = 36/56 (64.29%), Postives = 46/56 (82.14%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            ++L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPIL+
Sbjct:   97 SRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFS-SYRKVPILL 151          
BLAST of EMLSAG00000000441 vs. GO
Match: - (symbol:Ptges2 "prostaglandin E synthase 2" species:10090 "Mus musculus" [GO:0001516 "prostaglandin biosynthetic process" evidence=IEA] [GO:0003677 "DNA binding" evidence=IDA] [GO:0005634 "nucleus" evidence=IDA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0005739 "mitochondrion" evidence=ISO;IDA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0005829 "cytosol" evidence=IDA] [GO:0006629 "lipid metabolic process" evidence=IEA] [GO:0006631 "fatty acid metabolic process" evidence=IEA] [GO:0006633 "fatty acid biosynthetic process" evidence=IEA] [GO:0006693 "prostaglandin metabolic process" evidence=IEA] [GO:0009055 "electron carrier activity" evidence=IEA] [GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0016829 "lyase activity" evidence=IEA] [GO:0016853 "isomerase activity" evidence=IEA] [GO:0045454 "cell redox homeostasis" evidence=IEA] [GO:0045893 "positive regulation of transcription, DNA-templated" evidence=IDA] [GO:0046903 "secretion" evidence=IDA] [GO:0050220 "prostaglandin-E synthase activity" evidence=IEA] InterPro:IPR002109 InterPro:IPR004045 Pfam:PF13417 PROSITE:PS00195 PROSITE:PS51354 UniPathway:UPA00662 MGI:MGI:1917592 GO:GO:0016021 GO:GO:0005829 GO:GO:0005739 GO:GO:0005634 GO:GO:0045893 GO:GO:0000139 GO:GO:0009055 GO:GO:0003677 Gene3D:3.40.30.10 InterPro:IPR012336 SUPFAM:SSF52833 GO:GO:0020037 GO:GO:0055114 EMBL:CH466542 GO:GO:0045454 GO:GO:0015035 Gene3D:1.20.1050.10 InterPro:IPR010987 SUPFAM:SSF47616 GO:GO:0046903 GO:GO:0016829 GO:GO:0043295 GO:GO:0001516 eggNOG:NOG316980 GO:GO:0050220 CTD:80142 HOGENOM:HOG000231901 HOVERGEN:HBG069136 KO:K05309 OMA:AMYFISK OrthoDB:EOG7060R5 TreeFam:TF314304 EMBL:AK050616 EMBL:AL928669 EMBL:BC004846 RefSeq:NP_598544.2 UniGene:Mm.28048 ProteinModelPortal:Q8BWM0 SMR:Q8BWM0 IntAct:Q8BWM0 MINT:MINT-4113056 PhosphoSite:Q8BWM0 PaxDb:Q8BWM0 PRIDE:Q8BWM0 Ensembl:ENSMUST00000028162 GeneID:96979 KEGG:mmu:96979 UCSC:uc008jfm.2 GeneTree:ENSGT00390000000224 InParanoid:A2ASQ2 NextBio:352423 PRO:PR:Q8BWM0 Bgee:Q8BWM0 CleanEx:MM_PTGES2 Genevestigator:Q8BWM0 Uniprot:Q8BWM0)

HSP 1 Score: 77.411 bits (189), Expect = 8.514e-16
Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 0
Query:  108 LKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   99 LQLTLYQYKTCPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIKFS-SYRKVPILV 151          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592850183|gb|GAXK01107361.1| (TSA: Calanus finmarchicus comp37087_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 78.5666 bits (192), Expect = 2.446e-16
Identity = 50/103 (48.54%), Postives = 65/103 (63.11%), Query Frame = 0
Query:   60 YNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDXXXXXXXXXXXXXCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            YN+    +QS  I  +  DS+    +L  APP       I  P     +K+TL+QY TCPFCCK R FLDYFG +YD++EVNSV R ++KWS  YKKVPI+V+
Sbjct:  853 YNYKKKLAQS--IKSIGNDSQTKEFLLESAPPDFPPIRSISTPGLVQDIKITLFQYQTCPFCCKARVFLDYFGFNYDVIEVNSVMRTQVKWS-KYKKVPIVVV 1152          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592834083|gb|GAXK01123461.1| (TSA: Calanus finmarchicus comp7584003_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 31.5722 bits (70), Expect = 5.265e-1
Identity = 9/26 (34.62%), Postives = 18/26 (69.23%), Query Frame = 0
Query:  118 CPFCCKVRAFLDYFGISYDIVEVNSV 143
            CP+C K +  L+  G+ Y+++E++ V
Sbjct:   67 CPYCTKAKNVLNGIGVKYEVIELDQV 144          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592944480|gb|GAXK01014073.1| (TSA: Calanus finmarchicus comp8056_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.631e+0
Identity = 9/26 (34.62%), Postives = 17/26 (65.38%), Query Frame = 0
Query:  118 CPFCCKVRAFLDYFGISYDIVEVNSV 143
            CPFC K++   D   I Y+++E++ +
Sbjct:  481 CPFCVKIKQLFDSLKIKYEVLELDQI 558          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592944471|gb|GAXK01014082.1| (TSA: Calanus finmarchicus comp8056_c3_seq3 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.633e+0
Identity = 9/26 (34.62%), Postives = 17/26 (65.38%), Query Frame = 0
Query:  118 CPFCCKVRAFLDYFGISYDIVEVNSV 143
            CPFC K++   D   I Y+++E++ +
Sbjct: 1870 CPFCVKIKQLFDSLKIKYEVLELDQI 1947          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592944481|gb|GAXK01014072.1| (TSA: Calanus finmarchicus comp8056_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.637e+0
Identity = 9/26 (34.62%), Postives = 17/26 (65.38%), Query Frame = 0
Query:  118 CPFCCKVRAFLDYFGISYDIVEVNSV 143
            CPFC K++   D   I Y+++E++ +
Sbjct:  530 CPFCVKIKQLFDSLKIKYEVLELDQI 607          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592944479|gb|GAXK01014074.1| (TSA: Calanus finmarchicus comp8056_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.738e+0
Identity = 9/26 (34.62%), Postives = 17/26 (65.38%), Query Frame = 0
Query:  118 CPFCCKVRAFLDYFGISYDIVEVNSV 143
            CPFC K++   D   I Y+++E++ +
Sbjct:  102 CPFCVKIKQLFDSLKIKYEVLELDQI 179          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592944472|gb|GAXK01014081.1| (TSA: Calanus finmarchicus comp8056_c3_seq2 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.780e+0
Identity = 9/26 (34.62%), Postives = 17/26 (65.38%), Query Frame = 0
Query:  118 CPFCCKVRAFLDYFGISYDIVEVNSV 143
            CPFC K++   D   I Y+++E++ +
Sbjct: 1870 CPFCVKIKQLFDSLKIKYEVLELDQI 1947          
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Match: gi|592944473|gb|GAXK01014080.1| (TSA: Calanus finmarchicus comp8056_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 31.187 bits (69), Expect = 1.783e+0
Identity = 9/26 (34.62%), Postives = 17/26 (65.38%), Query Frame = 0
Query:  118 CPFCCKVRAFLDYFGISYDIVEVNSV 143
            CPFC K++   D   I Y+++E++ +
Sbjct: 1870 CPFCVKIKQLFDSLKIKYEVLELDQI 1947          
BLAST of EMLSAG00000000441 vs. L. salmonis peptides
Match: EMLSAP00000000441 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1068:94054:97506:1 gene:EMLSAG00000000441 transcript:EMLSAT00000000441 description:"maker-LSalAtl2s1068-snap-gene-1.22")

HSP 1 Score: 331.643 bits (849), Expect = 2.586e-117
Identity = 162/162 (100.00%), Postives = 162/162 (100.00%), Query Frame = 0
Query:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI
Sbjct:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162          
BLAST of EMLSAG00000000441 vs. SwissProt
Match: gi|73921740|sp|Q7ZUC7.1|PGES2_DANRE (RecName: Full=Prostaglandin E synthase 2; AltName: Full=Microsomal prostaglandin E synthase 2; Short=mPGES-2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.409e-19
Identity = 41/57 (71.93%), Postives = 47/57 (82.46%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            T LKLTLYQY TCPFC KVRAFLDY  + Y+IVEVN V R+EIKWS  Y+KVPIL++
Sbjct:  103 TDLKLTLYQYKTCPFCSKVRAFLDYHRLPYEIVEVNPVMRQEIKWS-TYRKVPILMV 158          
BLAST of EMLSAG00000000441 vs. SwissProt
Match: gi|73921742|sp|Q9N0A4.1|PGES2_MACFA (RecName: Full=Prostaglandin E synthase 2; AltName: Full=Microsomal prostaglandin E synthase 2; Short=mPGES-2; Contains: RecName: Full=Prostaglandin E synthase 2 truncated form)

HSP 1 Score: 80.4925 bits (197), Expect = 2.614e-17
Identity = 37/56 (66.07%), Postives = 46/56 (82.14%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            ++L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   98 SRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVLRAEIKFS-SYRKVPILV 152          
BLAST of EMLSAG00000000441 vs. SwissProt
Match: gi|73921741|sp|Q9H7Z7.1|PGES2_HUMAN (RecName: Full=Prostaglandin E synthase 2; AltName: Full=Membrane-associated prostaglandin E synthase-2; Short=mPGE synthase-2; AltName: Full=Microsomal prostaglandin E synthase 2; Short=mPGES-2; AltName: Full=Prostaglandin-H(2) E-isomerase; Contains: RecName: Full=Prostaglandin E synthase 2 truncated form)

HSP 1 Score: 79.7221 bits (195), Expect = 5.245e-17
Identity = 37/56 (66.07%), Postives = 46/56 (82.14%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            ++L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   98 SRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFS-SYRKVPILV 152          
BLAST of EMLSAG00000000441 vs. SwissProt
Match: gi|341942199|sp|Q8BWM0.3|PGES2_MOUSE (RecName: Full=Prostaglandin E synthase 2; AltName: Full=GATE-binding factor 1; Short=GBF-1; AltName: Full=Microsomal prostaglandin E synthase 2; Short=mPGES-2; Contains: RecName: Full=Prostaglandin E synthase 2 truncated form)

HSP 1 Score: 77.411 bits (189), Expect = 3.673e-16
Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 0
Query:  108 LKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPILV
Sbjct:   99 LQLTLYQYKTCPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIKFS-SYRKVPILV 151          
BLAST of EMLSAG00000000441 vs. SwissProt
Match: gi|978128212|sp|Q66LN0.3|PGES2_BOVIN (RecName: Full=Prostaglandin E synthase 2; AltName: Full=Membrane-associated prostaglandin E synthase-2; Short=mPGE synthase-2; AltName: Full=Microsomal prostaglandin E synthase 2; Short=mPGES-2; Contains: RecName: Full=Prostaglandin E synthase 2 truncated form)

HSP 1 Score: 76.6406 bits (187), Expect = 6.742e-16
Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 0
Query:  106 TKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            ++L+LTLYQY TCPFC KVRAFLD+  + Y +VEVN V R EIK+S +Y+KVPI++
Sbjct:   95 SRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFS-SYRKVPIVM 149          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: gb|EFA00341.1| (Prostaglandin E synthase 2-like Protein [Tribolium castaneum])

HSP 1 Score: 114.775 bits (286), Expect = 3.587e-30
Identity = 64/139 (46.04%), Postives = 83/139 (59.71%), Query Frame = 0
Query:   23 ASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
               S R Y +  S   +    +L L GV+V   +   Y+          I+     + PI   LP+  P  +    +R+PED++ LKLTL+QY TCPFCCKVRAFLDY+GISYD+VEV+ V R+ IKWSP YKKVPILV
Sbjct:   31 GGVSFRNYTTHRS---LKGVFKLGLAGVTVGALVGTGYSIHRLNQPRGHIIN-EETAIPILEELPKIAPSRE----VRFPEDRSGLKLTLFQYQTCPFCCKVRAFLDYYGISYDVVEVDPVLRQSIKWSP-YKKVPILV 160          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: XP_016770046.1 (PREDICTED: prostaglandin E synthase 2 [Apis mellifera])

HSP 1 Score: 101.679 bits (252), Expect = 3.640e-25
Identity = 59/136 (43.38%), Postives = 83/136 (61.03%), Query Frame = 0
Query:   31 ASSSSPSKMSTSPRLALGGVSVA---GGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAP--PYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            ++S   S + T  + +L G+S+    G +      W    ++++   +    + I  +L E P  P + + +    P D T+LKLTL+QY TCPFCCKVR FLDY+GISYDIVEV+ V RKEI WS +YKKVPIL+
Sbjct:   33 SASRQSSLLKTIFKASLVGISIGFPVGIIITTGYSWYINKKAAKTYHLEGKEKKIK-VLQEKPSVPVSREVVS---PMDSTELKLTLFQYQTCPFCCKVRVFLDYYGISYDIVEVDPVLRKEISWS-SYKKVPILL 163          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: gb|KFM64768.1| (Prostaglandin E synthase 2, partial [Stegodyphus mimosarum])

HSP 1 Score: 99.3673 bits (246), Expect = 1.095e-24
Identity = 58/134 (43.28%), Postives = 84/134 (62.69%), Query Frame = 0
Query:   31 ASSSSPSKMSTSPRLAL--GGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSE-PIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            +S++  S +S   + AL  GG+SV GGLY  Y   P +   +Q   +   ++  I + +P+  P      +I  P     L+LTLYQY TCPFCCKVRAFL+++GI Y+++EVN V R++IK+S  YKKVPIL+
Sbjct:   60 SSTNIGSGLSRFSKFALIIGGLSVGGGLYG-YLASPNKKARTQAQALTEKTDYTINYDIPDIKPSR----QISGPAADLGLELTLYQYQTCPFCCKVRAFLEFYGIPYNVIEVNPVMRQQIKFSK-YKKVPILI 187          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: AAF49434.1 (suppressor of ref(2)P sterility [Drosophila melanogaster])

HSP 1 Score: 93.2041 bits (230), Expect = 5.062e-22
Identity = 54/151 (35.76%), Postives = 84/151 (55.63%), Query Frame = 0
Query:   20 SPLASTSPRCYASSSSPSKMSTSP----RLALGGVSVA---GGLYALYNFWPTQSQSSQIVQMNPDS-EPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            +P A+ + R +A +         P    +LA+ G +V    G +Y +Y  W   S   +  +  P   + IP  +     Y +       P+D + L + L+Q+ TCPFCCKVRAFLDY GISY +VEV++V R++I+WS + KKVP+++I
Sbjct:   34 NPDAAFARRQFAVAVENGGGRKKPNGTFKLAVLGATVGAATGSVYTMYQRWTDGSSHKEHEETKPTRLDGIPAGVRITKRYVN-------PKDTSGLDIVLFQFQTCPFCCKVRAFLDYMGISYAVVEVDAVLRQDIRWS-SVKKVPMVLI 176          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: gb|EEC15523.1| (glutathione S-transferase, putative [Ixodes scapularis])

HSP 1 Score: 91.6633 bits (226), Expect = 6.659e-22
Identity = 40/61 (65.57%), Postives = 52/61 (85.25%), Query Frame = 0
Query:  102 PEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            P  KT LK+T++QY TCPFCCKVRAFLDY+GI YD++EVN V R+++K+S  YKKVPIL++
Sbjct:   37 PTTKTGLKITMFQYQTCPFCCKVRAFLDYYGIPYDVIEVNPVLRQQLKFS-EYKKVPILLV 96          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: EEB19583.1 (Prostaglandin E synthase 2, putative [Pediculus humanus corporis])

HSP 1 Score: 92.4337 bits (228), Expect = 8.502e-22
Identity = 51/118 (43.22%), Postives = 73/118 (61.86%), Query Frame = 0
Query:   44 RLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            +L +  V V   L A Y F+ T+ ++ +++    D   + + L E+ P       +   +D   L LTL+QY TCPFCCKVRAFLDY+GI Y++VEVN VFR++  W+  YKKVPIL+
Sbjct:   46 KLLVAAVPVTA-LGAGYYFYGTKKENDELLN-EYDIRNVEYQLLESKPNVPIARTVNKSKDDLNLNLTLFQYPTCPFCCKVRAFLDYYGIPYEVVEVNPVFRQQTSWTT-YKKVPILL 160          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: EAA10500.4 (AGAP004992-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 89.7373 bits (221), Expect = 6.241e-21
Identity = 53/145 (36.55%), Postives = 83/145 (57.24%), Query Frame = 0
Query:   28 RCYASSSSPSKMSTSPRLALGGVSVA---GGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPE--APPYNDKC------IKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            R  A+ ++P K +++  LA+ G+++    G  ++ Y+++                 P  H+L E   P   DK        K+  P D + L L L+Q+ TCPFCCKVRAFLD+ G+SY +VEV++V R++I+WS + KKVPIL+
Sbjct:   31 RRMATGAAPKKPTSTLGLAVKGMAIGALVGTGWSGYSYFK--------------GGPTDHMLHEHVGPKVLDKLPDVKIMRKVVNPNDDSGLDLVLFQFQTCPFCCKVRAFLDHSGLSYSVVEVDAVLRQDIRWSDS-KKVPILL 160          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: gb|KPM08698.1| (prostaglandin E synthase 2-like protein, partial [Sarcoptes scabiei])

HSP 1 Score: 85.1149 bits (209), Expect = 3.768e-19
Identity = 36/55 (65.45%), Postives = 46/55 (83.64%), Query Frame = 0
Query:  108 LKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            LKLTL+QY  CPFC KVR FLDY+G+ YDI+EVN V R++IK+S  Y+KVPIL++
Sbjct:   91 LKLTLFQYQNCPFCSKVRVFLDYYGLPYDIIEVNPVMRQQIKFSKKYRKVPILLV 145          
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Match: EFX75129.1 (putative prostaglandin E2 synthase, partial [Daphnia pulex])

HSP 1 Score: 70.8626 bits (172), Expect = 1.772e-14
Identity = 29/56 (51.79%), Postives = 43/56 (76.79%), Query Frame = 0
Query:   97 IKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSP 152
            +++   +D + L+LTL+QY  CPFC KVRA+LD+ G+SYD+VEVN V +K++ WS 
Sbjct:    5 LQVEGNKDTSNLQLTLFQYEPCPFCKKVRAYLDFAGLSYDVVEVNPVTKKQLNWSA 60          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|927034276|gb|ALD65882.1| (prostaglandin E synthase 2 [Lepeophtheirus salmonis])

HSP 1 Score: 336.265 bits (861), Expect = 1.516e-113
Identity = 161/162 (99.38%), Postives = 162/162 (100.00%), Query Frame = 0
Query:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV+
Sbjct:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVV 162          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|225712934|gb|ACO12313.1| (Prostaglandin E synthase 2 [Lepeophtheirus salmonis])

HSP 1 Score: 315.849 bits (808), Expect = 5.533e-109
Identity = 153/157 (97.45%), Postives = 155/157 (98.73%), Query Frame = 0
Query:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKV 157
            MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSK+STSPRLALGGVSVAGGL ALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQY TCPFCCKVRAFLDYFGISYDIVEVNSVFRKE+KWSPNYKKV
Sbjct:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSSPSKLSTSPRLALGGVSVAGGLCALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYATCPFCCKVRAFLDYFGISYDIVEVNSVFRKEVKWSPNYKKV 157          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|225711624|gb|ACO11658.1| (Prostaglandin E synthase 2 [Caligus rogercresseyi])

HSP 1 Score: 170.629 bits (431), Expect = 8.209e-49
Identity = 98/165 (59.39%), Postives = 113/165 (68.48%), Query Frame = 0
Query:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSS-PSKMSTSPRLALGGVSVAGGLYALY--NFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            MNHK+S  L R       P  L ++S RC A  SS P     +PR AL    +      L   +FWP   Q  + +Q  PDSEPI  ILP APPYNDK  KIRYPEDK+ LK+TLYQYTTCPFCCKVRAFLDY+G+SYDIVEVNSVF+KEIKWS +YKKVPILV+
Sbjct:    1 MNHKVSTLLCR-----RVPKWLCASSVRCIAQDSSKPPTTGFTPRQALVAGGLGLAGGLLAYSSFWP---QGIRNLQTAPDSEPISPILPLAPPYNDKRKKIRYPEDKSALKITLYQYTTCPFCCKVRAFLDYYGVSYDIVEVNSVFKKEIKWSNDYKKVPILVV 157          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|225710158|gb|ACO10925.1| (Prostaglandin E synthase 2 [Caligus rogercresseyi])

HSP 1 Score: 167.162 bits (422), Expect = 1.913e-47
Identity = 97/165 (58.79%), Postives = 113/165 (68.48%), Query Frame = 0
Query:    1 MNHKLSKFLGRISSAYSPPSPLASTSPRCYASSSS--PSKMSTSPRLALGGVSVAGGLYALYN-FWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            MNHK+S  L R       P  L ++S RC A  SS  PS   T  ++ + G     G    Y+ FWP   Q  + +Q  PDSEPI  ILP APPYNDK  KIRYPEDK+ LK+TL QYTTCPFCCKVRAFLDY+G+SYDIVEVNSVF+KEIKWS +YKKVPILV+
Sbjct:    1 MNHKVSTLLCR-----RVPKWLCASSVRCIAQDSSKPPSTGFTPRQVLVAGGLGLAGGLLAYSSFWP---QGIRNLQTAPDSEPISPILPLAPPYNDKRKKIRYPEDKSALKITLCQYTTCPFCCKVRAFLDYYGVSYDIVEVNSVFKKEIKWSNDYKKVPILVV 157          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|693673429|gb|AIS40910.1| (prostaglandin E synthase 2 [Anasa tristis])

HSP 1 Score: 120.939 bits (302), Expect = 5.285e-31
Identity = 63/133 (47.37%), Postives = 92/133 (69.17%), Query Frame = 0
Query:   32 SSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCI--KIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            +S  P+K ++  +LA   ++ AGG+ A   +  +Q++      +NP +E    +L + P   D  I  ++ YP D + LKLTL+QYTTCPFCCKVRAFLDY+GISYDIVEVN VFR+++KW+ +YKKVP+L++
Sbjct:   38 NSQKPTKNTSKLKLAF--LATAGGIGAGTAYAYSQNKERNAAILNPVNESAVSLLDKFP---DVKISKRVTYPTDSSGLKLTLFQYTTCPFCCKVRAFLDYYGISYDIVEVNPVFRQQMKWT-DYKKVPVLLV 164          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|939630590|ref|XP_014278364.1| (PREDICTED: prostaglandin E synthase 2 [Halyomorpha halys])

HSP 1 Score: 115.931 bits (289), Expect = 7.004e-28
Identity = 58/126 (46.03%), Postives = 87/126 (69.05%), Query Frame = 0
Query:   37 SKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            SK+  +   A  G++  G +Y++Y     Q+   +   +NP  E    IL ++P   +   K+RYP D + LK+ L+QYTTCPFCCKVRAFLD++GISYD+VEV+SVFR+++KW+ +YKKVPI+++
Sbjct:   47 SKVKIALIAAASGIT-TGTVYSVY-----QTNQQRTALLNPVQEKTITILDKSPNV-EITKKVRYPTDSSGLKIILFQYTTCPFCCKVRAFLDFYGISYDLVEVDSVFRQQLKWT-DYKKVPIVLV 164          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|91078348|ref|XP_973652.1| (PREDICTED: prostaglandin E synthase 2 [Tribolium castaneum] >gi|270003893|gb|EFA00341.1| Prostaglandin E synthase 2-like Protein [Tribolium castaneum])

HSP 1 Score: 114.775 bits (286), Expect = 1.755e-27
Identity = 64/139 (46.04%), Postives = 83/139 (59.71%), Query Frame = 0
Query:   23 ASTSPRCYASSSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
               S R Y +  S   +    +L L GV+V   +   Y+          I+     + PI   LP+  P  +    +R+PED++ LKLTL+QY TCPFCCKVRAFLDY+GISYD+VEV+ V R+ IKWSP YKKVPILV
Sbjct:   31 GGVSFRNYTTHRS---LKGVFKLGLAGVTVGALVGTGYSIHRLNQPRGHIIN-EETAIPILEELPKIAPSRE----VRFPEDRSGLKLTLFQYQTCPFCCKVRAFLDYYGISYDVVEVDPVLRQSIKWSP-YKKVPILV 160          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|1069779995|ref|XP_018319954.1| (PREDICTED: prostaglandin E synthase 2 [Agrilus planipennis])

HSP 1 Score: 114.775 bits (286), Expect = 1.940e-27
Identity = 65/132 (49.24%), Postives = 84/132 (63.64%), Query Frame = 0
Query:   33 SSSPSKMSTSPRLALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHIL--PEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            +SS  K  +  +L L GV++ G +   Y+        + I+    +   IP I   PE PP      KIR P D++ LKLTLYQY TCPFCCKVRAFLDY+GISYD++EV+ V R+ IKWSP YKKVPIL++
Sbjct:   37 TSSAKKSRSFVKLGLVGVTLGGVIGTGYSIHQLNQPKTHILN---EEVAIPLIENPPEIPPSK----KIRIPGDQSGLKLTLYQYQTCPFCCKVRAFLDYYGISYDVIEVDPVLRQSIKWSP-YKKVPILLV 160          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|1061112250|ref|XP_017882173.1| (PREDICTED: prostaglandin E synthase 2 [Ceratina calcarata])

HSP 1 Score: 112.079 bits (279), Expect = 2.027e-26
Identity = 69/145 (47.59%), Postives = 86/145 (59.31%), Query Frame = 0
Query:   27 PRCYASSSSPSKMSTSPRLALG--------GVSVAGGLYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAP--PYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILV 161
            PR + S  S S+ S++ +  L         G  V   + + YN W    Q+S+   +    E I  +L E P  P + K +   +P D + LKLTLYQY TCPFCCKVR FLDYFGISYDIVEV+ V RKEI WSP YKKVPIL+
Sbjct:   25 PRRHESFMSTSRQSSTLKTVLKASLVGISIGFPVGIVITSGYN-WYVSKQTSKRFHLQGKEERI-QVLQEKPTVPISRKIV---FPVDTSDLKLTLYQYQTCPFCCKVRVFLDYFGISYDIVEVDPVLRKEISWSP-YKKVPILL 163          
BLAST of EMLSAG00000000441 vs. nr
Match: gi|514995454|gb|AGO64145.1| (prostaglandin E synthase [Gammarus sp. KV-2010a])

HSP 1 Score: 112.464 bits (280), Expect = 2.442e-26
Identity = 68/157 (43.31%), Postives = 90/157 (57.32%), Query Frame = 0
Query:   17 SPPSPLASTSPRCYASSSSPSKMSTSPR-------LALGGVSVAGGLYALYNFWPTQSQSSQIVQMNPDS----EPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            S P PL S   RCYA  +  +++   P        + +G V     + AL  F+   +   ++ +         +P+P+ L E PP       +  P DK+ LKLTLYQY TCPFCCKVRAFLDY+G SYD+VEVNS+ RK+IKWS  YKKVP LV+
Sbjct:   42 SRPFPLHSC--RCYAQKAKAAEIKEMPADKRKMKYIVMGAVGFGAYIVALI-FYEKAALDERLKEERRAKSLTMQPLPY-LQEPPPTPAIARSVYNPNDKSGLKLTLYQYQTCPFCCKVRAFLDYYGFSYDVVEVNSITRKDIKWS-EYKKVPALVV 193          
BLAST of EMLSAG00000000441 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1136_size60149-snap-gene-0.9 (protein:Tk09876 transcript:maker-scaffold1136_size60149-snap-gene-0.9-mRNA-1 annotation:"prostaglandin e synthase 2")

HSP 1 Score: 109.768 bits (273), Expect = 2.974e-29
Identity = 59/134 (44.03%), Postives = 80/134 (59.70%), Query Frame = 0
Query:   31 ASSSSPSKMSTSPRLALGGVSVAGG--LYALYNFWPTQSQSSQIVQMNPDSEPIPHILPEAPPYNDKCIKIRYPEDKTKLKLTLYQYTTCPFCCKVRAFLDYFGISYDIVEVNSVFRKEIKWSPNYKKVPILVI 162
            A    P + S   +  +GG  V  G  +Y  Y FW  Q    QI   NP +    +++ E  P      K+  P D + LKLTL+QY  CPFCCK RA LDY+G++YD++EVNSV +K++KWS +YKKVPILV+
Sbjct:   47 AGGGQPKRGSFLLQTIVGGAVVGTGYAMYQNYGFW-NQGPQKQIA--NPQNSLEDYLMKEELPEFKVARKMINPLDHSGLKLTLFQYQPCPFCCKTRAMLDYYGLNYDVIEVNSVTKKQVKWS-DYKKVPILVV 176          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000441 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 13
Match NameE-valueIdentityDescription
-2.525e-2173.68symbol:CELE_R11A8.5 "Protein R11A8.5" species:6239... [more]
-2.861e-2135.76symbol:Su(P) "Suppressor of ref(2)P sterility" spe... [more]
-2.963e-1971.93symbol:ptgesl "prostaglandin E synthase 2-like" sp... [more]
-4.847e-1872.22symbol:PTGES2 "Uncharacterized protein" species:90... [more]
-5.729e-1766.07symbol:PTGES2 "Prostaglandin E synthase 2" species... [more]
-1.157e-1666.07symbol:PTGES2 "Prostaglandin E synthase 2" species... [more]
-3.731e-1666.07symbol:Ptges2 "Protein Ptges2" species:10116 "Ratt... [more]
-3.731e-1666.07symbol:Ptges2 "prostaglandin E synthase 2" species... [more]
-4.599e-1664.29symbol:PTGES2 "Uncharacterized protein" species:96... [more]
-8.514e-1668.52symbol:Ptges2 "prostaglandin E synthase 2" species... [more]

Pages

back to top
BLAST of EMLSAG00000000441 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 8
Match NameE-valueIdentityDescription
gi|592850183|gb|GAXK01107361.1|2.446e-1648.54TSA: Calanus finmarchicus comp37087_c1_seq1 transc... [more]
gi|592834083|gb|GAXK01123461.1|5.265e-134.62TSA: Calanus finmarchicus comp7584003_c0_seq1 tran... [more]
gi|592944480|gb|GAXK01014073.1|1.631e+034.62TSA: Calanus finmarchicus comp8056_c0_seq2 transcr... [more]
gi|592944471|gb|GAXK01014082.1|1.633e+034.62TSA: Calanus finmarchicus comp8056_c3_seq3 transcr... [more]
gi|592944481|gb|GAXK01014072.1|1.637e+034.62TSA: Calanus finmarchicus comp8056_c0_seq1 transcr... [more]
gi|592944479|gb|GAXK01014074.1|1.738e+034.62TSA: Calanus finmarchicus comp8056_c0_seq3 transcr... [more]
gi|592944472|gb|GAXK01014081.1|1.780e+034.62TSA: Calanus finmarchicus comp8056_c3_seq2 transcr... [more]
gi|592944473|gb|GAXK01014080.1|1.783e+034.62TSA: Calanus finmarchicus comp8056_c3_seq1 transcr... [more]
back to top
BLAST of EMLSAG00000000441 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 1
Match NameE-valueIdentityDescription
EMLSAP000000004412.586e-117100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1068:9405... [more]
back to top
BLAST of EMLSAG00000000441 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
gi|73921740|sp|Q7ZUC7.1|PGES2_DANRE1.409e-1971.93RecName: Full=Prostaglandin E synthase 2; AltName:... [more]
gi|73921742|sp|Q9N0A4.1|PGES2_MACFA2.614e-1766.07RecName: Full=Prostaglandin E synthase 2; AltName:... [more]
gi|73921741|sp|Q9H7Z7.1|PGES2_HUMAN5.245e-1766.07RecName: Full=Prostaglandin E synthase 2; AltName:... [more]
gi|341942199|sp|Q8BWM0.3|PGES2_MOUSE3.673e-1668.52RecName: Full=Prostaglandin E synthase 2; AltName:... [more]
gi|978128212|sp|Q66LN0.3|PGES2_BOVIN6.742e-1662.50RecName: Full=Prostaglandin E synthase 2; AltName:... [more]
back to top
BLAST of EMLSAG00000000441 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 9
Match NameE-valueIdentityDescription
gb|EFA00341.1|3.587e-3046.04Prostaglandin E synthase 2-like Protein [Tribolium... [more]
XP_016770046.13.640e-2543.38PREDICTED: prostaglandin E synthase 2 [Apis mellif... [more]
gb|KFM64768.1|1.095e-2443.28Prostaglandin E synthase 2, partial [Stegodyphus m... [more]
AAF49434.15.062e-2235.76suppressor of ref(2)P sterility [Drosophila melano... [more]
gb|EEC15523.1|6.659e-2265.57glutathione S-transferase, putative [Ixodes scapul... [more]
EEB19583.18.502e-2243.22Prostaglandin E synthase 2, putative [Pediculus hu... [more]
EAA10500.46.241e-2136.55AGAP004992-PA [Anopheles gambiae str. PEST][more]
gb|KPM08698.1|3.768e-1965.45prostaglandin E synthase 2-like protein, partial [... [more]
EFX75129.11.772e-1451.79putative prostaglandin E2 synthase, partial [Daphn... [more]
back to top
BLAST of EMLSAG00000000441 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|927034276|gb|ALD65882.1|1.516e-11399.38prostaglandin E synthase 2 [Lepeophtheirus salmoni... [more]
gi|225712934|gb|ACO12313.1|5.533e-10997.45Prostaglandin E synthase 2 [Lepeophtheirus salmoni... [more]
gi|225711624|gb|ACO11658.1|8.209e-4959.39Prostaglandin E synthase 2 [Caligus rogercresseyi][more]
gi|225710158|gb|ACO10925.1|1.913e-4758.79Prostaglandin E synthase 2 [Caligus rogercresseyi][more]
gi|693673429|gb|AIS40910.1|5.285e-3147.37prostaglandin E synthase 2 [Anasa tristis][more]
gi|939630590|ref|XP_014278364.1|7.004e-2846.03PREDICTED: prostaglandin E synthase 2 [Halyomorpha... [more]
gi|91078348|ref|XP_973652.1|1.755e-2746.04PREDICTED: prostaglandin E synthase 2 [Tribolium c... [more]
gi|1069779995|ref|XP_018319954.1|1.940e-2749.24PREDICTED: prostaglandin E synthase 2 [Agrilus pla... [more]
gi|1061112250|ref|XP_017882173.1|2.027e-2647.59PREDICTED: prostaglandin E synthase 2 [Ceratina ca... [more]
gi|514995454|gb|AGO64145.1|2.442e-2643.31prostaglandin E synthase [Gammarus sp. KV-2010a][more]

Pages

back to top
BLAST of EMLSAG00000000441 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 1
Match NameE-valueIdentityDescription
maker-scaffold1136_size60149-snap-gene-0.92.974e-2944.03protein:Tk09876 transcript:maker-scaffold1136_size... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1068supercontigLSalAtl2s1068:94054..97506 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s1068-snap-gene-1.22
Biotypeprotein_coding
EvidenceIEA
Noteprostaglandin E synthase 2 [Lepeophtheirus salmonis]
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000441 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000441EMLSAT00000000441-696288Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1068:94054..97506+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000441-683207 ID=EMLSAG00000000441-683207|Name=EMLSAG00000000441|organism=Lepeophtheirus salmonis|type=gene|length=3453bp|location=Sequence derived from alignment at LSalAtl2s1068:94054..97506+ (Lepeophtheirus salmonis)
CAATAACATAAGTCGAAGATTAATAATAATTAAAGGACCCTAGAGTCCTT TAATAACGCAAGTACATAATATATGTTCAGCTGATTCCTGTGAAAACAGT AGCTGGACACTTATGTAAACAAGTACGTTACAAAATTTATTTTTTTATAA GTAATATTCTCGTGACGTCACTCTGGTTCTAGTCAGTCTCGCTACATTTT TTTGGTGTATCGATTTATTTTTAAAAATTAGAAATAAATATTATTTTGGA TTATCAAATAAACAGCCGGATAAAGTAAGGAAATTCTAACTTCTGCATAT AATTATTTCTACAATTTAATTAACAGTATTTTATTTATTTTAGTGGATAA TTTATGGTAATGAGGCTTACATAATCAGTTGAATGAAATTAAGTACAACT ATTATTACATAAGCAGTAAAAAGAAGTAATGAATCACAAGCTATCCAAAT TTCTTGGTCGGATATCCTCCGCATACTCGCCGCCATCACCGCTTGCTTCA ACATCCCCCAGATGCTATGCATCTTCCTCTTCGCCATCGAAAATGAGTAC CTCACCTCGACTAGCCCTTGGGGGTGTGAGTGTTGCGGGAGGACTCTATG CTCTATACAACTTTTGGCCAACTCAAAGTCAATCATCACAGATCGTTCAA ATGAATCCTGACTCAGAGCCTATCCCTCATATCCTGCCGGAGGCTCCTCC CTATAATGATAAATGTATAAAGATTCGCTATCCGGAGGATAAAACAAAAT TAAAGCTCACATTATATCAAGTGAATTTAGTTTGGAGAAATTAGACTAAT TAATTATATAATGAATATCCTTCTTTCAGTATACAACATGCCCATTCTGC TGTAAAGTGAGGGCTTTTCTGGATTACTTTGGCATCAGCTATGATATTGT AGAGGTGAATTCCGTTTTTAGAAAAGAGATTAAATGGTCACCTAACTATA AAAAGGTTCCTATTTTAGTGGTAAAAACTCCACAAGGGGACTTTTTGCAG CTCAATGATTCAACTATGATTATTTCTGCACTTATGACCTATTTGAAGGA GCCTTCTAAAAGTAAGTAAAAAGATATACTGGGATCAAATGAGTATACAC ATTTCATTACTTTTCCCTTTCAAAAATGTATATCATTTACATTTAAATGT AGACCACAGTATGGGCCATTAAACTGTATAAATTTCATTCAATTTATTTA CTACTAGATGAATGACTAAGTGTATACCTCATTCAACGACAGAGATGTCA TTTTGACGTATAAAATTACCGAATTTATTATTGCCAAATCGAGGAAGTTA TAAAACACTTGTATTGGCCAAAGTCACAAACTAACTTTAGTAMTATATAG CCTAGCCATTGTTATTTACTACATTTTTTGTTATATTATAATATATTAAT AAGTCATGTAATTTCTTAATCATATTGTCAATTTGTAAGTTTCTGTGAAT AGTGTGTGAATTTATGGATTTTAAAAAGGTTTTCTTTGATGAACTGTAGG AGTCATGTCTTCTTCTTTTTTTTGATTTTTTTAACCTCTCCGTATCTTCA AGCAGAATTGTGCATTGTAACTCATTGATAAACCTAGCCATATAATTTTG AGTATTAATAAGTCTAATAGTTTCAATATATTAAATCAAATTTGTGGCTT ATATTTAAAAATCAAAATTGTGAATGGGTTAAAAGAACATCTTAGCCTTT CTAGTGTTAAGGGATTCTATGTTTTTGGGGGGCAATTTATGCTTTAAAAA AGATACAAGGAAAAAAACATTCAAATTAAAGTTCCTGGAGCTTAAATAAA TAAAATAAAAAATATATGGTTAACTTTTTATATTAAAATAGATGAAATAA TAACTCTTTTTTTTAAATAAACTTATATAGGAAAGGGTAAATTTAAAGAT AATTAACTTTAGTATAAATATAAAGCAAAGATTTTTTAGATGAAGATAAA CTATAATTTTGTTTTTAATTCATTATTCATTTTTTGTAGTAGTCAACGAA AAACTGTAGTAGAACCATTTCATCCCAGGGTTGCACACTGACTTTTTGCA TTTAATTGTAATTTTCAAGGTTTTATTTCTTCTTAAATGAATGCTGCCTG GGTGGATATCTTAAGACCTGTAATGCTATCAAGCAAACATGAAACATTTT AAAAGTTTACACAATTTCTTTGGATAAATCTCTAACCCAAAAGTTAGCCN GCCTAGGGTGGATATCTTAAGACCTGTAATGCTATCAAGCAAACATGAAA CATTTTAAAAGTTTACACAATTTCTTTGGATAAATCTCTAACCCAAAAGT TAGCCCGTTTAACCCCATCGTGCCCTACSTAMTMACTTCKTATAGYATAC RTTGTTTAATATTCAAAAATTTCATTTTCTTCGTGGTTTTTTTTTTTCAG ATCTGAAAGATATAGTCGAATGCTATCCACAAGTTACAAATACTGACCCA AGTAGTGGTAAATCCACTATTGAAATTCGCAATAAGTATTTTATTATGCA TCAAAATGACTCTGTTAATGATAAAAATCTGAAAGAAGAACTAAAGTGGA GAAAATGGGTTGATAGTGTTTTGTACATCGTATTAGCCCCAACGTGTATC GAAGTTTATCCGAGTCCATAGAGGCATTTCATTGGTTTGACACTGCGGGT AATTGGAAGAATGTTTTTAATACATTTGAACGTCAAGTTGTTATATACTT GGGAGCTTCCGTTATGTGGATTCTGGGAAAAGTGCTTAAGAAAAGACATG GMCTTCCGGATGACGTGAGGGAAGCCATATATCACGAAGTGAATAACTAT CTATCTCATGTGAAGAAAAAAGGTGGATCATTTGGTGGCGGAGAAGTCCC GGATTTAGCGGATATTTCTTTTTACGGTACTTTAAACTCATTTGAGGGAT GCGCTGCCTTTCAAGATGTACTAAGTCATACTGAACTTAGACAATGGTTT ACGAAGATGAAATGGGCTGTGAGCTCTCGAGCTGGCGGKTCTAGTATTTA ATTCATTATAATTAGACAAATTGTATGTATCATACAGTTTTTATTTGGGT AAATGCACATTTGAGCAATAAAATAGTTAACGATGGGACTTTTCACCACA GTCCTTTATTTCTTTAAGTGAATGTCTGACCAATGTTTTAGCAGACTTTA TCACATTTTGATGTTTCTGATTTGTGATAAAACATAATATTTTACCTATT TTAAGTAGTAAAGTATTATTTCATAAGTTAAGTTATAACTGCATAGATGA AATAAAATTGCGCTCATCTGTTAATTTCATATTTGGATAATGTATTACGT ATGATTTTCTAGTCAATTATAATTGAATTATTAAAACATGGTTTTACCGT TTAATCGACAATTGGTTAATTCACAAATTTCTTGTCTCATTATGAAAATG TATATAATAAGTGCATAATCTCATTATTTTCCAATAGATTGATACTTTCC CAG
back to top
Add to Basket