EMLSAG00000000543, EMLSAG00000000543-683309 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885522|gb|GAXK01072853.1| (TSA: Calanus finmarchicus comp431532_c1_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.806e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 887 HCSCILVTMLPTLLYNQRHP 946
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885513|gb|GAXK01072862.1| (TSA: Calanus finmarchicus comp431532_c1_seq10 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.084e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 544 HCSCILVTMLPTLLYNQRHP 603
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885519|gb|GAXK01072856.1| (TSA: Calanus finmarchicus comp431532_c1_seq4 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 2.225e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 887 HCSCILVTMLPTLLYNQRHP 946
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592889187|gb|GAXK01069188.1| (TSA: Calanus finmarchicus comp972762_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 4.882e+0 Identity = 15/50 (30.00%), Postives = 20/50 (40.00%), Query Frame = 0 Query: 4 CNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSC 53 C +PG + VM V VCN W + +S + I S C C Sbjct: 229 CRPSPGTDRSGQVMGYEVSGVCNDWSLACQASVTACAVSCIAHSSYRCWC 378
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592798956|gb|GAXK01155612.1| (TSA: Calanus finmarchicus comp105552_c9_seq2 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.078e+0 Identity = 14/42 (33.33%), Postives = 23/42 (54.76%), Query Frame = 0 Query: 11 KKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCS 52 +KL + M H +D+SS+SI+ K IC++ +CS Sbjct: 4552 QKLLVNHWSMEHGDVRTLLYLDISSFSILNVKVICNNVGYCS 4677
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592798957|gb|GAXK01155611.1| (TSA: Calanus finmarchicus comp105552_c9_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.079e+0 Identity = 14/42 (33.33%), Postives = 23/42 (54.76%), Query Frame = 0 Query: 11 KKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCS 52 +KL + M H +D+SS+SI+ K IC++ +CS Sbjct: 4552 QKLLVNHWSMEHGDVRTLLYLDISSFSILNVKVICNNVGYCS 4677
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592801758|gb|GAXK01152810.1| (TSA: Calanus finmarchicus comp403419_c3_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 9.338e+0 Identity = 10/38 (26.32%), Postives = 19/38 (50.00%), Query Frame = 0 Query: 8 PGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFIC 45 PGK ++ + +H + N W ++D ++ H F C Sbjct: 742 PGKDSQ*RLLVMNMHCMRNCWSMVDYVTWKFFSHTFCC 855
BLAST of EMLSAG00000000543 vs. L. salmonis peptides
Match: EMLSAP00000000543 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1089:95639:99073:1 gene:EMLSAG00000000543 transcript:EMLSAT00000000543 description:"snap_masked-LSalAtl2s1089-processed-gene-0.3") HSP 1 Score: 142.895 bits (359), Expect = 6.700e-46 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0 Query: 1 MADCNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCIVYFILPLVVYLEKKP 69 MADCNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCIVYFILPLVVYLEKKP Sbjct: 1 MADCNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCIVYFILPLVVYLEKKP 69 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000543 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 17
Pagesback to top
BLAST of EMLSAG00000000543 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000543 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000543 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000543 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000543 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1089:95639..99073+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000543-683309 ID=EMLSAG00000000543-683309|Name=EMLSAG00000000543|organism=Lepeophtheirus salmonis|type=gene|length=3435bp|location=Sequence derived from alignment at LSalAtl2s1089:95639..99073+ (Lepeophtheirus salmonis)back to top Add to Basket
|