EMLSAG00000000543, EMLSAG00000000543-683309 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592903043|gb|GAXK01055332.1| (TSA: Calanus finmarchicus comp85622_c2_seq5 transcribed RNA sequence) HSP 1 Score: 31.9574 bits (71), Expect = 1.293e-1 Identity = 14/51 (27.45%), Postives = 27/51 (52.94%), Query Frame = 0 Query: 4 CNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCI 54 C+D PG K FN+++ V + + ++++GHK G++C C+ Sbjct: 193 CSDLPGHKVHFNIIFRKVKNLSKR------IPFTLLGHKLFIVYGIYCLCL 327
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592903044|gb|GAXK01055331.1| (TSA: Calanus finmarchicus comp85622_c2_seq4 transcribed RNA sequence) HSP 1 Score: 31.9574 bits (71), Expect = 1.306e-1 Identity = 14/51 (27.45%), Postives = 27/51 (52.94%), Query Frame = 0 Query: 4 CNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCI 54 C+D PG K FN+++ V + + ++++GHK G++C C+ Sbjct: 193 CSDLPGHKVHFNIIFRKVKNLSKR------IPFTLLGHKLFIVYGIYCLCL 327
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592903040|gb|GAXK01055335.1| (TSA: Calanus finmarchicus comp85622_c2_seq8 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 3.137e-1 Identity = 14/51 (27.45%), Postives = 27/51 (52.94%), Query Frame = 0 Query: 4 CNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCI 54 C+D PG K FN+++ V + + ++++GHK G++C C+ Sbjct: 5 CSDLPGHKVHFNIIFRKVKNLSKR------IPFTLLGHKLFIVYGIYCLCL 139
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592903041|gb|GAXK01055334.1| (TSA: Calanus finmarchicus comp85622_c2_seq7 transcribed RNA sequence) HSP 1 Score: 30.8018 bits (68), Expect = 3.173e-1 Identity = 14/51 (27.45%), Postives = 27/51 (52.94%), Query Frame = 0 Query: 4 CNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCI 54 C+D PG K FN+++ V + + ++++GHK G++C C+ Sbjct: 5 CSDLPGHKVHFNIIFRKVKNLSKR------IPFTLLGHKLFIVYGIYCLCL 139
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592904041|gb|GAXK01054334.1| (TSA: Calanus finmarchicus comp7167113_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.246e+0 Identity = 15/43 (34.88%), Postives = 23/43 (53.49%), Query Frame = 0 Query: 25 CNKWEIMDVSSYSIMGHKFICSSGVHCSCIVYFILPLVVYLEK 67 CN W+ + ++G +FI HCS +V+ +L L LEK Sbjct: 592 CNSWKYFSKLNPKLLGFQFIIK---HCSNVVFLVLILSAGLEK 711
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885516|gb|GAXK01072859.1| (TSA: Calanus finmarchicus comp431532_c1_seq7 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.721e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 544 HCSCILVTMLPTLLYNQRHP 603
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885517|gb|GAXK01072858.1| (TSA: Calanus finmarchicus comp431532_c1_seq6 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.731e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 544 HCSCILVTMLPTLLYNQRHP 603
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885518|gb|GAXK01072857.1| (TSA: Calanus finmarchicus comp431532_c1_seq5 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.741e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 544 HCSCILVTMLPTLLYNQRHP 603
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885520|gb|GAXK01072855.1| (TSA: Calanus finmarchicus comp431532_c1_seq3 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.794e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 887 HCSCILVTMLPTLLYNQRHP 946
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Match: gi|592885521|gb|GAXK01072854.1| (TSA: Calanus finmarchicus comp431532_c1_seq2 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.800e+0 Identity = 9/20 (45.00%), Postives = 15/20 (75.00%), Query Frame = 0 Query: 50 HCSCIVYFILPLVVYLEKKP 69 HCSCI+ +LP ++Y ++ P Sbjct: 887 HCSCILVTMLPTLLYNQRHP 946
BLAST of EMLSAG00000000543 vs. L. salmonis peptides
Match: EMLSAP00000000543 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1089:95639:99073:1 gene:EMLSAG00000000543 transcript:EMLSAT00000000543 description:"snap_masked-LSalAtl2s1089-processed-gene-0.3") HSP 1 Score: 142.895 bits (359), Expect = 6.700e-46 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0 Query: 1 MADCNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCIVYFILPLVVYLEKKP 69 MADCNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCIVYFILPLVVYLEKKP Sbjct: 1 MADCNDNPGKKKLFNVMYLMVHAVCNKWEIMDVSSYSIMGHKFICSSGVHCSCIVYFILPLVVYLEKKP 69 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000543 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000543 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 17
Pagesback to top
BLAST of EMLSAG00000000543 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000543 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000543 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000543 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000543 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1089:95639..99073+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000543-683309 ID=EMLSAG00000000543-683309|Name=EMLSAG00000000543|organism=Lepeophtheirus salmonis|type=gene|length=3435bp|location=Sequence derived from alignment at LSalAtl2s1089:95639..99073+ (Lepeophtheirus salmonis)back to top Add to Basket
|