EMLSAG00000000580, EMLSAG00000000580-683346 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000000580
Unique NameEMLSAG00000000580-683346
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, abnormal egg strings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
R F161 UN38_580 female
  1. PreAdult2
  2. Adult
Abnormal eggstrings in some individuals
female reproduction, abnormal egg strings
21.08.2014 - 10:10
01.10.2014 (All day)
Homology
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:LOC618826 "Uncharacterized protein" species:9913 "Bos taurus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 TreeFam:TF330455 OrthoDB:EOG7MKW6Q GeneTree:ENSGT00730000110306 EMBL:DAAA02045994 EMBL:DAAA02045995 Ensembl:ENSBTAT00000053990 OMA:IPWILEV Uniprot:E1BDT3)

HSP 1 Score: 98.2117 bits (243), Expect = 4.473e-22
Identity = 79/242 (32.64%), Postives = 123/242 (50.83%), Query Frame = 0
Query:   23 CGLENKPSVD------SKIIGGHEAARHQFPW-LAFVTTGGY--CTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWG---INSF---DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNG-FARCT 237
            CG+   P++D      S+I+ G +A    +PW ++  T+ G+  C GS++ E+W++TA HC  +    G    +    +G+  P  Q R ++Q+   P         D AL+KL +P +L+  V P+CLP+ AD + P  G+L T+TGWG    N+F   DK   + L    N      WG    D++     SG   C GDSGGPL  + +DG +   G+  +  SS+C   + G +AR T
Sbjct:   19 CGV---PAIDPVLSGLSRIVNGEDAVPGSWPWQVSLQTSSGFHFCGGSLISEDWVVTAAHCGVSK---GTTFTSQPQDSGSGPPPSQYRRTAQVFEHPQWDLRAVRNDVALLKLAAPARLSAAVAPVCLPS-ADTSFP-TGSLCTVTGWGKTRYNAFDTPDKLQQATLPILSNADCREFWGSKITDVMICAGASGISSCMGDSGGPLVCQ-KDGAWTLAGIVSW-GSSRCSPFLPGVYARVT 250          

HSP 2 Score: 58.5362 bits (140), Expect = 2.173e-8
Identity = 37/115 (32.17%), Postives = 53/115 (46.09%), Query Frame = 0
Query:  231 NGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT-------GDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTGGYCT 338
            +GF  C GS++ E+W++TA HC ++              +G+  P  Q R + + +E P         D AL+KL  P  L+  V PVCLP+     A   FP      TG  CT
Sbjct:   55 SGFHFCGGSLISEDWVVTAAHCGVSKG---TTFTSQPQDSGSGPPPSQYRRTAQVFEHPQWDLRAVRNDVALLKLAAPARLSAAVAPVCLPS-----ADTSFP------TGSLCT 155          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:OVCH2 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 OrthoDB:EOG75B84T Gene3D:2.60.120.290 InterPro:IPR000859 Pfam:PF00431 SMART:SM00042 SUPFAM:SSF49854 PROSITE:PS01180 GeneTree:ENSGT00730000110306 TreeFam:TF326419 EMBL:AADN03004392 Ensembl:ENSGALT00000008522 Uniprot:F1NZZ9)

HSP 1 Score: 100.523 bits (249), Expect = 1.633e-21
Identity = 72/221 (32.58%), Postives = 104/221 (47.06%), Query Frame = 0
Query:   21 DICGL-ENKPS-VDSKIIGGHEAARHQFPWLAFVTTGGY--CTGSVLDENWIITARHCVKN-----DAWAGIRVGAHSIANGADEPNMQIRNSSQ--IH-----TSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTNANS---------------GRGICFGDSGGPLNYEMEDG 210
            D+CG+  N+P  + S+IIGG EA  H +PW   +       C G+VL + W+ITA HC  +     D W  +  G H +    ++   Q R+  Q  IH     T+   D AL++L  PL+ N YV P+CLP + +  +P   ++  ITGWG    D+    +LY  +   ++       Y N  S               G+  C GDSGGPL    EDG
Sbjct:  558 DVCGMPSNQPRFIFSRIIGGEEAVPHSWPWQVSIQISDQHICGGAVLAKEWVITAAHCFNSKELYRDLWM-VVTGIHDLT---EQEYRQKRSVKQYIIHPSFNKTTMDSDIALLQLAEPLEFNHYVHPVCLPAKEEVVQP--SSVCIITGWGAQEEDREKSKKLYQLEVPILMLEACQTYYINLPSRVTQRMICAGFPLEEGKDSCTGDSGGPLVCPSEDG 772          

HSP 2 Score: 60.077 bits (144), Expect = 1.932e-8
Identity = 34/91 (37.36%), Postives = 48/91 (52.75%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHC-----VLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT-------GDFALIKLEIPLELNEYVRPVCLP 314
            C G+VL + W+ITA HC     +  D W  +  GIH      ++ Y+Q R+  ++   P+        D AL++L  PLE N YV PVCLP
Sbjct:  599 CGGAVLAKEWVITAAHCFNSKELYRDLWM-VVTGIHDL---TEQEYRQKRSVKQYIIHPSFNKTTMDSDIALLQLAEPLEFNHYVHPVCLP 685          

HSP 3 Score: 56.225 bits (134), Expect = 3.111e-7
Identity = 57/237 (24.05%), Postives = 102/237 (43.04%), Query Frame = 0
Query:   26 ENKP----SVDSKIIGGHEAARHQFPWLAFVT--TGGYCTGSVLDENWIITARHCVKND---AWAGIRVGAHSI---ANGADEPNMQ--IRNSSQIHTSPIG-DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWG-----------INSFDKTNYSELYFAKNVKVVR---WGWDIIYTN-ANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNG 232
            E KP    ++ ++I+GG++  +   PW   +      +C G+++   W++TA HCV +     +  +  G H +    NG     ++  I++ +     P+  D AL+KL+     +  V P CLP   +  K   G + T  GWG           +   +    + +  ++ +  +R    G  I+     + G+  C GDSGGPL    + G ++  GV  +     C RG  G
Sbjct:   16 ETKPWSYFNLFTRIVGGNQVKQGSHPWQVSLKRREKHFCGGTIVSAQWVVTAAHCVSDRNLLKYLNVTAGEHDLRIRENGEQTLPVKYIIKHPNFDPRRPMNYDIALLKLDGTFNFSSSVLPACLPDPGE--KFEAGYICTACGWGRLRENGVLPQVLYEVNLPILNSMECSRALSTLRKPIQGDTILCAGFPDGGKDACQGDSGGPLLCRRKHGAWILAGVISW--GMGCARGWRG 248          

HSP 4 Score: 46.2098 bits (108), Expect = 5.421e-4
Identity = 31/101 (30.69%), Postives = 46/101 (45.54%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGY--CTGSVLDENWIITAKHC-----VLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPT-------GDFALIKLEIP 402
            GG EA  H +PW   +       C G+VL + W+ITA HC     +  D W  +  GIH      ++ Y Q R+  ++   P+        D AL++L  P
Sbjct:  576 GGEEAVPHSWPWQVSIQISDQHICGGAVLAKEWVITAAHCFNSKELYRDLWM-VVTGIHDL---TEQEYRQKRSVKQYIIHPSFNKTTMDSDIALLQLAEP 672          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:TMPRSS9 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR002172 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00057 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50068 PROSITE:PS50240 SMART:SM00020 SMART:SM00192 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 Gene3D:4.10.400.10 InterPro:IPR023415 PROSITE:PS01209 InterPro:IPR000082 Pfam:PF01390 SUPFAM:SSF82671 PROSITE:PS50024 OrthoDB:EOG7RNK07 TreeFam:TF330647 GeneTree:ENSGT00740000115437 EMBL:AADN03008977 Ensembl:ENSGALT00000000620 Uniprot:F1NP62)

HSP 1 Score: 97.0561 bits (240), Expect = 2.774e-20
Identity = 96/386 (24.87%), Postives = 162/386 (41.97%), Query Frame = 0
Query:   23 CGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITARHC---VKNDAWAGIRVGAHSIANGADEPNMQ------IRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRAD---ANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW-DIIYTNANSGRGICF-----------GDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEY-VRP-VCLP---TGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTG-NGAD 374
            CG        S+I+GG EA+R +FPW   +      +C  ++L E W+++A HC    ++ A      G  SI +GAD   ++      I + S    +   D A+++L+ P+   +Y++P+CLP        NK  +     I+GWG    D     E      VK++       +Y++A + R +C            GDSGGPL  E   GK+   G+  +       R    + R T      +WI+ A           + +   ST +    P + + T++    + +   A  K        E   RP +  P    GG +A+R + PW   +      +C  +++ + W+++A HC    N  EI   + +T  NG D
Sbjct:  218 CGSRPAMQTASRIVGGTEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDPAMWAAYAGTTSI-SGADSSAVKMGIARIIPHPSYNTDTADYDVAVLELKRPVTFTKYIQPVCLPHAGHHFPTNKKCL-----ISGWGYLKEDFLVKPEFLQKATVKLLDQALCSSLYSHALTDRMLCAGYLEGKIDSCQGDSGGPLVCEEPSGKFFLAGIVSWGIGCAEARRPGVYTRVTKL---RDWILDAISPFPTSITRTVPLTHSSTNSNVVTPEELSATTSTAIPTSSPALAASKPATAPRPQECGGRPGLSKPNKIVGGTDASRGEIPWQVSLQEDSMHFCGATIIGDRWLLSAAHCFNETNPEEIEAYMGTTSLNGTD 594          

HSP 2 Score: 85.8853 bits (211), Expect = 1.437e-16
Identity = 97/408 (23.77%), Postives = 158/408 (38.73%), Query Frame = 0
Query:    9 IIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITARHCVKNDAWAGIR--VGAHSIANGADEPNMQIRNSSQIHTSPIG-------DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVV-RWGWDIIYTNANSGRGICF-----------GDSGGPLNYEMEDGKYMQIG------------------------------VNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSE---IRVGIHSTGNGADEPYKQTRT----STEFYESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITAKHC 353
            +  S  A    P  CG     S  +KI+GG +A+R + PW   +      +C  +++ + W+++A HC        I   +G  S+ NG D   +++ N +++   P+        D A+++L  PL  N+Y++PICLP      K  +G    I+GWG         SE     +V ++ +   + +Y  + + R IC            GDSGGPL  E+  G +   G                              ++QF   S      +  AR T  +L      TA   +     SE     V   ST   + EP K T+     +T      +       L   L  ++ V       GG  AAR ++PW   L        C   ++ + W+++A HC
Sbjct:  505 LAASKPATAPRPQECGGRPGLSKPNKIVGGTDASRGEIPWQVSLQEDSMHFCGATIIGDRWLLSAAHCFNETNPEEIEAYMGTTSL-NGTDGSAVKV-NVTRVIPHPLFNPMLLDFDVAVLELARPLVFNKYIQPICLPLA--VQKFPVGKKCIISGWGNLQEGNVTMSESLQKASVGIIDQKTCNFLYNFSLTERMICAGFLEGKIDSCQGDSGGPLACEVTPGVFYLAGIVSWGIGCAQAKKPGVYSRITKLNDWILDTISQFPGPSTGAPSTSATARTTADILTLRPSTTATGPISETTPSEKAATTVQETSTALKSTEPAKPTQAPGAPATSVLHGASSSVPDCGLTTALAFSKIV-------GGSSAARGEWPWQVSLWLRQKEHKCGAVLIADRWLLSAAHC 901          

HSP 3 Score: 63.929 bits (154), Expect = 1.425e-9
Identity = 60/229 (26.20%), Postives = 95/229 (41.48%), Query Frame = 0
Query:   15 ANPKYPDICGLENKPSVDSKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHC--VKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIG-------DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTNANSGRGICF-----------GDSGGPLNYEMEDGKYMQIGVNQF 220
            A+   PD CGL    +  SKI+GG  AAR ++PW   L        C   ++ + W+++A HC  + +D    +        NG D    +I    +I+  P         D AL++L +P++ +  ++PICLP  +   +   GA   ITGWG           L  A    +        Y    S R +C            GD+GGPL  +   G++   G+  +
Sbjct:  841 ASSSVPD-CGLTTALAF-SKIVGGSSAARGEWPWQVSLWLRQKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAFLGTPFLNGNDGKMEKIF---RIYKHPFYNVYSLDYDVALLELSAPVRFSSTIKPICLPDNSHIFQE--GARCFITGWGSTKEGGLMTKHLQKAAVNVIGDQDCKKFYPVQISSRMVCAGFPQGTVDSCSGDAGGPLACKEPSGRWFLAGITSW 1062          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:ctrb1 "chymotrypsinogen B1" species:7955 "Danio rerio" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0006508 "proteolysis" evidence=IEA] [GO:0003824 "catalytic activity" evidence=IEA] [GO:0008233 "peptidase activity" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0008236 "serine-type peptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 ZFIN:ZDB-GENE-030131-1171 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 GeneTree:ENSGT00730000110306 EMBL:CR356247 OMA:HETNVCT ProteinModelPortal:E7F8R9 Ensembl:ENSDART00000109691 ArrayExpress:E7F8R9 Bgee:E7F8R9 Uniprot:E7F8R9)

HSP 1 Score: 95.9005 bits (237), Expect = 3.002e-20
Identity = 101/348 (29.02%), Postives = 154/348 (44.25%), Query Frame = 0
Query:    4 LVLLTIIGSVLANPKYPDICGLENKPSVDS---KIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTIT-GWGINSFDKTN------YSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGG--PLNYEMEDGKYMQIGVNQFVTSSKCDRGVN-----GFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCL 313
            L  L +IG+          CG+   P V +   +I+ G EA  H +PW   L   T   +C GS+++E W++TA HC    +   I +G H  ++ A EP +Q     ++   P         D  LIKL +P K+N +V P+CL   A+ N    G +  +T GWG+   +  +       + L    N    R WG    D++     SG   C GDSG   P    +  G Y +I   +          V+     GF  C GS+++ENW++TA HC +  +   + +G H   + A+    QT    +  + P         D  LIKL  P ++N +V PVCL
Sbjct:    7 LSCLALIGTAYG-------CGVPAIPPVITGYARIVNGEEAVPHSWPWQVSLQDSTGFHFCGGSLINEWWVVTAAHCNVRTSHRVI-LGEHDRSSNA-EP-IQTMTVGKVFKHPNFNMFTINNDILLIKLATPAKINTHVSPVCL---AETNDNFPGGMKCVTSGWGLTKHNAPDTPALLQQAALPLLTNEDCKRFWGNKITDLMVCAGASGASSCMGDSGCGVPAIPPVVTG-YARIVNGEEARPHSWPWQVSLQDSTGFHFCGGSLINENWVVTAAHCNVRTS-HRVILGEHDRSSNAEA--IQTIAVGKSIKHPNYNSFTINNDILLIKLATPAKINTHVSPVCL 337          

HSP 2 Score: 77.411 bits (189), Expect = 4.855e-14
Identity = 63/222 (28.38%), Postives = 94/222 (42.34%), Query Frame = 0
Query:   23 CGLENKPSVDS---KIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIG---------------DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTIT-GWGINSFDKTNYS----------------ELYFAKNVKVVRWGWDIIYTNANSGRGICFGDSGGPLNYE 206
            CG+   P V +   +I+ G EA  H +PW   L   T   +C GS+++ENW++TA HC        +R     I    D  +    N+  I T  +G               D  LIKL +P K+N +V P+CL   A+ N    G +  +T GWG+  ++  +                  + Y+  N+       D++     SG   C GDSGGPL  E
Sbjct:  215 CGVPAIPPVVTGYARIVNGEEARPHSWPWQVSLQDSTGFHFCGGSLINENWVVTAAHC-------NVRTSHRVILGEHDRSS----NAEAIQTIAVGKSIKHPNYNSFTINNDILLIKLATPAKINTHVSPVCL---AETNDNFPGGMKCVTSGWGLTRYNAPDTPALLQQAALPLLTNDDCKRYWGTNIT------DLMICAGASGVSSCMGDSGGPLVCE 416          

HSP 3 Score: 46.2098 bits (108), Expect = 3.577e-4
Identity = 37/113 (32.74%), Postives = 54/113 (47.79%), Query Frame = 0
Query:  300 IPLELNEYVRPVCLPTGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKLEIP 402
            IP  +  Y R V     G EA  H +PW   L   T   +C GS+++E W++TA HC +  +   + +G H   + A EP +QT T  + ++ P         D  LIKL  P
Sbjct:   24 IPPVITGYARIV----NGEEAVPHSWPWQVSLQDSTGFHFCGGSLINEWWVVTAAHCNVRTS-HRVILGEHDRSSNA-EP-IQTMTVGKVFKHPNFNMFTINNDILLIKLATP 129          

HSP 4 Score: 45.0542 bits (105), Expect = 9.636e-4
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 0
Query:  287 ESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKLEIP 402
             S  GD       IP  +  Y R V     G EA  H +PW   L   T   +C GS+++ENW++TA HC +  +   + +G H   + A+   +QT    +  + P         D  LIKL  P
Sbjct:  207 SSCMGDSGCGVPAIPPVVTGYARIV----NGEEARPHSWPWQVSLQDSTGFHFCGGSLINENWVVTAAHCNVRTS-HRVILGEHDRSSNAEA--IQTIAVGKSIKHPNYNSFTINNDILLIKLATP 325          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:CTRB2 "Uncharacterized protein" species:9615 "Canis lupus familiaris" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 TreeFam:TF330455 OrthoDB:EOG7MKW6Q GeneTree:ENSGT00730000110306 OMA:ADCKKFW EMBL:AAEX03004066 Ensembl:ENSCAFT00000031965 Uniprot:E2RSM7)

HSP 1 Score: 93.2041 bits (230), Expect = 3.054e-20
Identity = 70/241 (29.05%), Postives = 110/241 (45.64%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGAD----EPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            M  L LL+    V A   +  +  +E   +  S+I+ G +A    +PW   L   T   +C GS++ E+W++TA HC       G+R     +A   D    E N+Q+   +++  +P         D  L+KL +P + +E V P+CLP   D   P  G +   TGWG   +      DK   + L    N +  + WG    D++     SG   C GDSGGPL  + +DG +  +G+
Sbjct:    2 MAFLWLLSCFALVGAASSHCGVPAIEPVLNGLSRIVNGEDAVPGSWPWQVSLQDSTGFHFCGGSLISEDWVVTAAHC-------GVRTSHLVVAGEFDQSSSEENIQVLKIAEVFKNPKFNMFTVRNDITLLKLATPARFSETVSPVCLPQATDEFPP--GLMCVTTGWGRTKYNANKTPDKLQQAALPLLSNAECKKFWGSKITDVMICAGASGVSSCMGDSGGPLVCQ-KDGAWTLVGI 232          

HSP 2 Score: 51.6026 bits (122), Expect = 5.039e-6
Identity = 35/111 (31.53%), Postives = 53/111 (47.75%), Query Frame = 0
Query:  231 NGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT-------GDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTG 334
             GF  C GS++ E+W++TA HC +    S + V      + ++E  +  + + E +++P         D  L+KL  P   +E V PVCLP    E      P L  VTTG
Sbjct:   57 TGFHFCGGSLISEDWVVTAAHCGVRT--SHLVVAGEFDQSSSEENIQVLKIA-EVFKNPKFNMFTVRNDITLLKLATPARFSETVSPVCLPQATDEFP----PGLMCVTTG 160          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:CTRB2 "Chymotrypsinogen B2" species:9606 "Homo sapiens" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0005576 "extracellular region" evidence=TAS] [GO:0005615 "extracellular space" evidence=IEA] [GO:0006766 "vitamin metabolic process" evidence=TAS] [GO:0006767 "water-soluble vitamin metabolic process" evidence=TAS] [GO:0007586 "digestion" evidence=IEA] [GO:0009235 "cobalamin metabolic process" evidence=TAS] [GO:0022617 "extracellular matrix disassembly" evidence=TAS] [GO:0030198 "extracellular matrix organization" evidence=TAS] [GO:0044281 "small molecule metabolic process" evidence=TAS] Reactome:REACT_111217 InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 Reactome:REACT_118779 Reactome:REACT_116125 GO:GO:0005576 GO:GO:0005615 GO:GO:0007586 GO:GO:0006508 GO:GO:0004252 GO:GO:0009235 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 GO:GO:0022617 HOGENOM:HOG000251820 EMBL:AC009078 TreeFam:TF330455 OrthoDB:EOG7MKW6Q MEROPS:S01.152 KO:K01310 EMBL:AK291822 EMBL:BC073145 RefSeq:NP_001020371.3 UniGene:Hs.632211 ProteinModelPortal:Q6GPI1 SMR:Q6GPI1 STRING:9606.ENSP00000303963 PhosphoSite:Q6GPI1 DMDM:290457638 PaxDb:Q6GPI1 PRIDE:Q6GPI1 Ensembl:ENST00000303037 GeneID:440387 KEGG:hsa:440387 UCSC:uc002fdr.3 CTD:440387 GeneCards:GC16M075237 HGNC:HGNC:2522 neXtProt:NX_Q6GPI1 PharmGKB:PA27023 InParanoid:Q6GPI1 OMA:ADCKKFW GenomeRNAi:440387 NextBio:109214 PRO:PR:Q6GPI1 ArrayExpress:Q6GPI1 Bgee:Q6GPI1 CleanEx:HS_CTRB2 Genevestigator:Q6GPI1 Uniprot:Q6GPI1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.126e-19
Identity = 65/209 (31.10%), Postives = 102/209 (48.80%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIR----VGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            S+I+ G +A    +PW   L   T   +C GS++ E+W++TA HC       G+R    V A     G+DE N+Q+   +++  +P         D  L+KL +P + ++ V  +CLP+ AD + P  G L   TGWG   +      DK   + L    N +  + WG    D++     SG   C GDSGGPL  + +DG +  +G+
Sbjct:   32 SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHC-------GVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS-ADDDFP-AGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQ-KDGAWTLVGI 230          

HSP 2 Score: 49.6766 bits (117), Expect = 1.682e-5
Identity = 33/113 (29.20%), Postives = 51/113 (45.13%), Query Frame = 0
Query:  231 NGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTGGY 336
             GF  C GS++ E+W++TA HC +    S++ V       G+DE   Q     + +++P         D  L+KL  P   ++ V  VCLP+     A   FP      T G+
Sbjct:   55 TGFHFCGGSLISEDWVVTAAHCGVRT--SDVVVA-GEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS-----ADDDFPAGTLCATTGW 159          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:CTRB1 "Chymotrypsinogen B" species:9606 "Homo sapiens" [GO:0004252 "serine-type endopeptidase activity" evidence=NAS] [GO:0005576 "extracellular region" evidence=TAS] [GO:0005615 "extracellular space" evidence=IEA] [GO:0006766 "vitamin metabolic process" evidence=TAS] [GO:0006767 "water-soluble vitamin metabolic process" evidence=TAS] [GO:0007586 "digestion" evidence=IEA] [GO:0009235 "cobalamin metabolic process" evidence=TAS] [GO:0022617 "extracellular matrix disassembly" evidence=TAS] [GO:0030198 "extracellular matrix organization" evidence=TAS] [GO:0044281 "small molecule metabolic process" evidence=TAS] Reactome:REACT_111217 InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 Reactome:REACT_118779 Reactome:REACT_116125 GO:GO:0005576 GO:GO:0005615 GO:GO:0007586 GO:GO:0006508 GO:GO:0004252 GO:GO:0009235 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 GO:GO:0022617 HOGENOM:HOG000251820 TreeFam:TF330455 OrthoDB:EOG7MKW6Q EMBL:M24400 EMBL:BT007356 EMBL:BC005385 PIR:A31299 UniGene:Hs.610926 ProteinModelPortal:P17538 SMR:P17538 STRING:9606.ENSP00000354294 BindingDB:P17538 ChEMBL:CHEMBL4796 PhosphoSite:P17538 DMDM:117617 PaxDb:P17538 PRIDE:P17538 Ensembl:ENST00000361017 GeneCards:GC16P075252 H-InvDB:HIX0013242 HGNC:HGNC:2521 MIM:118890 neXtProt:NX_P17538 InParanoid:P17538 PRO:PR:P17538 ArrayExpress:P17538 Bgee:P17538 CleanEx:HS_CTRB1 Genevestigator:P17538 Uniprot:P17538)

HSP 1 Score: 91.2781 bits (225), Expect = 1.357e-19
Identity = 68/229 (29.69%), Postives = 109/229 (47.60%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIR----VGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            S+I+ G +A    +PW   L   T   +C GS++ E+W++TA HC       G+R    V A     G+DE N+Q+   +++  +P         D  L+KL +P + ++ V  +CLP+ AD + P  G L   TGWG   +      DK   + L    N +  + WG    D++     SG   C GDSGGPL  + +DG +  +G+  + + +        +AR T
Sbjct:   32 SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHC-------GVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS-ADDDFP-AGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQ-KDGAWTLVGIVSWGSDTCSTSSPGVYARVT 250          

HSP 2 Score: 49.6766 bits (117), Expect = 1.637e-5
Identity = 33/113 (29.20%), Postives = 51/113 (45.13%), Query Frame = 0
Query:  231 NGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTGGY 336
             GF  C GS++ E+W++TA HC +    S++ V       G+DE   Q     + +++P         D  L+KL  P   ++ V  VCLP+     A   FP      T G+
Sbjct:   55 TGFHFCGGSLISEDWVVTAAHCGVRT--SDVVVA-GEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS-----ADDDFPAGTLCATTGW 159          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:LOC100621820 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 TreeFam:TF330455 OrthoDB:EOG7MKW6Q GeneTree:ENSGT00730000110306 OMA:ITNLMVC EMBL:FP340593 Ensembl:ENSSSCT00000032037 Uniprot:I3LHI7)

HSP 1 Score: 91.2781 bits (225), Expect = 1.565e-19
Identity = 72/240 (30.00%), Postives = 115/240 (47.92%), Query Frame = 0
Query:   23 CGLENKPSVDS---KIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHC--VKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI------NSFDKTNYSELYFAKNVKVVR-WGWDI---IYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            CG+   P V S   +I+ G +A    +PW   L   T   +C GS++ E+W++TA HC    +D      V A     G+D  ++Q+ N +++  +P         D  L+KL +P + +E V  +CLP+ +D + P  G L   TGWG+      N+ D+   + L    N    R WG+ I   +     SG   C GDSGGPL  + +DG +  +G+  + +S+        +AR T
Sbjct:   24 CGVPAIPPVLSGLSRIVNGEDAVPGSWPWQVSLQDSTGFHFCGGSLISEDWVVTAAHCGVTTSDV-----VVAGEFDQGSDAESIQVINIAKVFKNPRYSWFINSNDITLLKLATPARFSETVSAVCLPSASD-DFP-AGTLCVTTGWGLTKYTDANTPDRLQQAALPLLSNAACRRYWGFRITKSMICAGASGVSSCMGDSGGPLVCQ-KDGVWTLVGIVSWGSSTCSTSSPGVYARVT 255          

HSP 2 Score: 50.0618 bits (118), Expect = 1.512e-5
Identity = 35/122 (28.69%), Postives = 53/122 (43.44%), Query Frame = 0
Query:  231 NGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTGGYCTGSVLDEN 345
             GF  C GS++ E+W++TA HC +    S++ V       G+D    Q     + +++P       + D  L+KL  P   +E V  VCLP+     A   FP      T G+      D N
Sbjct:   60 TGFHFCGGSLISEDWVVTAAHCGVTT--SDVVVA-GEFDQGSDAESIQVINIAKVFKNPRYSWFINSNDITLLKLATPARFSETVSAVCLPS-----ASDDFPAGTLCVTTGWGLTKYTDAN 173          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:zgc:112160 "zgc:112160" species:7955 "Danio rerio" [GO:0004252 "serine-type endopeptidase activity" evidence=IEA] [GO:0006508 "proteolysis" evidence=IEA] [GO:0003824 "catalytic activity" evidence=IEA] [GO:0005575 "cellular_component" evidence=ND] [GO:0008233 "peptidase activity" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0008236 "serine-type peptidase activity" evidence=IEA] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 ZFIN:ZDB-GENE-050417-229 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 HOGENOM:HOG000251820 TreeFam:TF330455 OrthoDB:EOG7MKW6Q GeneTree:ENSGT00730000110306 EMBL:CR356247 MEROPS:S01.437 EMBL:BC093233 RefSeq:NP_001017724.1 UniGene:Dr.29122 STRING:7955.ENSDARP00000058066 Ensembl:ENSDART00000058067 GeneID:550419 KEGG:dre:550419 InParanoid:Q561U4 OMA:DQILASN NextBio:20879666 PRO:PR:Q561U4 Uniprot:Q561U4)

HSP 1 Score: 90.1225 bits (222), Expect = 2.959e-19
Identity = 73/245 (29.80%), Postives = 116/245 (47.35%), Query Frame = 0
Query:   23 CGLENKPSVDS---KIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTIT-GWGINSFDKTNYSELYFAKNVKVV------------RWG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNG-FARCT 237
            CG+   P V S   +I+ G EA  H +PW   L   T   +C GS+++E W++TA HC    +   + +G H+      + ++Q    S++ T P         D AL+KL +P  LN +V P+CL   A+A+      +T +T GWG+     T Y+ L+    ++ V             WG    D +     +G   C GDSGGPL  + +D  +  +G+  +  SS+CD  + G + R T
Sbjct:   19 CGVPAIPPVVSGYARIVNGEEAVPHSWPWQVSLQDFTGFHFCGGSLINEFWVVTAAHCSVRTS-HRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCL---AEASDNFASGMTCVTSGWGV-----TRYNALFTPDELQQVALPLLSNEDCKNHWGSNIRDTMICAGAAGASSCMGDSGGPLVCQ-KDNIWTLVGIVSW-GSSRCDPTMPGVYGRVT 252          

HSP 2 Score: 56.225 bits (134), Expect = 1.136e-7
Identity = 30/89 (33.71%), Postives = 46/89 (51.69%), Query Frame = 0
Query:  232 GFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT-------GDFALIKLEIPLELNEYVRPVCL 313
            GF  C GS+++E W++TA HC +  +   + +G H+ G    +   QT   ++ +  P         D AL+KL  P  LN +V PVCL
Sbjct:   56 GFHFCGGSLINEFWVVTAAHCSVRTS-HRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCL 143          

HSP 3 Score: 51.2174 bits (121), Expect = 6.101e-6
Identity = 34/113 (30.09%), Postives = 54/113 (47.79%), Query Frame = 0
Query:  300 IPLELNEYVRPVCLPTGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPT-------GDFALIKLEIP 402
            IP  ++ Y R V     G EA  H +PW   L   T   +C GS+++E W++TA HC +  +   + +G H+ G    +  +QT   ++ +  P         D AL+KL  P
Sbjct:   24 IPPVVSGYARIV----NGEEAVPHSWPWQVSLQDFTGFHFCGGSLINEFWVVTAAHCSVRTS-HRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLTAP 131          
BLAST of EMLSAG00000000580 vs. GO
Match: - (symbol:Ctrb1 "chymotrypsinogen B1" species:10090 "Mus musculus" [GO:0003824 "catalytic activity" evidence=IEA] [GO:0004252 "serine-type endopeptidase activity" evidence=ISO] [GO:0005576 "extracellular region" evidence=IEA] [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005764 "lysosome" evidence=ISO] [GO:0006508 "proteolysis" evidence=ISO;IDA] [GO:0007586 "digestion" evidence=IEA] [GO:0008233 "peptidase activity" evidence=IDA] [GO:0008236 "serine-type peptidase activity" evidence=IEA] [GO:0016787 "hydrolase activity" evidence=IEA] [GO:0030163 "protein catabolic process" evidence=ISO] [GO:0034097 "response to cytokine" evidence=ISO] [GO:0043065 "positive regulation of apoptotic process" evidence=ISO] InterPro:IPR001254 InterPro:IPR001314 InterPro:IPR009003 InterPro:IPR018114 Pfam:PF00089 PRINTS:PR00722 PROSITE:PS00134 PROSITE:PS00135 PROSITE:PS50240 SMART:SM00020 MGI:MGI:88559 GO:GO:0005615 GO:GO:0007586 GO:GO:0008233 GO:GO:0006508 GO:GO:0004252 SUPFAM:SSF50494 eggNOG:COG5640 HOVERGEN:HBG013304 HOGENOM:HOG000251820 TreeFam:TF330455 OrthoDB:EOG7MKW6Q MEROPS:S01.152 GeneTree:ENSGT00730000110306 KO:K01310 EMBL:AK003060 EMBL:AK003079 EMBL:AK007566 EMBL:AK007765 EMBL:AK007815 EMBL:AK008644 EMBL:AK008729 EMBL:AK008888 EMBL:AK008927 EMBL:BC061083 RefSeq:NP_079859.2 UniGene:Mm.34374 ProteinModelPortal:Q9CR35 SMR:Q9CR35 PhosphoSite:Q9CR35 PaxDb:Q9CR35 PRIDE:Q9CR35 Ensembl:ENSMUST00000034435 GeneID:66473 KEGG:mmu:66473 UCSC:uc009nms.2 CTD:1504 InParanoid:Q9CR35 OMA:LATEARF ChiTaRS:CTRB1 NextBio:321790 PRO:PR:Q9CR35 Bgee:Q9CR35 CleanEx:MM_CTRB1 Genevestigator:Q9CR35 Uniprot:Q9CR35)

HSP 1 Score: 89.7373 bits (221), Expect = 4.942e-19
Identity = 67/209 (32.06%), Postives = 98/209 (46.89%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIR----VGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            S+I+ G +A    +PW   L   T   +C GS++ ENW++TA HC       G++    V A     G+DE N+Q+   +Q+  +P         D  L+KL +P + +E V  +CLPT  D + P  G L   TGWG   +      DK   + L      K    WG    D++     SG   C GDSGGPL  + +DG +   G+
Sbjct:   32 SRIVNGEDAIPGSWPWQVSLQDRTGFHFCGGSLISENWVVTAAHC-------GVKTTDVVVAGEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRNDITLLKLATPAQFSETVSAVCLPT-VDDDFP-AGTLCATTGWGKTKYNALKTPDKLQQAALPIVSEAKCKESWGSKITDVMICAGASGVSSCMGDSGGPLVCQ-KDGVWTLAGI 230          

HSP 2 Score: 53.1434 bits (126), Expect = 1.433e-6
Identity = 30/92 (32.61%), Postives = 46/92 (50.00%), Query Frame = 0
Query:  231 NGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT-------GDFALIKLEIPLELNEYVRPVCLPT 315
             GF  C GS++ ENW++TA HC +    +++ V       G+DE   Q     + +++P         D  L+KL  P + +E V  VCLPT
Sbjct:   55 TGFHFCGGSLISENWVVTAAHCGVKT--TDVVVA-GEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRNDITLLKLATPAQFSETVSAVCLPT 143          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778605|gb|GAXK01175963.1| (TSA: Calanus finmarchicus comp2611_c0_seq4 transcribed RNA sequence)

HSP 1 Score: 137.117 bits (344), Expect = 1.915e-35
Identity = 85/239 (35.56%), Postives = 132/239 (55.23%), Query Frame = 0
Query:   19 YPDICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVV-----RWGWDIIYT-----NANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            + DICGLEN P +D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L   +++ V+        + IIY      ++++G+G+C GDSGG LN   E + K+ Q+GV  FV+SS C+ G  +GF R
Sbjct:  218 FADICGLEN-PGMD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNEYVGELTTPVGWGKNADSAGGITPKLQMVEDLPVIDNPTCDETYGIIYDGIMCIDSSNGKGVCNGDSGGSLNMRQEAENKWTQVGVASFVSSSGCESGDPHGFTR 925          

HSP 2 Score: 56.9954 bits (136), Expect = 4.088e-8
Identity = 30/95 (31.58%), Postives = 47/95 (49.47%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEAARH 323
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P         D AL++L   +E N+Y+RP CLP    E+  +
Sbjct:  335 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNEY 616          

HSP 3 Score: 51.6026 bits (122), Expect = 1.851e-6
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P         D AL++L
Sbjct:  266 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRL 541          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778602|gb|GAXK01175966.1| (TSA: Calanus finmarchicus comp2611_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 135.191 bits (339), Expect = 7.986e-35
Identity = 85/239 (35.56%), Postives = 131/239 (54.81%), Query Frame = 0
Query:   19 YPDICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVV-----RWGWDIIYT-----NANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            + DICGLEN P  D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L   +++ V+        + IIY      ++++G+G+C GDSGG LN   E + K+ Q+GV  FV+SS C+ G  +GF R
Sbjct:  125 FADICGLEN-PGKD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDESNGYVGELTTPVGWGKNADSAGGITPKLQMVEDLPVIDNPTCDETYGIIYDGIMCIDSSNGKGVCNGDSGGSLNMRQEAENKWTQVGVASFVSSSGCESGDPHGFTR 832          

HSP 2 Score: 57.7658 bits (138), Expect = 2.272e-8
Identity = 30/92 (32.61%), Postives = 47/92 (51.09%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEA 320
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P       + D AL++L   +E N+Y+RP CLP    E+
Sbjct:  443 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDES 715          

HSP 3 Score: 52.7582 bits (125), Expect = 9.767e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P       + D AL++L
Sbjct:  509 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRL 784          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778608|gb|GAXK01175960.1| (TSA: Calanus finmarchicus comp2611_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 136.346 bits (342), Expect = 8.869e-35
Identity = 85/239 (35.56%), Postives = 132/239 (55.23%), Query Frame = 0
Query:   19 YPDICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVV-----RWGWDIIYT-----NANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            + DICGLEN P +D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L   +++ V+        + IIY      ++++G+G+C GDSGG LN   E + K+ Q+GV  FV+SS C+ G  +GF R
Sbjct:  219 FEDICGLEN-PGMD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNGYVGELTTPVGWGKNADSAGGITPKLQMVEDLPVIDNPTCDETYGIIYDGIMCIDSSNGKGVCNGDSGGSLNMRQEAENKWTQVGVASFVSSSGCESGDPHGFTR 926          

HSP 2 Score: 56.9954 bits (136), Expect = 4.999e-8
Identity = 30/92 (32.61%), Postives = 46/92 (50.00%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEA 320
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P         D AL++L   +E N+Y+RP CLP    E+
Sbjct:  336 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDES 608          

HSP 3 Score: 51.6026 bits (122), Expect = 2.264e-6
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P         D AL++L
Sbjct:  267 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRL 542          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778606|gb|GAXK01175962.1| (TSA: Calanus finmarchicus comp2611_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 134.806 bits (338), Expect = 1.582e-34
Identity = 83/239 (34.73%), Postives = 128/239 (53.56%), Query Frame = 0
Query:   19 YPDICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVVR----------WGWDIIYTNANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            + DICGLEN P +D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L    ++ V+               I+  +++ G+G+C GDSGG LN   E + K+ QIGV  FV+S+ C+ G  +GF R
Sbjct:  218 FADICGLEN-PGMD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNEYVGELTTPVGWGKNADSAGGITPKLQMVSDLPVIDNPTCNDYYGILNAGIMCIDSSDGKGVCNGDSGGTLNLRQEAENKWTQIGVTSFVSSAGCESGNPHGFTR 925          

HSP 2 Score: 56.9954 bits (136), Expect = 4.259e-8
Identity = 30/95 (31.58%), Postives = 47/95 (49.47%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEAARH 323
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P         D AL++L   +E N+Y+RP CLP    E+  +
Sbjct:  335 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNEY 616          

HSP 3 Score: 51.6026 bits (122), Expect = 1.984e-6
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P         D AL++L
Sbjct:  266 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRL 541          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778604|gb|GAXK01175964.1| (TSA: Calanus finmarchicus comp2611_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 135.191 bits (339), Expect = 2.180e-34
Identity = 85/239 (35.56%), Postives = 131/239 (54.81%), Query Frame = 0
Query:   19 YPDICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVV-----RWGWDIIYT-----NANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            + DICGLEN P  D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L   +++ V+        + IIY      ++++G+G+C GDSGG LN   E + K+ Q+GV  FV+SS C+ G  +GF R
Sbjct:  302 FADICGLEN-PGKD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNGYVGELTTPVGWGKNADSAGGITPKLQMVEDLPVIDNPTCNETYGIIYDGIMCIDSSNGKGVCNGDSGGSLNMRQEAENKWTQVGVASFVSSSGCESGDPHGFTR 1009          

HSP 2 Score: 56.6102 bits (135), Expect = 5.461e-8
Identity = 30/92 (32.61%), Postives = 46/92 (50.00%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEA 320
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P         D AL++L   +E N+Y+RP CLP    E+
Sbjct:  620 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDES 892          

HSP 3 Score: 51.6026 bits (122), Expect = 2.170e-6
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P         D AL++L
Sbjct:  686 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRL 961          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778607|gb|GAXK01175961.1| (TSA: Calanus finmarchicus comp2611_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 134.035 bits (336), Expect = 2.922e-34
Identity = 83/239 (34.73%), Postives = 128/239 (53.56%), Query Frame = 0
Query:   19 YPDICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVVR----------WGWDIIYTNANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            + DICGLEN P +D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L    ++ V+               I+  +++ G+G+C GDSGG LN   E + K+ QIGV  FV+S+ C+ G  +GF R
Sbjct:  219 FEDICGLEN-PGMD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNGYVGELTTPVGWGKNADSAGGITPKLQMVSDLPVIDNPTCNDYYGILNAGIMCIDSSDGKGVCNGDSGGTLNLRQEAENKWTQIGVTSFVSSAGCESGNPHGFTR 926          

HSP 2 Score: 56.9954 bits (136), Expect = 4.374e-8
Identity = 30/92 (32.61%), Postives = 46/92 (50.00%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEA 320
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P         D AL++L   +E N+Y+RP CLP    E+
Sbjct:  336 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDES 608          

HSP 3 Score: 51.6026 bits (122), Expect = 1.966e-6
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P         D AL++L
Sbjct:  267 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRL 542          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778603|gb|GAXK01175965.1| (TSA: Calanus finmarchicus comp2611_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 133.65 bits (335), Expect = 3.410e-34
Identity = 83/239 (34.73%), Postives = 127/239 (53.14%), Query Frame = 0
Query:   19 YPDICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVVR----------WGWDIIYTNANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            + DICGLEN P  D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L    ++ V+               I+  +++ G+G+C GDSGG LN   E + K+ QIGV  FV+S+ C+ G  +GF R
Sbjct:  171 FADICGLEN-PGKD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDESNEYVGELTTPVGWGKNADSAGGITPKLQMVSDLPVIDNPTCNDYYGILNAGIMCIDSSDGKGVCNGDSGGTLNLRQEAENKWTQIGVTSFVSSAGCESGNPHGFTR 878          

HSP 2 Score: 57.7658 bits (138), Expect = 2.178e-8
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEAARH 323
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P       + D AL++L   +E N+Y+RP CLP    E+  +
Sbjct:  480 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDESNEY 761          

HSP 3 Score: 52.7582 bits (125), Expect = 1.036e-6
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P       + D AL++L
Sbjct:  555 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRL 830          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778599|gb|GAXK01175969.1| (TSA: Calanus finmarchicus comp2611_c1_seq6 transcribed RNA sequence)

HSP 1 Score: 126.331 bits (316), Expect = 3.611e-32
Identity = 82/234 (35.04%), Postives = 127/234 (54.27%), Query Frame = 0
Query:   24 GLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVV-----RWGWDIIYT-----NANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            GLEN P  D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L   +++ V+        + IIY      ++++G+G+C GDSGG LN   E + K+ Q+GV  FV+SS C+ G  +GF R
Sbjct:  125 GLEN-PGKD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDESNGYVGELTTPVGWGKNADSAGGITPKLQMVEDLPVIDNPTCDETYGIIYDGIMCIDSSNGKGVCNGDSGGSLNMRQEAENKWTQVGVASFVSSSGCESGDPHGFTR 817          

HSP 2 Score: 57.3806 bits (137), Expect = 1.802e-8
Identity = 30/92 (32.61%), Postives = 47/92 (51.09%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEA 320
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P       + D AL++L   +E N+Y+RP CLP    E+
Sbjct:  443 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDES 715          

HSP 3 Score: 52.373 bits (124), Expect = 8.692e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P       + D AL++L
Sbjct:  509 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRL 784          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778601|gb|GAXK01175967.1| (TSA: Calanus finmarchicus comp2611_c1_seq4 transcribed RNA sequence)

HSP 1 Score: 126.331 bits (316), Expect = 1.061e-31
Identity = 82/234 (35.04%), Postives = 127/234 (54.27%), Query Frame = 0
Query:   24 GLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVV-----RWGWDIIYT-----NANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            GLEN P  D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L   +++ V+        + IIY      ++++G+G+C GDSGG LN   E + K+ Q+GV  FV+SS C+ G  +GF R
Sbjct:  302 GLEN-PGKD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDESNGYVGELTTPVGWGKNADSAGGITPKLQMVEDLPVIDNPTCNETYGIIYDGIMCIDSSNGKGVCNGDSGGSLNMRQEAENKWTQVGVASFVSSSGCESGDPHGFTR 994          

HSP 2 Score: 56.6102 bits (135), Expect = 4.790e-8
Identity = 30/92 (32.61%), Postives = 46/92 (50.00%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEA 320
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P         D AL++L   +E N+Y+RP CLP    E+
Sbjct:  620 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRLPEKIEFNDYIRPACLPPAEDES 892          

HSP 3 Score: 51.6026 bits (122), Expect = 1.996e-6
Identity = 30/93 (32.26%), Postives = 46/93 (49.46%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P         D AL++L
Sbjct:  686 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLENDIALVRL 961          
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Match: gi|592778600|gb|GAXK01175968.1| (TSA: Calanus finmarchicus comp2611_c1_seq5 transcribed RNA sequence)

HSP 1 Score: 124.405 bits (311), Expect = 1.871e-31
Identity = 80/234 (34.19%), Postives = 123/234 (52.56%), Query Frame = 0
Query:   24 GLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYS-ELYFAKNVKVVR----------WGWDIIYTNANSGRGICFGDSGGPLNYEME-DGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            GLEN P  D +I+GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  GAH +     EP+     S +  T P         D AL++L   ++ N+Y+RP CLP   D +   +G LTT  GWG N+      + +L    ++ V+               I+  +++ G+G+C GDSGG LN   E + K+ QIGV  FV+S+ C+ G  +GF R
Sbjct:  171 GLEN-PGKD-RIVGGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDESNEYVGELTTPVGWGKNADSAGGITPKLQMVSDLPVIDNPTCNDYYGILNAGIMCIDSSDGKGVCNGDSGGTLNLRQEAENKWTQIGVTSFVSSAGCESGNPHGFTR 863          

HSP 2 Score: 57.7658 bits (138), Expect = 1.671e-8
Identity = 30/95 (31.58%), Postives = 48/95 (50.53%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEAARH 323
            C GS++ + +I+TA HC    ++  I  G H       EP++   TS E +  P       + D AL++L   +E N+Y+RP CLP    E+  +
Sbjct:  480 CGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRLPEKIEFNDYIRPACLPPAEDESNEY 761          

HSP 3 Score: 52.373 bits (124), Expect = 8.972e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
            GGHEAA +++PW    F+    +C GS++ + +I+TA HC    ++  I  G H       EP+    TS E +  P       + D AL++L
Sbjct:  555 GGHEAAENEWPWQVALFIDDAWFCGGSIISDEYIMTAAHCADGASYFNILAGAHDV-RADSEPHRVEITSYEGFTHPDWDPNTLSNDIALVRL 830          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000000580 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1098:131845:138345:1 gene:EMLSAG00000000580 transcript:EMLSAT00000000580 description:"augustus_masked-LSalAtl2s1098-processed-gene-0.1")

HSP 1 Score: 835.869 bits (2158), Expect = 0.000e+0
Identity = 402/402 (100.00%), Postives = 402/402 (100.00%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
            MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP
Sbjct:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000002211 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1418:32411:33184:1 gene:EMLSAG00000002211 transcript:EMLSAT00000002211 description:"augustus_masked-LSalAtl2s1418-processed-gene-0.0")

HSP 1 Score: 355.525 bits (911), Expect = 2.231e-121
Identity = 171/242 (70.66%), Postives = 199/242 (82.23%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSI-ANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDK--TNYSELYFAKNVKVVRWGW--DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            M+ LV L II S  ANPKYPDICGLENKPSVDS++IGG EAAR+QFPWLAFV+T GYCTGSVLDENWIITA+HC+ +D  A +RVGAH+   + ADEPNMQIR SS+IHTS  GDFALIKLESPL LN+YVRP+CLPTRAD NK L+G  TTITGWG+N  D    NY  LYFAKN+ +++ G+  +II T+AN G+ +CFGDSGGPLNYEMEDGKYMQIGVNQFVT+ KC  GVNG+AR +
Sbjct:    1 MKTLVFLAIIASTFANPKYPDICGLENKPSVDSRVIGGQEAARNQFPWLAFVSTFGYCTGSVLDENWIITAKHCIGSDGVAXVRVGAHNKWGSIADEPNMQIRKSSKIHTSSTGDFALIKLESPLDLNKYVRPVCLPTRADVNKTLVGESTTITGWGVNILDPDYVNYPGLYFAKNITIIKCGFAKNIICTDANQGKAVCFGDSGGPLNYEMEDGKYMQIGVNQFVTNGKCVGGVNGYARVS 242          

HSP 2 Score: 124.79 bits (312), Expect = 6.008e-33
Identity = 60/88 (68.18%), Postives = 71/88 (80.68%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHST-GNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
            GG EAAR+QFPWLAFV+T GYCTGSVLDENWIITAKHC+ +D  + +RVG H+  G+ ADEP MQ R S++ + S TGDFALIKLE P
Sbjct:   37 GGQEAARNQFPWLAFVSTFGYCTGSVLDENWIITAKHCIGSDGVAXVRVGAHNKWGSIADEPNMQIRKSSKIHTSSTGDFALIKLESP 124          

HSP 3 Score: 115.546 bits (288), Expect = 1.233e-29
Identity = 56/87 (64.37%), Postives = 68/87 (78.16%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHST-GNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            V+ F  CTGSVLDENWIITAKHC+ +D  + +RVG H+  G+ ADEP  Q R S++ + S TGDFALIKLE PL+LN+YVRPVCLPT
Sbjct:   52 VSTFGYCTGSVLDENWIITAKHCIGSDGVAXVRVGAHNKWGSIADEPNMQIRKSSKIHTSSTGDFALIKLESPLDLNKYVRPVCLPT 138          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000004058 (pep:novel supercontig:LSalAtl2s:LSalAtl2s216:147045:147812:1 gene:EMLSAG00000004058 transcript:EMLSAT00000004058 description:"augustus_masked-LSalAtl2s216-processed-gene-1.1")

HSP 1 Score: 344.739 bits (883), Expect = 3.647e-117
Identity = 167/238 (70.17%), Postives = 189/238 (79.41%), Query Frame = 0
Query:    1 MR-ALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW--DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFAR 235
            MR  LVL+ I  S  ANPKYPD CGLENKP VDSKI+GG EAARHQFPWLA V+T   CTGS+LDENWIITA+HC+  +  A IRVGAHSIA GADEP MQ R SS+IH SP GDFALIKL+ PL+LNEYVRP+CLPTRA+AN    G   TITGWG+N+FD+T Y ELYFAKNVK+++  W  +II T+AN G   CFGDSGGPLNYEME GKYMQIGVNQFVTS  C  G+NG+AR
Sbjct:    1 MRTVLVLVAIFASAFANPKYPDTCGLENKPLVDSKIVGGQEAARHQFPWLASVSTNVACTGSILDENWIITAQHCINPNGGAEIRVGAHSIAYGADEPYMQPRKSSEIHISPNGDFALIKLDIPLELNEYVRPVCLPTRAEANDTFFGESVTITGWGVNNFDRTTYPELYFAKNVKIIQCSWPENIICTDANQGMAXCFGDSGGPLNYEMEXGKYMQIGVNQFVTSLTCVGGINGYAR 238          

HSP 2 Score: 129.413 bits (324), Expect = 1.719e-34
Identity = 60/88 (68.18%), Postives = 69/88 (78.41%), Query Frame = 0
Query:  315 TGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
             GG EAARHQFPWLA V+T   CTGS+LDENWIITA+HC+  +  +EIRVG HS   GADEPYMQ R S+E + SP GDFALIKL+IP
Sbjct:   37 VGGQEAARHQFPWLASVSTNVACTGSILDENWIITAQHCINPNGGAEIRVGAHSIAYGADEPYMQPRKSSEIHISPNGDFALIKLDIP 124          

HSP 3 Score: 125.946 bits (315), Expect = 2.310e-33
Identity = 58/80 (72.50%), Postives = 66/80 (82.50%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            CTGS+LDENWIITA+HC+  +  +EIRVG HS   GADEPY Q R S+E + SP GDFALIKL+IPLELNEYVRPVCLPT
Sbjct:   59 CTGSILDENWIITAQHCINPNGGAEIRVGAHSIAYGADEPYMQPRKSSEIHISPNGDFALIKLDIPLELNEYVRPVCLPT 138          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000004692 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2467:39021:39659:-1 gene:EMLSAG00000004692 transcript:EMLSAT00000004692 description:"augustus_masked-LSalAtl2s2467-processed-gene-0.0")

HSP 1 Score: 324.324 bits (830), Expect = 8.345e-110
Identity = 156/213 (73.24%), Postives = 179/213 (84.04%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSI-ANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWD--IIYTNANSGRGICFGDSGGPLNYEMEDG 210
            M + +LLTIIGSVLANPKYP ICGLENKP VDSKIIGGHEAARHQFPWLAFVTT G+CTGSVLDENWIITA HC+ +   A +RVGAHS  A    EPNMQIR SS+ + SP GDFALIKLESPL+LN+YVRP+CLPTRADANK  +GA TTITGWG+NSFD+ NY ELYFAKNV +++  ++  II T+++ G+ ICFGDSGGPLNYEMEDG
Sbjct:    1 MFSFLLLTIIGSVLANPKYPHICGLENKPFVDSKIIGGHEAARHQFPWLAFVTTDGHCTGSVLDENWIITANHCIGSVGVATVRVGAHSKWATEVHEPNMQIRTSSEFYESPTGDFALIKLESPLELNKYVRPVCLPTRADANKTFVGASTTITGWGVNSFDRANYPELYFAKNVTIIQCSYEENIICTDSDQGKAICFGDSGGPLNYEMEDG 213          

HSP 2 Score: 132.109 bits (331), Expect = 6.067e-36
Identity = 64/88 (72.73%), Postives = 70/88 (79.55%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHST-GNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
            GGHEAARHQFPWLAFVTT G+CTGSVLDENWIITA HC+ +   + +RVG HS       EP MQ RTS+EFYESPTGDFALIKLE P
Sbjct:   37 GGHEAARHQFPWLAFVTTDGHCTGSVLDENWIITANHCIGSVGVATVRVGAHSKWATEVHEPNMQIRTSSEFYESPTGDFALIKLESP 124          

HSP 3 Score: 115.931 bits (289), Expect = 3.499e-30
Identity = 57/82 (69.51%), Postives = 63/82 (76.83%), Query Frame = 0
Query:  235 RCTGSVLDENWIITAKHCVLNDNWSEIRVGIHST-GNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
             CTGSVLDENWIITA HC+ +   + +RVG HS       EP  Q RTS+EFYESPTGDFALIKLE PLELN+YVRPVCLPT
Sbjct:   57 HCTGSVLDENWIITANHCIGSVGVATVRVGAHSKWATEVHEPNMQIRTSSEFYESPTGDFALIKLESPLELNKYVRPVCLPT 138          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000003762 (pep:novel supercontig:LSalAtl2s:LSalAtl2s202:266089:360909:-1 gene:EMLSAG00000003762 transcript:EMLSAT00000003762 description:"maker-LSalAtl2s202-augustus-gene-3.27")

HSP 1 Score: 340.502 bits (872), Expect = 2.808e-105
Identity = 157/224 (70.09%), Postives = 179/224 (79.91%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW--DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVT 222
            MR LV L II S  ANPKYPDICGLENKP  DSKI+GG EAARHQFPWLA V+T G  TGSVLDENWIITA+HCV+ D  AGI VGAHS ANGADEPN Q R SS+IH S IGDFALIKLE PL+LNEYVRP+CLPTRADAN   +GA TTITGWG+N+FD+ NY ELYFAK+V+VV+ G   +++ T+AN G+ +CFGDSGGPLNYEMEDG  +    +Q  T
Sbjct:   74 MRTLVYLAIIASAFANPKYPDICGLENKPFADSKIVGGQEAARHQFPWLASVSTFGSXTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIPLELNEYVRPVCLPTRADANNTFVGASTTITGWGVNNFDRANYPELYFAKDVEVVKCGHGENVLCTDANPGKAVCFGDSGGPLNYEMEDGNQLDQIPDQLFT 297          

HSP 2 Score: 130.954 bits (328), Expect = 1.083e-32
Identity = 62/86 (72.09%), Postives = 66/86 (76.74%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            V+ F   TGSVLDENWIITAKHCV  D  + I VG HS  NGADEP KQ R S+E + S  GDFALIKLEIPLELNEYVRPVCLPT
Sbjct:  125 VSTFGSXTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIPLELNEYVRPVCLPT 210          

HSP 3 Score: 128.642 bits (322), Expect = 7.530e-32
Identity = 61/87 (70.11%), Postives = 65/87 (74.71%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
            GG EAARHQFPWLA V+T G  TGSVLDENWIITAKHCV  D  + I VG HS  NGADEP  Q R S+E + S  GDFALIKLEIP
Sbjct:  110 GGQEAARHQFPWLASVSTFGSXTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIP 196          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000010565 (pep:novel supercontig:LSalAtl2s:LSalAtl2s701:205033:207166:-1 gene:EMLSAG00000010565 transcript:EMLSAT00000010565 description:"snap_masked-LSalAtl2s701-processed-gene-2.2")

HSP 1 Score: 259.996 bits (663), Expect = 8.883e-85
Identity = 129/200 (64.50%), Postives = 149/200 (74.50%), Query Frame = 0
Query:   40 EAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW--DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            EAARHQFPWLA V+T G CTGSVLDENWIITA+HCV+ D  AGI VGAHSIA G DEPN Q R  S+                   LNEYVRP+CLPTRADANK  +GA TTITGWG+N+F + NY ELYFAK+V+VV+ G   +++ T+AN G+ +CFGDSGGPLNYEMEDGKYMQIG NQFVT+ KC  G NG+AR T
Sbjct:   14 EAARHQFPWLASVSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSIAKGTDEPNKQARKVSE-------------------LNEYVRPVCLPTRADANKTFVGASTTITGWGVNNFYRANYPELYFAKDVEVVKCGHGENVLCTDANPGKAVCFGDSGGPLNYEMEDGKYMQIGXNQFVTNGKCAGGHNGYARIT 194          

HSP 2 Score: 95.1301 bits (235), Expect = 6.031e-23
Identity = 46/70 (65.71%), Postives = 49/70 (70.00%), Query Frame = 0
Query:  319 EAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYE 388
            EAARHQFPWLA V+T G CTGSVLDENWIITAKHCV  D  + I VG HS   G DEP  Q R  +E  E
Sbjct:   14 EAARHQFPWLASVSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSIAKGTDEPNKQARKVSELNE 83          

HSP 3 Score: 85.8853 bits (211), Expect = 1.323e-19
Identity = 46/86 (53.49%), Postives = 49/86 (56.98%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            V+ F  CTGSVLDENWIITAKHCV  D  + I VG HS   G DEP KQ R  +                   ELNEYVRPVCLPT
Sbjct:   26 VSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSIAKGTDEPNKQARKVS-------------------ELNEYVRPVCLPT 92          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000003030 (pep:novel supercontig:LSalAtl2s:LSalAtl2s171:72691:75166:-1 gene:EMLSAG00000003030 transcript:EMLSAT00000003030 description:"snap_masked-LSalAtl2s171-processed-gene-0.2")

HSP 1 Score: 255.758 bits (652), Expect = 8.202e-83
Identity = 119/165 (72.12%), Postives = 132/165 (80.00%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNY 165
            MR LV L II S LANPKYPDICGLEN P VDSKI+GG EAARHQFPWLA + T G CTGS+LDE+WIITA+HCVK D  A + VG HSIANGADEP  Q R SS+IH S  GDFALIKLESPL+ NEYVRP+C+PTRADAN+  +G  TTITGWG N +DK NY
Sbjct:   59 MRTLVYLAIIASALANPKYPDICGLENNPLVDSKIVGGQEAARHQFPWLASIYTFGSCTGSILDESWIITAKHCVKTDGVASVLVGVHSIANGADEPYRQNRKSSEIHVSSSGDFALIKLESPLEFNEYVRPVCIPTRADANETFVGESTTITGWGANGYDKVNY 223          

HSP 2 Score: 127.487 bits (319), Expect = 4.867e-34
Identity = 58/87 (66.67%), Postives = 67/87 (77.01%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
            GG EAARHQFPWLA + T G CTGS+LDE+WIITAKHCV  D  + + VG+HS  NGADEPY Q R S+E + S +GDFALIKLE P
Sbjct:   95 GGQEAARHQFPWLASIYTFGSCTGSILDESWIITAKHCVKTDGVASVLVGVHSIANGADEPYRQNRKSSEIHVSSSGDFALIKLESP 181          

HSP 3 Score: 126.716 bits (317), Expect = 7.833e-34
Identity = 56/83 (67.47%), Postives = 66/83 (79.52%), Query Frame = 0
Query:  233 FARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            F  CTGS+LDE+WIITAKHCV  D  + + VG+HS  NGADEPY+Q R S+E + S +GDFALIKLE PLE NEYVRPVC+PT
Sbjct:  113 FGSCTGSILDESWIITAKHCVKTDGVASVLVGVHSIANGADEPYRQNRKSSEIHVSSSGDFALIKLESPLEFNEYVRPVCIPT 195          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000002441 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1469:33430:34032:-1 gene:EMLSAG00000002441 transcript:EMLSAT00000002441 description:"augustus_masked-LSalAtl2s1469-processed-gene-0.0")

HSP 1 Score: 254.218 bits (648), Expect = 1.257e-82
Identity = 124/199 (62.31%), Postives = 148/199 (74.37%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHS-IANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVR--WGWDIIYTNANSGRGICF 196
            MR LV + +I S LANPKYPD CG+ENKPSVDS+IIGG EA R QFPWLA V T G CTGS+LDENWIITA+HC+  +  A +RVGAHS   +  DE NMQIR SS  + S  GDFALIKL S L LN +VRP+CLP RA+ +   IG+  TITGWG+NSFD+ NY+ELYFAKNV +++   G DII T+AN G+G  F
Sbjct:    1 MRTLVFVALIASTLANPKYPDTCGIENKPSVDSRIIGGQEAVRSQFPWLAAVFTHGECTGSILDENWIITAKHCIDLNGVARVRVGAHSKYGSIIDEKNMQIRESSHFNVSSKGDFALIKLNSSLILNRFVRPVCLPXRANVSSSFIGSKATITGWGVNSFDRANYAELYFAKNVSIIQCNQGKDIICTDANHGKGCLF 199          

HSP 2 Score: 102.834 bits (255), Expect = 1.096e-25
Identity = 52/85 (61.18%), Postives = 59/85 (69.41%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHST-GNGADEPYMQTRTSTEFYESPTGDFALIKL 399
            GG EA R QFPWLA V T G CTGS+LDENWIITAKHC+  +  + +RVG HS  G+  DE  MQ R S+ F  S  GDFALIKL
Sbjct:   37 GGQEAVRSQFPWLAAVFTHGECTGSILDENWIITAKHCIDLNGVARVRVGAHSKYGSIIDEKNMQIRESSHFNVSSKGDFALIKL 121          

HSP 3 Score: 93.5893 bits (231), Expect = 1.653e-22
Identity = 47/80 (58.75%), Postives = 55/80 (68.75%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHST-GNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLP 314
            CTGS+LDENWIITAKHC+  +  + +RVG HS  G+  DE   Q R S+ F  S  GDFALIKL   L LN +VRPVCLP
Sbjct:   58 CTGSILDENWIITAKHCIDLNGVARVRVGAHSKYGSIIDEKNMQIRESSHFNVSSKGDFALIKLNSSLILNRFVRPVCLP 137          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000008265 (pep:novel supercontig:LSalAtl2s:LSalAtl2s49:962253:963657:-1 gene:EMLSAG00000008265 transcript:EMLSAT00000008265 description:"maker-LSalAtl2s49-snap-gene-9.24")

HSP 1 Score: 224.557 bits (571), Expect = 7.439e-72
Identity = 107/142 (75.35%), Postives = 116/142 (81.69%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADAN 142
            MR LV L II S LANPKYPD CGLENKP  DSKI+GG EAAR+QFPWLA V T G CTGSVLDENWIITA+HC+     A +RVG HSIA+GA EPNMQ RNSS+IH S  GDFALIKLESPL+LNEYVRP+CLPTR DAN
Sbjct:    1 MRTLVFLAIIASALANPKYPDTCGLENKPLADSKIVGGQEAARNQFPWLASVYTFGACTGSVLDENWIITAKHCIIPLEGAKVRVGVHSIADGAYEPNMQTRNSSEIHVSSTGDFALIKLESPLELNEYVRPVCLPTREDAN 142          

HSP 2 Score: 125.946 bits (315), Expect = 2.119e-34
Identity = 71/138 (51.45%), Postives = 87/138 (63.04%), Query Frame = 0
Query:  196 FGDSGGPLNYEMEDGKYM---QIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAF 330
            + D+ G  N  + D K +   +   NQF   +     V  F  CTGSVLDENWIITAKHC++    +++RVG+HS  +GA EP  QTR S+E + S TGDFALIKLE PLELNEYVRPVCLPT   E A   F +  F
Sbjct:   19 YPDTCGLENKPLADSKIVGGQEAARNQFPWLA----SVYTFGACTGSVLDENWIITAKHCIIPLEGAKVRVGVHSIADGAYEPNMQTRNSSEIHVSSTGDFALIKLESPLELNEYVRPVCLPT--REDANMTFGYDQF 150          

HSP 3 Score: 124.79 bits (312), Expect = 4.913e-34
Identity = 59/88 (67.05%), Postives = 69/88 (78.41%), Query Frame = 0
Query:  315 TGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
             GG EAAR+QFPWLA V T G CTGSVLDENWIITAKHC++    +++RVG+HS  +GA EP MQTR S+E + S TGDFALIKLE P
Sbjct:   36 VGGQEAARNQFPWLASVYTFGACTGSVLDENWIITAKHCIIPLEGAKVRVGVHSIADGAYEPNMQTRNSSEIHVSSTGDFALIKLESP 123          
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Match: EMLSAP00000005882 (pep:novel supercontig:LSalAtl2s:LSalAtl2s3194:2307:3653:1 gene:EMLSAG00000005882 transcript:EMLSAT00000005882 description:"maker-LSalAtl2s3194-augustus-gene-0.3")

HSP 1 Score: 174.866 bits (442), Expect = 4.263e-51
Identity = 103/261 (39.46%), Postives = 144/261 (55.17%), Query Frame = 0
Query:    5 VLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTG-----GYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP---------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI--NSFDKTNYSELYFAKNVKVVR-----------WGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCT 237
            +LL+I     ++ +Y DICG+ENK    SKIIGG EA  +QFPW+  +        G CTGS++++ +I+TA HCV       I  G H  +   DEP+ QI  +++    P           D ALIKLE  L+ N+YVRPICLP  +D  K       T TGWG+   S +  +  +L++   ++V++              D+I  +++  +G+C GDSGGP+NYE+EDGKYMQIGV  FV    CD G   GFAR T
Sbjct:    8 ILLSIAFLQSSSAEYEDICGIENK-EXSSKIIGGQEAEPNQFPWVVAILMSSIFGSGRCTGSIVNKQYILTASHCVAQFDRFTISAGTHDYSK--DEPHQQIMLATESIPHPNFTNNMFEYHDDIALIKLEKELEFNDYVRPICLPKYSDMEKTFADETVTSTGWGLIQGSPNPISVPQLHYVNGLRVIKNDVCAQTYGSLINEDLICIDSSDHKGVCNGDSGGPMNYEIEDGKYMQIGVADFVGGKTCDDGKPEGFARVT 265          

HSP 2 Score: 73.559 bits (179), Expect = 5.666e-15
Identity = 39/92 (42.39%), Postives = 51/92 (55.43%), Query Frame = 0
Query:  232 GFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT---------GDFALIKLEIPLELNEYVRPVCLP 314
            G  RCTGS++++ +I+TA HCV   +   I  G H      DEP++Q   +TE    P           D ALIKLE  LE N+YVRP+CLP
Sbjct:   61 GSGRCTGSIVNKQYILTASHCVAQFDRFTISAGTHDYSK--DEPHQQIMLATESIPHPNFTNNMFEYHDDIALIKLEKELEFNDYVRPICLP 150          

HSP 3 Score: 59.6918 bits (143), Expect = 2.965e-10
Identity = 36/99 (36.36%), Postives = 48/99 (48.48%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTG-----GYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPT---------GDFALIKLE 400
            GG EA  +QFPW+  +        G CTGS++++ +I+TA HCV   +   I  G H      DEP+ Q   +TE    P           D ALIKLE
Sbjct:   39 GGQEAEPNQFPWVVAILMSSIFGSGRCTGSIVNKQYILTASHCVAQFDRFTISAGTHDYSK--DEPHQQIMLATESIPHPNFTNNMFEYHDDIALIKLE 135          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|290457638|sp|Q6GPI1.2|CTRB2_HUMAN (RecName: Full=Chymotrypsinogen B2; Contains: RecName: Full=Chymotrypsin B2 chain A; Contains: RecName: Full=Chymotrypsin B2 chain B; Contains: RecName: Full=Chymotrypsin B2 chain C; Flags: Precursor)

HSP 1 Score: 91.2781 bits (225), Expect = 8.114e-20
Identity = 65/209 (31.10%), Postives = 102/209 (48.80%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIR----VGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            S+I+ G +A    +PW   L   T   +C GS++ E+W++TA HC       G+R    V A     G+DE N+Q+   +++  +P         D  L+KL +P + ++ V  +CLP+ AD + P  G L   TGWG   +      DK   + L    N +  + WG    D++     SG   C GDSGGPL  + +DG +  +G+
Sbjct:   32 SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHC-------GVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS-ADDDFP-AGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQ-KDGAWTLVGI 230          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|1098883660|sp|P17538.2|CTRB1_HUMAN (RecName: Full=Chymotrypsinogen B; Contains: RecName: Full=Chymotrypsin B chain A; Contains: RecName: Full=Chymotrypsin B chain B; Contains: RecName: Full=Chymotrypsin B chain C; Flags: Precursor)

HSP 1 Score: 91.2781 bits (225), Expect = 8.951e-20
Identity = 65/209 (31.10%), Postives = 102/209 (48.80%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIR----VGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            S+I+ G +A    +PW   L   T   +C GS++ E+W++TA HC       G+R    V A     G+DE N+Q+   +++  +P         D  L+KL +P + ++ V  +CLP+ AD + P  G L   TGWG   +      DK   + L    N +  + WG    D++     SG   C GDSGGPL  + +DG +  +G+
Sbjct:   32 SRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHC-------GVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPS-ADDDFP-AGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQ-KDGAWTLVGI 230          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|119771|sp|P16295.1|FA9_CAVPO (RecName: Full=Coagulation factor IX; AltName: Full=Christmas factor)

HSP 1 Score: 90.8929 bits (224), Expect = 1.723e-19
Identity = 69/209 (33.01%), Postives = 97/209 (46.41%), Query Frame = 0
Query:   28 KPSVDS-KIIGGHEAARHQFPWLAFVT--TGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQI--HTSPIGDF-------ALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWG-INSFDKT----NYSELYFAKNVKVVRWGWDIIYTNA------NSGRGICFGDSGGPLNYEMEDGKYM 213
            KPS +  +++GG +A   QFPW   +   T  +C GS+++E WI+TA HC+       +  G H+I    D    Q RN +QI  H S    F       AL++L+ PL LN YV PIC+  R   N  L      ++GWG + S  +T     Y  +        +R     IY N         GR  C GDSGGP   E+E   ++
Sbjct:   51 KPSDEFFRVVGGEDAKPGQFPWQVLLNGETEAFCGGSIVNEKWIVTAAHCILPGIKIEVVAGKHNIEKKEDTE--QRRNVTQIILHHSYNASFNKYSHDIALLELDKPLSLNSYVTPICIANREYTNIFLKFGAGYVSGWGKLFSQGRTASILQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVEGTNFL 257          

HSP 2 Score: 57.7658 bits (138), Expect = 3.293e-8
Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 0
Query:  234 ARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDF-------ALIKLEIPLELNEYVRPVCL 313
            A C GS+++E WI+TA HC+L     E+  G H+     D   ++  T    + S    F       AL++L+ PL LN YV P+C+
Sbjct:   82 AFCGGSIVNEKWIVTAAHCILPGIKIEVVAGKHNIEKKEDTEQRRNVTQIILHHSYNASFNKYSHDIALLELDKPLSLNSYVTPICI 168          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|129688|sp|P21902.1|PCE_TACTR (RecName: Full=Proclotting enzyme; Contains: RecName: Full=Proclotting enzyme light chain; Contains: RecName: Full=Proclotting enzyme heavy chain; Flags: Precursor)

HSP 1 Score: 92.4337 bits (228), Expect = 1.887e-19
Identity = 68/241 (28.22%), Postives = 113/241 (46.89%), Query Frame = 0
Query:   17 PKYPDICGLENKPSVDSKIIGGHEAARHQFPWL--AFVTTGGY----CTGSVLDENWIITARHCVKNDAWA--------GIRVGAHSIANGADEPN-MQIRNSSQIH------TSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW---------DIIYTN-------ANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQF 220
            P  P++CG+ N  +  ++IIGG EA    +PW+   ++  GG     C G+++    +ITA HCV N A           +R+G H++ +  D+ N +    +S  H       + + D A++ L   +   + +RPICLP R      L      ITGWG  +F+  + + L   + V++  W           D+  TN       A+ G+  C GDSGGP+   ++ G++  IG+  F
Sbjct:  112 PNLPEVCGIHN--TTTTRIIGGREAPIGAWPWMTAVYIKQGGIRSVQCGGALVTNRHVITASHCVVNSAGTDVMPADVFSVRLGEHNLYSTDDDSNPIDFAVTSVKHHEHFVLATYLNDIAILTLNDTVTFTDRIRPICLPYRKLRYDDLAMRKPFITGWGTTAFNGPSSAVL---REVQLPIWEHEACRQAYEKDLNITNVYMCAGFADGGKDACQGDSGGPMMLPVKTGEFYLIGIVSF 347          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|81916772|sp|Q9CR35.1|CTRB1_MOUSE (RecName: Full=Chymotrypsinogen B; Contains: RecName: Full=Chymotrypsin B chain A; Contains: RecName: Full=Chymotrypsin B chain B; Contains: RecName: Full=Chymotrypsin B chain C; Flags: Precursor)

HSP 1 Score: 89.7373 bits (221), Expect = 3.568e-19
Identity = 67/209 (32.06%), Postives = 98/209 (46.89%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIR----VGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            S+I+ G +A    +PW   L   T   +C GS++ ENW++TA HC       G++    V A     G+DE N+Q+   +Q+  +P         D  L+KL +P + +E V  +CLPT  D + P  G L   TGWG   +      DK   + L      K    WG    D++     SG   C GDSGGPL  + +DG +   G+
Sbjct:   32 SRIVNGEDAIPGSWPWQVSLQDRTGFHFCGGSLISENWVVTAAHC-------GVKTTDVVVAGEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRNDITLLKLATPAQFSETVSAVCLPT-VDDDFP-AGTLCATTGWGKTKYNALKTPDKLQQAALPIVSEAKCKESWGSKITDVMICAGASGVSSCMGDSGGPLVCQ-KDGVWTLAGI 230          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|119257|sp|P05208.1|CEL2A_MOUSE (RecName: Full=Chymotrypsin-like elastase family member 2A; AltName: Full=Elastase-2; AltName: Full=Elastase-2A; Flags: Precursor)

HSP 1 Score: 89.3521 bits (220), Expect = 4.924e-19
Identity = 75/254 (29.53%), Postives = 122/254 (48.03%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVD--SKIIGGHEAARHQFPW---LAFVTTGGY---CTGSVLDENWIITARHCVKNDAWAGIRVGAHSIAN-GADEPNMQIRN---SSQIHTSPIG---DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI-----NSFDKTNYSELY---FAKNVKVVRWGWDIIYTNANSG----RGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCD 227
            +R L+L  ++   L+       CG       D  S+++GG EA  + +PW   L  +++G +   C GS++  NW++TA HC+ N     + +GAHS++N GA    +Q+       + ++  +G   D ALIKL SP+ L++ ++  CLP  A    P    +  +TGWG+     NS D      L    +A       WG  +  +   +G       C GDSGGPLN    +G++   G+  F +S  C+
Sbjct:    2 IRTLLLSALVAGALS-------CGYPTYEVEDDVSRVVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPP-AGTILPR-NYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCN 246          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|1706190|sp|P80646.1|CTRB_GADMO (RecName: Full=Chymotrypsin B; Contains: RecName: Full=Chymotrypsin B chain A; Contains: RecName: Full=Chymotrypsin B chain B; Flags: Precursor)

HSP 1 Score: 88.5817 bits (218), Expect = 5.490e-19
Identity = 66/216 (30.56%), Postives = 107/216 (49.54%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW-LAFVTTGGY--CTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSF------DKTNYSELYFAKNVKVVR-WG----WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCD 227
            ++I+ G EA  H +PW ++   + G+  C GS+++ENW++TA HC     +  + VG H   + A + N+QI   S + T P         D +LIKL SP  L   V P+CL   +D   P +  +T  +GWG+  +      +K   + L    N +  + WG     D++     +G   C GDSGGPL  + +D  +  +G+  +  SS+C 
Sbjct:   14 ARIVNGEEAVPHSWPWQVSLQQSNGFHFCGGSLINENWVVTAAHC-NVRTYHRVIVGEH---DKASDENIQILKPSMVFTHPKWDSRTINNDISLIKLASPAVLGTNVSPVCLGESSDVFAPGMKCVT--SGWGLTRYNAPGTPNKLQQAALPLMSNEECSQTWGNNMISDVMICAGAAGATSCMGDSGGPLVCQ-KDNVWTLVGIVSW-GSSRCS 221          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|461857|sp|Q00871.1|CTRB1_LITVA (RecName: Full=Chymotrypsin BI; Flags: Precursor)

HSP 1 Score: 88.5817 bits (218), Expect = 1.054e-18
Identity = 64/215 (29.77%), Postives = 103/215 (47.91%), Query Frame = 0
Query:   34 KIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVR----------WGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRG 229
            +I+GG EA  H +P  A  F+    +C GS++   W++TA HC+    +  + +GAH+I    +E +     S+   T           D ALI+L SP+ LN  ++ + LP+ +D +   +G   T TGWG  S   +  S++    NV V+            G  ++  +   G+  C GDSGGPLN        M  G+  F +S+ C++G
Sbjct:   45 RIVGGVEATPHSWPHQAALFIDDMYFCGGSLISSEWVLTAAHCMDGAGFVEVVLGAHNIRQ--NEASQVSITSTDFFTHENWNSWLLTNDIALIRLPSPVSLNSNIKTVKLPS-SDVS---VGTTVTPTGWGRPSDSASGISDVLRQVNVPVMTNADCDSVYGIVGDGVVCIDGTGGKSTCNGDSGGPLNLNG-----MTYGITSFGSSAGCEKG 248          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|117612|sp|P04813.1|CTR2_CANFA (RecName: Full=Chymotrypsinogen 2; Contains: RecName: Full=Chymotrypsin 2 chain A; Contains: RecName: Full=Chymotrypsin 2 chain B; Contains: RecName: Full=Chymotrypsin 2 chain C; Flags: Precursor)

HSP 1 Score: 87.8113 bits (216), Expect = 1.721e-18
Identity = 68/230 (29.57%), Postives = 109/230 (47.39%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPW---LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIA----NGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI------NSFDKTNYSELYFAKNVKVVR-WG---WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNG-FARCT 237
            S+I+ G +A    +PW   L   T   +C GS++ E+W++TA HC       G+R     +A     G+D  ++Q+   +++  +P         D  L+KL +P + ++ V  +CLP   D + P  G L   TGWG+      N+ DK   + L    N +  + WG    D++     SG   C GDSGGPL  + +DG +  +G+  +  S  C     G +AR T
Sbjct:   32 SRIVNGEDAVPGSWPWQVSLQDSTGFHFCGGSLISEDWVVTAAHC-------GVRTTHQVVAGEFDQGSDAESIQVLKIAKVFKNPKFNMFTINNDITLLKLATPARFSKTVSAVCLPQATD-DFP-AGTLCVTTGWGLTKHTNANTPDKLQQAALPLLSNAECKKFWGSKITDLMVCAGASGVSSCMGDSGGPLVCQ-KDGAWTLVGIVSW-GSGTCSTSTPGVYARVT 250          
BLAST of EMLSAG00000000580 vs. SwissProt
Match: gi|119775|sp|P16292.1|FA9_RABIT (RecName: Full=Coagulation factor IX; AltName: Full=Christmas factor)

HSP 1 Score: 87.4261 bits (215), Expect = 2.647e-18
Identity = 63/204 (30.88%), Postives = 94/204 (46.08%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPWLAFVT--TGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQI-----HTSPIG----DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDK------TNYSELYFAKNVKVVRWGWDIIYTNAN------SGRGICFGDSGGPLNYEMEDGKYM 213
            ++I+GG  A   QFPW   +      +C GS+++E W++TA HC+K D    +  G ++I     E   Q RN  +I     + + I     D AL++L+ PL LN YV PIC+  R   N  L      ++GWG   F++        Y  + F      +R     IY N         G+  C GDSGGP   E+E   ++
Sbjct:   47 TRIVGGENAKPGQFPWQVLLNGKVEAFCGGSIINEKWVVTAAHCIKPDDNITVVAGEYNIQE--TENTEQKRNVIRIIPYHKYNATINKYNHDIALLELDKPLTLNSYVTPICIANREYTNIFLNFGSGYVSGWG-RVFNRGRQASILQYLRVPFVDRATCLRSTKFTIYNNMFCAGFDVGGKDSCEGDSGGPHVTEVEGTSFL 247          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX82218.1 (hypothetical protein DAPPUDRAFT_33543, partial [Daphnia pulex])

HSP 1 Score: 119.398 bits (298), Expect = 1.578e-30
Identity = 74/235 (31.49%), Postives = 124/235 (52.77%), Query Frame = 0
Query:   34 KIIGGHEAARHQFPWLAFVTTGG------YCTGSVLDENWIITARHCV----KNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRAD---ANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVR-------WGWD-----IIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFAR 235
            +I+GG  A+ ++FPW AF+  G       YC G+++ + WI+T+ +C+    +      + +GAH I     E N ++ + SQ+   P        GD A+I+L + +   +Y+RP+CL T  +   A+ P+     T+TGWG      ++ + L    +V V+        +G +     II T+  + RGIC GD GGP+N++  DG + QIG+  FV++S C RG  +G+ R
Sbjct:    1 RIVGGDPASPNEFPWQAFLNVGMTSGATYYCGGTLIADRWILTSANCLVVSGQTLKSVNVYLGAHDI-TATSEVNRRVYSGSQVFLHPDYNANNQAGDIAMIQLTTSVTYTQYIRPVCLATSTEPDYASSPV-----TVTGWGTTYDGASSLNSLLRKVSVPVITNAECSSTYGSNVVTDKIICTSGANSRGICTGDGGGPMNFKQSDGTWKQIGIVSFVSASGCQRGYPSGYTR 229          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX82212.1 (hypothetical protein DAPPUDRAFT_49241 [Daphnia pulex])

HSP 1 Score: 117.472 bits (293), Expect = 2.208e-29
Identity = 70/232 (30.17%), Postives = 122/232 (52.59%), Query Frame = 0
Query:   34 KIIGGHEAARHQFPWLAFVTTGGY------CTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGAD--EPNMQIRN--------SSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW-----------DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCT 237
            +I+GG E A ++FPW  F+           C GS++ + WI+TA HC++N     + +GAH++ +  +  + N + R+        S+ +H    GD  LI+L   ++ ++YVRPICL + A++    +G    +TGWG+ S +    S +    + +V+               +++ T+  +  G C GDSGGP++ EM DG + QIG+  F ++  C++G  NGF R +
Sbjct:    2 RIVGGVETAPNEFPWQVFLVLEKANHQLFSCGGSLISDRWILTAAHCLENVVIVHVTLGAHNVDDDKEIHQENYRSRDYYIHPDWDSNTLH----GDIGLIRLPESIEFSDYVRPICLDSPAESLNDYVGETVVLTGWGLYSDEGGGSSSILRKTSAEVITNQECYEQYDSLITDEMMCTSTANHHGTCNGDSGGPMHLEMADGSWKQIGIVSFGSNLGCEKGYPNGFTRVS 229          

HSP 2 Score: 55.4546 bits (132), Expect = 8.591e-8
Identity = 28/87 (32.18%), Postives = 48/87 (55.17%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT-------GDFALIKLEIPLELNEYVRPVCLPT 315
            C GS++ + WI+TA HC+ N     + +G H+  +   E +++   S ++Y  P        GD  LI+L   +E ++YVRP+CL +
Sbjct:   32 CGGSLISDRWILTAAHCLENVVIVHVTLGAHNVDDDK-EIHQENYRSRDYYIHPDWDSNTLHGDIGLIRLPESIEFSDYVRPICLDS 117          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX82341.1 (hypothetical protein DAPPUDRAFT_316896 [Daphnia pulex])

HSP 1 Score: 115.546 bits (288), Expect = 1.182e-28
Identity = 73/235 (31.06%), Postives = 117/235 (49.79%), Query Frame = 0
Query:   30 SVDSKIIGGHEAARHQFPWLAFVTT------GGYCTGSVLDENWIITARHCV----KNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPI-------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVR-------WGW----DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRG-VNGFAR 235
            S +S+I+GG E   ++FPW AF+           C G+++ + WI+TA  C+    +   +  + +GAH       E N ++ ++S+I   P        GD ALIKL+S +K ++Y+RP+CL             + T+TGWG         S +     V V+        +G     DI+ T+  +  G C GDSGGP+NY+  DG++ QIG+  F ++  C +G  NG+ R
Sbjct:    6 SSNSRIVGGVETQPNEFPWQAFLQVEMQSGNAYACGGTLIADRWILTAARCLVVPGQKVRYIDVYLGAHD-RTAESEDNRKLYSNSEIFIHPAWNPATDAGDVALIKLKSAVKYSQYIRPVCLSISGIDEPDYADEMVTVTGWGTTYDGSPRMSPVLHKMTVPVISNNDCKTTYGDNITDDIMCTSGANNMGTCIGDSGGPMNYKQMDGRWKQIGIISFGSTEGCQKGHPNGYTR 239          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: gb|EFA10697.1| (serine protease P127 [Tribolium castaneum])

HSP 1 Score: 114.39 bits (285), Expect = 3.061e-28
Identity = 92/287 (32.06%), Postives = 137/287 (47.74%), Query Frame = 0
Query:    1 MRA--LVLLTIIGSVLANPK----------YPDICGLENKPSVDSKIIGGHEAARHQFPWLAFV-----TTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTS-----PIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI-NSFDKT-----NYSELYFAKNVKVVRWGWD----IIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLN 255
            M+A  +++L I+    A PK           P +  L+++PS   KIIGGHEA  H  P+ AF+     + G YC GS++ +N+++TA HC  +   A + +GAH      D     +    ++H        I D A+IKL   +   + V+ + LP++ADAN    G    I+GWG+ + FD       NY ++    N K      D    I+ T+ +   G C GDSGGPL   ++D   +QIGV  F          + F+R T S LD  WI T    V+N
Sbjct:    1 MKASLILILGIVALAAAAPKPTKLNYRNLYKPPVGPLKHRPS--PKIIGGHEATPHSIPYQAFLEVYSGSEGWYCGGSLISQNYVLTAGHCGVDATEAHVTLGAHKPLQDEDTQVKIVSKDVKVHEQYNAELIINDVAVIKLPKAVTFTDAVKAVALPSKADANNTFEGETARISGWGLTDGFDNKLSEVLNYVDVKVISNAKCGEAFGDLKDSIVCTSGDENTGSCNGDSGGPL--AIDD---VQIGVVSFGIMYCLSGYPSAFSRVT-SFLD--WIATNSDVVIN 277          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX79604.1 (chymotrypsin-like protein [Daphnia pulex])

HSP 1 Score: 112.464 bits (280), Expect = 2.199e-27
Identity = 77/238 (32.35%), Postives = 125/238 (52.52%), Query Frame = 0
Query:   22 ICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSI-ANGADEPN-MQIR-NSSQIHTS-----PIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVR-------WGWD----IIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCT 237
             CG EN  S +S+I+GG EA  H  PW    FV    +C GS++   WI+TA HC ++  +  I +G+H++  N  +EP+  +IR N S +H        + D AL+K+  P+K    ++P+CL   ++ +   +  +  ++GWG +S      S++    +V  +        +G      II  +   GRG C GDSGGPL + + DG + Q+GV  F +S  CD+ +  GF+R +
Sbjct:   58 FCGREN--STNSRIVGGTEAEPHSLPWQVALFVDDRFFCGGSLISNEWILTAAHCAEDAGFFDILLGSHNVRLNATEEPSRFEIRSNVSIVHPGWSSFRFMNDIALVKIPQPIKFTPEIQPVCLAPPSEPDH--VDDILHVSGWGRHSELTPGISQVLREIDVPCISNEECALTYGETITDGIICISTAGGRGSCNGDSGGPLTF-VNDGVHNQVGVVSFGSSMGCDKNLPAGFSRVS 290          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX89389.1 (hypothetical protein DAPPUDRAFT_230174 [Daphnia pulex])

HSP 1 Score: 111.309 bits (277), Expect = 6.524e-27
Identity = 79/241 (32.78%), Postives = 123/241 (51.04%), Query Frame = 0
Query:   23 CGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLN-EYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVV-------RWGWDII--------YTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRG-VNGFARCT 237
            CG+ N     ++II G EA  ++FPW+A  F++ G +CT S++ + WI+TA HC     +  + +GAH++     EP      +++ + +P        GD ALIKL +P+ ++ + VRPICL    D +   +GA   I GWG  +      S       V V+        +G  II        +T+ NS  G C GDSG  ++    +G+Y QIGV  FV+S+ C  G  +G+AR +
Sbjct:   66 CGVANP----ARIINGAEATPNEFPWVAALFISGGSFCTASLISDQWILTAAHCADGALYFDVYLGAHNVR--VTEPTRLEIRATEKYINPNWNPNTLNGDVALIKLPAPVDISGDLVRPICLQDPTDTDL-YVGASAKIAGWGKTADGPGGISPTLQKSTVTVITNAECQNTYGALIIRDYTICTSFTDTNS--GTCNGDSGSAMSVINANGQYTQIGVTSFVSSAGCASGNPDGYARVS 297          

HSP 2 Score: 60.077 bits (144), Expect = 3.424e-9
Identity = 34/95 (35.79%), Postives = 51/95 (53.68%), Query Frame = 0
Query:  317 GHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKLEIP 402
            G EA  ++FPW+A  F++ G +CT S++ + WI+TA HC     + ++ +G H+      EP      +TE Y +P        GD ALIKL  P
Sbjct:   77 GAEATPNEFPWVAALFISGGSFCTASLISDQWILTAAHCADGALYFDVYLGAHNV--RVTEPTRLEIRATEKYINPNWNPNTLNGDVALIKLPAP 169          

HSP 3 Score: 55.4546 bits (132), Expect = 9.922e-8
Identity = 31/92 (33.70%), Postives = 52/92 (56.52%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELN-EYVRPVCL 313
            ++G + CT S++ + WI+TA HC     + ++ +G H+      EP +    +TE Y +P        GD ALIKL  P++++ + VRP+CL
Sbjct:   93 ISGGSFCTASLISDQWILTAAHCADGALYFDVYLGAHNV--RVTEPTRLEIRATEKYINPNWNPNTLNGDVALIKLPAPVDISGDLVRPICL 182          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: gb|EFA10698.1| (serine protease P128 [Tribolium castaneum])

HSP 1 Score: 108.612 bits (270), Expect = 3.125e-26
Identity = 90/286 (31.47%), Postives = 129/286 (45.10%), Query Frame = 0
Query:    1 MRALVL-LTIIGSVLANPK----------YPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGG-----YCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTS-----PIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINS-FDKTNYSELYFAKNVKV---------VRWGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLN 255
            M+ ++L LTI     A PK           P I G E K   + +IIGGHEA  H  P+ AF+         YC GS++ +N+++TA HC      A + +GAH +    D          ++H        + D A+IKL  P+ L + ++ + LP + D N   +G    I+GWG+ S F   +   LY   NV             +   ++ T+ +   G C GDSGGPL   + DG  +QIGV  F          +GF R T S LD  WI T    V+N
Sbjct:    1 MKTIILFLTITALAAAFPKTTKLHYRNLYKPPISG-ETKHKPNPRIIGGHEAIPHSIPYQAFLEIYADGEAYYCGGSLISQNYVLTAAHCGVGVTEALVTLGAHKVFETEDTQVKITSKEIKVHEEYDDNLIVNDIAVIKLPQPVNLTDSIKTVALPNKTDVNNTFVGTTARISGWGLTSGFGDVSKVLLYVDVNVITNIDCGNQFDEDFADSVLCTSGDQETGSCNGDSGGPL---VVDG--VQIGVVSFGVMWCLPGYPSGFTRIT-SFLD--WIATNSDVVIN 277          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX82344.1 (hypothetical protein DAPPUDRAFT_49170 [Daphnia pulex])

HSP 1 Score: 108.997 bits (271), Expect = 7.761e-26
Identity = 70/223 (31.39%), Postives = 115/223 (51.57%), Query Frame = 0
Query:   32 DSKIIGGHEAARHQFPWLAFV----TTG--GYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFD-KTNYSELYFAKNVKVVRWG-----------WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRG 229
            +++I+GG     ++FPW AF+    +TG  G+C GS++   WI+TA HC+       + +GAH+I     E N +  ++ Q+  +P        GD ALIKL S +  + Y+RPICLP+  + +   +     +TGWG ++    ++ S +     V V+                ++ T+ +S RG C GDSGGP+NY   +G++ QIG+  F +   C  G
Sbjct:   65 NNRIVGGTATYPNEFPWQAFLRVEMSTGSIGFCGGSLISNRWILTAAHCLS----VKVYLGAHNIT--TYETNRKSYSAMQVFINPEWNQTTLAGDIALIKLYSLVTFSRYIRPICLPSTVEPD--YVNQNVVVTGWGSSTTRGNSSLSPVLRKATVPVISNAECRSIYKGIITSKVMCTSGSSYRGTCNGDSGGPMNYRQSNGRWKQIGIVSFGSLVNCQSG 279          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX79602.1 (chymotrypsin-like protein [Daphnia pulex])

HSP 1 Score: 107.842 bits (268), Expect = 9.933e-26
Identity = 72/230 (31.30%), Postives = 114/230 (49.57%), Query Frame = 0
Query:   30 SVDSKIIGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITARHCVKNDAWAGIRVGAHSI-ANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVR-------WGWDI----IYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCT 237
            S  S+I+GG EA  H  PW   +   G  +C G+++   W++TA HC  N  +  I +G+H++    A+EP      S+Q    P       I D ALIKL +P++    ++PIC+    + +    G +  I+GWG  S      S +    +V  +        +G  I    I  +   G+G C GDSGGPL Y + +G + Q+GV  F +S+ C+ G+  GF+R +
Sbjct:   62 SAPSRIVGGTEATPHSAPWQVAIFIDGQYFCGGTLISNEWVLTAAHCADNAIFFNIYLGSHNVRLTAAEEPTRVEVRSTQYTVHPNWGSIRIINDVALIKLPAPIEFTPEIQPICMAPSTEPDH--TGDILHISGWGKPSDAAAGISPVLREVDVPCISNAECAATYGATITAGNICVDTTGGKGSCNGDSGGPLTY-VANGVHNQVGVVSFGSSAGCEVGLPAGFSRVS 288          

HSP 2 Score: 53.9138 bits (128), Expect = 3.809e-7
Identity = 28/92 (30.43%), Postives = 47/92 (51.09%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTG-NGADEPYKQTRTSTEFYESPT-------GDFALIKLEIPLELNEYVRPVCL 313
            ++G   C G+++   W++TA HC  N  +  I +G H+     A+EP +    ST++   P         D ALIKL  P+E    ++P+C+
Sbjct:   86 IDGQYFCGGTLISNEWVLTAAHCADNAIFFNIYLGSHNVRLTAAEEPTRVEVRSTQYTVHPNWGSIRIINDVALIKLPAPIEFTPEIQPICM 177          
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Match: EFX82345.1 (putative chymotrypsin precursor-1 protein [Daphnia pulex])

HSP 1 Score: 104.76 bits (260), Expect = 4.560e-24
Identity = 75/238 (31.51%), Postives = 115/238 (48.32%), Query Frame = 0
Query:   23 CGLEN-KPSVDSKIIGGHEAARHQFPWLAFV---TTGG---YCTGSVLDENWIITARHCV----KNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKP-LIGALTTITGWGINSFDKTNYSELYFAKNVKVVR-------WGWDIIY-----TNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRG 229
            CG+ N       +I+GG +A  ++FPW AFV   T  G   YC GS++ + WI+T+  CV    +   +  I +GAH I   + E N ++ N  + +  P        GD ALIKL + +   +Y+RP+CL T    N+P  + +   + GWG  S      S +     V V+        +G  ++      T     RG C GD+GGPL +   +G++ QIG+  FV+S  C  G
Sbjct:   98 CGVANLMDEATDRIVGGVQAIPNEFPWQAFVKVETNAGNIYYCGGSLIADRWILTSARCVLIPGQTLRYLTIYLGAHDI-TASYEANRRVYNGYEAYIHPEWNPSTQAGDIALIKLCNIVTYTQYIRPVCLATY---NEPSYVNSQVAVAGWGTTSDGSYTLSPVLREVTVPVISNTQCSNYYGSAVVTSKVMCTTGMLSRGPCNGDNGGPLIFRESNGRWKQIGIVSFVSSQGCQSG 331          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|155966294|gb|ABU41100.1| (serine proteinase [Lepeophtheirus salmonis])

HSP 1 Score: 369.392 bits (947), Expect = 9.862e-125
Identity = 176/239 (73.64%), Postives = 198/239 (82.85%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW--DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            MR LV L II S  ANPKYPDICGLENKP  DSKI+GG EAARHQFPWLA V+T G CTGSVLDENWIITA+HCV+ D  AGI VGAHS ANGADEPN Q R SS+IH S IGDFALIKLE PL+LNEYVRP+CLPTRADAN   +GA TTITGWG+N+FD+ NY ELYFAK+V+VV+ G   +++ T+AN G+ +CFGDSGGPLNYEMEDGKYMQIGVNQFVT+ KC  G NG+AR T
Sbjct:    1 MRTLVYLAIIASAFANPKYPDICGLENKPFADSKIVGGQEAARHQFPWLASVSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIPLELNEYVRPVCLPTRADANNTFVGASTTITGWGVNNFDRANYPELYFAKDVEVVKCGHGENVLCTDANPGKAVCFGDSGGPLNYEMEDGKYMQIGVNQFVTNGKCAGGHNGYARIT 239          

HSP 2 Score: 130.568 bits (327), Expect = 6.681e-32
Identity = 63/86 (73.26%), Postives = 67/86 (77.91%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            V+ F  CTGSVLDENWIITAKHCV  D  + I VG HS  NGADEP KQ R S+E + S  GDFALIKLEIPLELNEYVRPVCLPT
Sbjct:   52 VSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIPLELNEYVRPVCLPT 137          

HSP 3 Score: 127.487 bits (319), Expect = 9.894e-31
Identity = 62/88 (70.45%), Postives = 66/88 (75.00%), Query Frame = 0
Query:  315 TGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
             GG EAARHQFPWLA V+T G CTGSVLDENWIITAKHCV  D  + I VG HS  NGADEP  Q R S+E + S  GDFALIKLEIP
Sbjct:   36 VGGQEAARHQFPWLASVSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIP 123          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|290563022|gb|ADD38905.1| (Collagenase [Lepeophtheirus salmonis])

HSP 1 Score: 369.392 bits (947), Expect = 1.076e-124
Identity = 176/239 (73.64%), Postives = 198/239 (82.85%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGW--DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            MR LV L II S  ANPKYPDICGLENKP  DSKI+GG EAARHQFPWLA V+T G CTGSVLDENWIITA+HCV+ D  AGI VGAHS ANGADEPN Q R SS+IH S IGDFALIKLE PL+LNEYVRP+CLPTRADAN   +GA TTITGWG+N+FD+ NY ELYFAK+V+VV+ G   +++ T+AN G+ +CFGDSGGPLNYEMEDGKYMQIGVNQFVT+ KC  G NG+AR T
Sbjct:    1 MRTLVYLAIIASAFANPKYPDICGLENKPFADSKIVGGQEAARHQFPWLASVSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIPLELNEYVRPVCLPTRADANNTFVGASTTITGWGVNNFDRANYPELYFAKDVEVVKCGHGENVLCTDANPGKAVCFGDSGGPLNYEMEDGKYMQIGVNQFVTNGKCAGGHNGYARIT 239          

HSP 2 Score: 130.568 bits (327), Expect = 7.037e-32
Identity = 63/86 (73.26%), Postives = 67/86 (77.91%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            V+ F  CTGSVLDENWIITAKHCV  D  + I VG HS  NGADEP KQ R S+E + S  GDFALIKLEIPLELNEYVRPVCLPT
Sbjct:   52 VSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIPLELNEYVRPVCLPT 137          

HSP 3 Score: 127.487 bits (319), Expect = 9.997e-31
Identity = 62/88 (70.45%), Postives = 66/88 (75.00%), Query Frame = 0
Query:  315 TGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
             GG EAARHQFPWLA V+T G CTGSVLDENWIITAKHCV  D  + I VG HS  NGADEP  Q R S+E + S  GDFALIKLEIP
Sbjct:   36 VGGQEAARHQFPWLASVSTFGSCTGSVLDENWIITAKHCVQTDGVAGILVGAHSKANGADEPNKQARKSSEIHVSSIGDFALIKLEIP 123          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|290562501|gb|ADD38646.1| (Chymotrypsin-like elastase family member 2A [Lepeophtheirus salmonis])

HSP 1 Score: 357.451 bits (916), Expect = 5.647e-120
Identity = 172/238 (72.27%), Postives = 192/238 (80.67%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWD-IIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            MR LV L II S LANPKYPD CGLENKP  DSKI+GG EAAR+QFPWLA V T G CTGSVLDENWIITA+HC+     A +RVG HSIA+GA EPNMQ RNSS+IH S  GDFALIKLESPL+LNEYVRP+CLPTR DAN   +G  TTITGWGINSFD+T Y ELYFAKNVKV+   W  +I T++N G+ ICFGDSGGPLNYEMEDGKYMQIGVN+ VT+ KC  G+NG+AR T
Sbjct:    1 MRTLVFLAIIASALANPKYPDTCGLENKPLADSKIVGGQEAARNQFPWLASVYTFGACTGSVLDENWIITAKHCIIPLEGAKVRVGVHSIADGAYEPNMQTRNSSEIHVSSTGDFALIKLESPLELNEYVRPVCLPTREDANMTFVGKSTTITGWGINSFDRTTYPELYFAKNVKVIECNWRGVICTDSNPGKAICFGDSGGPLNYEMEDGKYMQIGVNRLVTNPKCVGGINGYARMT 238          

HSP 2 Score: 124.79 bits (312), Expect = 1.267e-29
Identity = 72/142 (50.70%), Postives = 88/142 (61.97%), Query Frame = 0
Query:  196 FGDSGGPLNYEMEDGKYM---QIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVTTG 334
            + D+ G  N  + D K +   +   NQF   +     V  F  CTGSVLDENWIITAKHC++    +++RVG+HS  +GA EP  QTR S+E + S TGDFALIKLE PLELNEYVRPVCLPT   E A   F   +   TG
Sbjct:   19 YPDTCGLENKPLADSKIVGGQEAARNQFPWLAS----VYTFGACTGSVLDENWIITAKHCIIPLEGAKVRVGVHSIADGAYEPNMQTRNSSEIHVSSTGDFALIKLESPLELNEYVRPVCLPT--REDANMTFVGKSTTITG 154          

HSP 3 Score: 124.02 bits (310), Expect = 2.057e-29
Identity = 59/87 (67.82%), Postives = 69/87 (79.31%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
            GG EAAR+QFPWLA V T G CTGSVLDENWIITAKHC++    +++RVG+HS  +GA EP MQTR S+E + S TGDFALIKLE P
Sbjct:   37 GGQEAARNQFPWLASVYTFGACTGSVLDENWIITAKHCIIPLEGAKVRVGVHSIADGAYEPNMQTRNSSEIHVSSTGDFALIKLESP 123          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|225718906|gb|ACO15299.1| (Collagenase precursor [Caligus clemensi])

HSP 1 Score: 294.278 bits (752), Expect = 4.751e-95
Identity = 145/239 (60.67%), Postives = 177/239 (74.06%), Query Frame = 0
Query:    4 LVLLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITARHCVK--NDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFD-KTNYSELYFAKNVKVVRWGW--DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            L+L T I +V ANPKYP+ICGLENKP+   +IIGG EAAR+QFPWLA V  GGYCTGSVLDENW+ITA+HCV   + AWA  + G H+  +G  EP+MQ R S +IH SP GDFAL+K+  P +LNE+VRP+CLP+RAD     +G   TITGWG+ SFD K  Y ELYF K VKV +     +I+ +N+++G  ICFGDSGGPLNYE +DGKYMQIGVNQFV+S  C  G NG+AR T
Sbjct:    5 LILTTFIATVFANPKYPEICGLENKPADSGRIIGGQEAARNQFPWLAAVLAGGYCTGSVLDENWVITAKHCVTVGHPAWA--KAGVHNRFDGNIEPHMQDRRSDEIHVSPHGDFALMKMHPPFELNEFVRPVCLPSRADIANTFVGVNATITGWGVQSFDSKVMYPELYFQKGVKVEKCSHPDNILCSNSDNGVSICFGDSGGPLNYEFQDGKYMQIGVNQFVSSGTCVGGWNGYARLT 241          

HSP 2 Score: 111.309 bits (277), Expect = 1.230e-24
Identity = 52/87 (59.77%), Postives = 64/87 (73.56%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDFALIKLEIP 402
            GG EAAR+QFPWLA V  GGYCTGSVLDENW+ITAKHCV   + +  + G+H+  +G  EP+MQ R S E + SP GDFAL+K+  P
Sbjct:   38 GGQEAARNQFPWLAAVLAGGYCTGSVLDENWVITAKHCVTVGHPAWAKAGVHNRFDGNIEPHMQDRRSDEIHVSPHGDFALMKMHPP 124          

HSP 3 Score: 101.679 bits (252), Expect = 4.153e-21
Identity = 46/80 (57.50%), Postives = 59/80 (73.75%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            CTGSVLDENW+ITAKHCV   + +  + G+H+  +G  EP+ Q R S E + SP GDFAL+K+  P ELNE+VRPVCLP+
Sbjct:   59 CTGSVLDENWVITAKHCVTVGHPAWAKAGVHNRFDGNIEPHMQDRRSDEIHVSPHGDFALMKMHPPFELNEFVRPVCLPS 138          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|225708700|gb|ACO10196.1| (Chymotrypsin-C precursor [Caligus rogercresseyi])

HSP 1 Score: 171.785 bits (434), Expect = 3.978e-47
Identity = 100/263 (38.02%), Postives = 149/263 (56.65%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPDICGLENKP-SVDSKIIGGHEAARHQFPW-----LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWG--INSFDKTNYSELYFAKNVKVVR-------WG----WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKC-DRGVNGFARCT 237
            +R L L  ++  V    +Y DICG+EN   S+  ++IGG EA+ +QFPW     + F+   G CTGS++++ WI+TA HCV +     + VG+H      DEP+ Q   + + +  P      + D AL+KL+  ++ N+YVRP C PT +D  K       T+ GWG      D  + + L +A+++KV+        +G      +I  +++ GRG+C GDSGGPLNYEME GKYMQIGV  FV++  C D+   G+AR T
Sbjct:    5 VRFLGLALLVSFV--QSEYEDICGIENPSGSLSGRVIGGQEASPNQFPWTVALTIHFMRGNGTCTGSIINKQWILTAGHCVGDSQKIEVYVGSHDY-ELEDEPHRQYFVTEESYLHPNYDYTEVDDIALVKLQEEIEFNDYVRPACFPTYSDVGKTFSDERVTVIGWGRIKGEPDPISVTALQYAEDIKVIDNKACKDVYGSIVTERLICIDSSEGRGVCSGDSGGPLNYEMEPGKYMQIGVADFVSTLSCIDKRPEGYARLT 264          

HSP 2 Score: 72.4034 bits (176), Expect = 8.808e-11
Identity = 37/92 (40.22%), Postives = 53/92 (57.61%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDF------ALIKLEIPLELNEYVRPVCLPT 315
            + G   CTGS++++ WI+TA HCV +    E+ VG H      DEP++Q   + E Y  P  D+      AL+KL+  +E N+YVRP C PT
Sbjct:   60 MRGNGTCTGSIINKQWILTAGHCVGDSQKIEVYVGSHDY-ELEDEPHRQYFVTEESYLHPNYDYTEVDDIALVKLQEEIEFNDYVRPACFPT 150          

HSP 3 Score: 65.0846 bits (157), Expect = 3.153e-8
Identity = 37/96 (38.54%), Postives = 53/96 (55.21%), Query Frame = 0
Query:  316 GGHEAARHQFPW-----LAFVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESPTGDF------ALIKLE 400
            GG EA+ +QFPW     + F+   G CTGS++++ WI+TA HCV +    E+ VG H      DEP+ Q   + E Y  P  D+      AL+KL+
Sbjct:   40 GGQEASPNQFPWTVALTIHFMRGNGTCTGSIINKQWILTAGHCVGDSQKIEVYVGSHDY-ELEDEPHRQYFVTEESYLHPNYDYTEVDDIALVKLQ 134          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|225717794|gb|ACO14743.1| (Collagenase precursor [Caligus clemensi])

HSP 1 Score: 155.221 bits (391), Expect = 7.010e-41
Identity = 97/259 (37.45%), Postives = 143/259 (55.21%), Query Frame = 0
Query:    6 LLTIIGSVL--ANPKYPDICGLENKPSVDSKIIGGHEAARHQFPW-----LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI--NSFDKTNYSELYFAKNVKVV-----------RWGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCT 237
            L+  I SVL   + +Y DICG+EN  S   KIIGG EAA +QFPW     + F+   G CTGS++++ +I+TA HCV++     I  G+H  +    E N QI  +S+    P        D A+I+L+  L+ NE+VRPICLP  +DA    +    T TGWG+           +L++   ++++               ++I  +++  +GIC GDSGGP+NY++ + KY+QIGV  FV  S CD G+  GFAR T
Sbjct:    7 LIFAIASVLYSVSAEYEDICGIEND-SPYGKIIGGQEAAPNQFPWVVAIQMKFLVGNGSCTGSIINKKYILTAAHCVEDSKKFTIFAGSHDYSLFT-ETNRQIMKASRGIPHPNFVNNGHDDIAIIELDEELEFNEFVRPICLPKYSDAVNTFVDEEITSTGWGLIKGQPSPVRVPQLHYVDGLRIIDNSICAQTYGPMVNENLICIDSSEHKGICNGDSGGPMNYKIGEKKYIQIGVADFVGGSTCDDGMPEGFARVT 263          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|155966191|gb|ABU41050.1| (serine proteinase [Lepeophtheirus salmonis])

HSP 1 Score: 138.658 bits (348), Expect = 3.428e-35
Identity = 81/212 (38.21%), Postives = 117/212 (55.19%), Query Frame = 0
Query:   49 LAFVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP---------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI--NSFDKTNYSELYFAKNVKVVR-------WG----WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCT 237
            ++ +   G CTGS++++ +I+TA HCV       I  G H  +   DEP+ QI  +++    P           D ALIKLE  L+ N+YVRPICLP  +D  K       T TGWG+   S +  +  +L++   ++V++       +G     D+I  +++  +G+C GDSGGP+NYE+EDGKYMQIGV  FV    CD G   GFAR T
Sbjct:    1 MSSIFGSGRCTGSIVNKQYILTASHCVAQFDRFTISAGTHDYSK--DEPHQQIMLATESIPHPNFTNNMFEYHDDIALIKLEKELEFNDYVRPICLPKYSDMGKTFADETVTSTGWGLIQGSPNPISVPQLHYVNGLRVIKNDVCAQTYGSLINEDLICIDSSDHKGVCNGDSGGPMNYEIEDGKYMQIGVADFVGGKTCDDGKPEGFARVT 210          

HSP 2 Score: 73.559 bits (179), Expect = 1.745e-11
Identity = 39/92 (42.39%), Postives = 51/92 (55.43%), Query Frame = 0
Query:  232 GFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPT---------GDFALIKLEIPLELNEYVRPVCLP 314
            G  RCTGS++++ +I+TA HCV   +   I  G H      DEP++Q   +TE    P           D ALIKLE  LE N+YVRP+CLP
Sbjct:    6 GSGRCTGSIVNKQYILTASHCVAQFDRFTISAGTHDYSK--DEPHQQIMLATESIPHPNFTNNMFEYHDDIALIKLEKELEFNDYVRPICLP 95          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|1067061119|ref|XP_018016632.1| (PREDICTED: transmembrane protease serine 9-like [Hyalella azteca])

HSP 1 Score: 141.739 bits (356), Expect = 1.932e-33
Identity = 123/438 (28.08%), Postives = 193/438 (44.06%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANPKYPD---ICGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVV-----------RWGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCTGSVLDENWIITAKHCVLN-------DNWSEIRVG-IHSTGNGADEPY---------KQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPV--CLP-------TGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEF 386
            +RAL   ++I + +   K+     + G    P+ D +I+GG EA  H +PW+   F+    +C GS++D+ WI+TA HC+ N     +  GAH I    +EP      S++ +            D AL+KL +PL     + P+CLP+ +DA   + G L   +GWG+ S D ++ S +     V V+               D+I  +   G G C GDSGGPLNY +  GK    G+  + +S+ C+ G  + F R T  +   +WI       ++         +  + V  I  T   A  P          +    S   +  P     +I   +P       R V  C P        GG EA  H +PW+   F+    +C GS++D+ WI+TA HC+      ++  G H+     +EP   T TST+F
Sbjct:   40 VRALPYKSVIDTYVPKEKFSGTRVVEGCGPVPTQD-RIVGGEEAVPHSYPWMVGLFINIATFCGGSIIDKEWILTAAHCLDNARTVDVVAGAHYIQQ--NEPTQVTITSTEFYVHEDWGSILIRNDIALLKLPTPLTWTPEIAPVCLPSYSDAEL-VAGDLVNPSGWGLPSDDSSSISPVLRQVTVPVLDNDVCAQSYPGSVTPDVICIDTTGGHGTCSGDSGGPLNY-VNGGKTTTRGITSYGSSTGCETGYPDAFTRVTHYL---SWIAEKTGIAIDPFLGLSFKMFKAVVVAVICCTAYAAGNPAAGVEWRWTPRHLTVSPNVHAVPYKQ--VIDSYVPRVYTPGTRQVEGCGPVPAQDRIVGGEEAVPHSYPWMVALFIDDIYFCGGSIIDDQWILTAAHCMDGARSVDVVAGAHNIRQ--NEPSQVTLTSTDF 465          

HSP 2 Score: 100.908 bits (250), Expect = 1.673e-19
Identity = 70/225 (31.11%), Postives = 110/225 (48.89%), Query Frame = 0
Query:   34 KIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKV-------VRWGW----DIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCT 237
            +I+GG EA  H +PW+   F+    +C GS++D+ WI+TA HC+       +  GAH+I    +EP+     S+               D A+I L   L  +  + P+CLP  A A +   G L   +GWG  S  +++ S++     V V         +G     D+I  ++  G+G C GDSGGPLNY ++ GK    G+  + +S+ C+ G  + F R T
Sbjct:  392 RIVGGEEAVPHSYPWMVALFIDDIYFCGGSIIDDQWILTAAHCMDGARSVDVVAGAHNIRQ--NEPSQVTLTSTDFTVHEDWGSILIRNDVAIIHLPEKLTWSAEIAPVCLPA-ASAPELQAGVLVNPSGWGRPSDAQSSISDVLRQVVVPVESNEVCGTYYGASVTPDVICIDSTGGKGTCNGDSGGPLNY-VDGGKTYTRGIVSYGSSTGCETGYPDAFTRVT 612          

HSP 3 Score: 65.0846 bits (157), Expect = 9.891e-8
Identity = 36/96 (37.50%), Postives = 49/96 (51.04%), Query Frame = 0
Query:  316 GGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKLEIP 402
            GG EA  H +PW+   F+    +C GS++D+ WI+TA HC+ N    ++  G H      +EP   T TSTEFY            D AL+KL  P
Sbjct:   78 GGEEAVPHSYPWMVGLFINIATFCGGSIIDKEWILTAAHCLDNARTVDVVAGAHYIQQ--NEPTQVTITSTEFYVHEDWGSILIRNDIALLKLPTP 171          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|1067064627|ref|XP_018016266.1| (PREDICTED: brachyurin-like [Hyalella azteca])

HSP 1 Score: 126.716 bits (317), Expect = 5.830e-30
Identity = 88/277 (31.77%), Postives = 135/277 (48.74%), Query Frame = 0
Query:   17 PKYPDICGLENKPSV---------------DSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHT----SPI---GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKV-------VRWGWD-----IIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCTGSVLDENWIITAKHCVLND 256
            P+ PD+ GL+++PS                 S+I+GG EA  H FPW    F+    +C GS++ + W++TA HC+       +  GAH+I     EP+     S+ +       P+    D A++KL SP+  NE++ P+CLPTR+DA  P  G   T +GWG    D  N S++       V       V +G +     ++ T+   G G C+GDSGGPLNY    G  +  GV  FV+   C  G+ +GF R    +   +WI T    ++++
Sbjct:   29 PRRPDV-GLDSQPSRLTEANSVAGCGPTKDASRIVGGTEAVPHSFPWQVALFIDDIYFCGGSLISDEWVLTAGHCLHEAQSVVVVAGAHNIREA--EPSQVTMTSTNLKVHEDYGPVFLRNDIAILKLPSPITFNEFIAPVCLPTRSDAILPA-GTSVTASGWGRIQDDAVNVSDVLNQSTNDVITDDECEVYYGANTINGGVVCTDTTGGHGTCYGDSGGPLNYRT-GGVTVTRGVTSFVSDGGCAGGLPDGFTRV---LYQLDWIETNTGIIIDN 297          
BLAST of EMLSAG00000000580 vs. nr
Match: gi|998513659|ref|XP_015517470.1| (PREDICTED: uncharacterized protein LOC107222566 [Neodiprion lecontei])

HSP 1 Score: 129.028 bits (323), Expect = 5.811e-29
Identity = 126/439 (28.70%), Postives = 192/439 (43.74%), Query Frame = 0
Query:   25 LENKPSVD-SKIIGGHEAARHQFPW-LAFVTTG-----GYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADE-----PNMQIRNSSQIHTSPI-GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTN-------------------ANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNG-FARCTGSVLDENWII--TAKHCVLNDNWSEIRVGIH----------------STGNGADEPYKQTRTSTEFYESPTGDFALIKLE--IPLELNEYVRPVCLPTGGHEAARHQFPW-LAFVTTG-----GYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYES-----PTGDFALIKL 399
            LE+   V+ ++I+GG EA   QFP+ +  ++T      G+C GS+L+ENW++TA HCV       + V AH+I N  +E     P  +I       T+ I  D A+++L  P++ ++ V+PI LP+R+   +   G    ++GWG +S    + S         V+RW  + I TN                      GR  C GDSGGPL    +DG   Q+G   F  +  C  G  G + R T  +   +WI+  T     + D      V +                 +     D  + Q  +  E +      F + KL+   PL+ +  V       GG  A R QFP+ +A ++T      G+C GS+L+ENWI+TA HCV      E+     +     D  + +T T    +ES        D ALIKL
Sbjct:   45 LEDAERVNPTRIVGGEEATPGQFPYQIGLLSTNAAGSTGFCGGSILNENWVLTAAHCVDVAVSVEVIVAAHNI-NEPEEGQYRVPAQKIVVHENWDTATIRNDLAVLRLAFPIEYSDRVQPIRLPSRSQVGQTFAGETGIVSGWGRDSDSSNSVS--------PVLRWTQNPITTNLACSIYYFFQINSAQICLSGEGGRSSCNGDSGGPLVIVEDDGIATQVGAVSFGIALGCSVGWPGVYVRLTDYL---DWIVEHTDNEIFIRDYVPFFDVLLRKSDCTMKVLVALCFVAAVAQAYDIDWSQV-SPIEVFPPDYEGFLIKKLKNVTPLDASRIV-------GGEVATRGQFPYQVAVLSTNAAGATGFCGGSILNENWILTAAHCVDVAVSVEVVFAAQNINEDEDGQFSRTSTDIIVHESWDAANIRNDLALIKL 463          

HSP 2 Score: 99.3673 bits (246), Expect = 6.508e-19
Identity = 77/237 (32.49%), Postives = 115/237 (48.52%), Query Frame = 0
Query:   25 LENKPSVD-SKIIGGHEAARHQFPW-LAFVTTG-----GYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTS-----PIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWG-INSFDKTNYSELYFAKNVKVV-----RWGWDIIYTN-----ANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNG-FARCT 237
            L+N   +D S+I+GG  A R QFP+ +A ++T      G+C GS+L+ENWI+TA HCV       +   A +I    D    +      +H S        D ALIKL   ++ ++ V+P  LP+R+  ++   G   T++GWG  +    +  S L +  N  +       W W ++ T+      + GR  C GDSGGPL     DG+  Q+GV  F  S  C  G  G + R T
Sbjct:  356 LKNVTPLDASRIVGGEVATRGQFPYQVAVLSTNAAGATGFCGGSILNENWILTAAHCVDVAVSVEVVFAAQNINEDEDGQFSRTSTDIIVHESWDAANIRNDLALIKLAEAIEYSDLVQPTRLPSRSQVSETFAGLTGTVSGWGRDSDSSNSVSSVLRWTSNPILTYSACRSWYWSLVNTDQICLSGSEGRSSCNGDSGGPLVVTDTDGEITQVGVVSFGISLGCAVGWPGVYVRLT 592          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold41_size498431-snap-gene-0.15 (protein:Tk00188 transcript:maker-scaffold41_size498431-snap-gene-0.15-mRNA-1 annotation:"collagenase precursor")

HSP 1 Score: 129.028 bits (323), Expect = 5.144e-34
Identity = 87/267 (32.58%), Postives = 130/267 (48.69%), Query Frame = 0
Query:    6 LLTIIGSVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTT--GGYCTGSVLDENWIITARHCVK--NDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFD--KTNYSELYFAKNVKVVR-----------WGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFARCTGSVLDENWII 247
            L T   S +  PK    CG+EN  +  +K++GG E++ +QFPWL+ +      +CT S++ +NWI+TA HCV   N+ W  + VG H + N           +S     P         D AL++L   +K +  VR  CL   +D     + A TT+TGWG +S    +     ++FA   KV+             G   I  + +   G+C GDSGGPLN +   G+Y QIGV  FV+ + C  G  +GF R T  +   +WI+
Sbjct:   96 LPTTPASAIPAPKQGAECGIENTKNSQTKVVGGQESSPNQFPWLSALNCRLTFFCTSSIIGDNWILTAAHCVDGCNNGW-DVTVGVHDLDNPESTAQTITVPASNGIVHPGWDSVALSNDIALVELPEAVKFSNVVRTSCLVDSSDVGDDFVNADTTVTGWGKHSDSPFEGRSDRVFFATGRKVITNTECAATYGDLIGDGHICIDTSDSIGVCSGDSGGPLNLKTSSGQYKQIGVTSFVSGAGCLSGYPHGFTRTTAYL---DWIM 358          

HSP 2 Score: 52.7582 bits (125), Expect = 8.706e-8
Identity = 25/60 (41.67%), Postives = 39/60 (65.00%), Query Frame = 0
Query:  316 GGHEAARHQFPWLAFVTT--GGYCTGSVLDENWIITAKHCV--LNDNWSEIRVGIHSTGN 371
            GG E++ +QFPWL+ +      +CT S++ +NWI+TA HCV   N+ W ++ VG+H   N
Sbjct:  127 GGQESSPNQFPWLSALNCRLTFFCTSSIIGDNWILTAAHCVDGCNNGW-DVTVGVHDLDN 185          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold28_size608977-snap-gene-3.11 (protein:Tk05750 transcript:maker-scaffold28_size608977-snap-gene-3.11-mRNA-1 annotation:"chymotrypsin-like proteinase")

HSP 1 Score: 103.219 bits (256), Expect = 2.717e-25
Identity = 83/276 (30.07%), Postives = 133/276 (48.19%), Query Frame = 0
Query:    1 MRALVLLTIIGSVLANP-KYPDI-------------------CGLENKPSVDSKIIGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQ--IHTSPIG------DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSE-LYFAKNVKVVRWG----------WDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGV-NGFA 234
            M+ L +L +I    A+P KYP I                    G   + ++++KI+GG EA  + +P++   F+    +C GS+L+E W++TA HC+   A   +  GAH++    DEP+ Q + S++  +H   +       D  +I+L   LK N++V  I    RA  + P +G L +  GWG  S   +  S+ L F   + ++  G            II  +AN G G C GDSGGPL     +GK   +G+  F +S  C+ G  +GF+
Sbjct:    7 MKVLAILGLIALASASPAKYPVIRDLTKYQDRGVLYPHIFEKAGKHPRVNLENKIVGGSEAVPNSYPFIVALFIDDSFFCGGSILNEEWVLTASHCMDGAASVEVVAGAHNVRE--DEPSQQRQFSTEFTVHEDWVANLVDGTDITVIRLPKALKFNQFVSSI---DRAPKD-PAVGDLVSAIGWGRPSDSASGISDVLRFVTGLDIISNGDCSSVYGTMSPRIICISANGGAGTCNGDSGGPL----VNGKGQLVGLTSFGSSLGCELGFPDGFS 272          

HSP 2 Score: 54.6842 bits (130), Expect = 1.323e-8
Identity = 27/74 (36.49%), Postives = 41/74 (55.41%), Query Frame = 0
Query:  315 TGGHEAARHQFPWLA--FVTTGGYCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEF 386
             GG EA  + +P++   F+    +C GS+L+E W++TA HC+      E+  G H+     DEP  Q + STEF
Sbjct:   62 VGGSEAVPNSYPFIVALFIDDSFFCGGSILNEEWVLTASHCMDGAASVEVVAGAHNVRE--DEPSQQRQFSTEF 133          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold470_size172058-snap-gene-0.30 (protein:Tk09897 transcript:maker-scaffold470_size172058-snap-gene-0.30-mRNA-1 annotation:"transmembrane protease serine 9-like")

HSP 1 Score: 101.293 bits (251), Expect = 2.831e-23
Identity = 113/414 (27.29%), Postives = 168/414 (40.58%), Query Frame = 0
Query:   34 KIIGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITARHCVK----NDAWAGIRV--GAHSIANGADEPNMQIRNSSQIHTSPI--------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGI----NSFDKTNYSELYFAKNVKVVR--------WGWDII--YTNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPTGGHEAARHQFPWLAFVT-TGGY--CTGSVLDENWIITAKHCVLNDNWSE-IRV--GIHSTGNGADEPYMQTR---------TSTEFYESPTGDFALIKLEIP 402
            KII G +A  H FPWL  +   G  +C GS++++N +ITA HC+      D ++ + V  G H ++   +      R    I   P         GD AL++L+ P++ N  ++PICLP + +A       L    GWG+    +S D     EL   +N   V            D+I  +        IC GDSGGPL   + DGK+   G+  F  +         FAR +       +    +     D     R            PY+           PT  F   +  + L++ +          G ++  H FPW A ++  GG+  C GS++  + IITA HCV    ++E IRV  G H      +  +  TR         + T F     GD ALI LE P
Sbjct:  315 KIIDGTDAPIHAFPWLVSLNYNGEHFCGGSLINQNTVITAAHCMDFGAVPDFFSKLLVYFGEHDLSLANETEFTTTRRVLNIIIHPRYSATPGSPGDVALLQLDRPVEYNRAIKPICLP-KLEAGGSFEQMLAVAAGWGVTEDQSSSDILRQVELNIIRNSTCVENMNAINVPILEDMICTFKGPLGSETICSGDSGGPLMVRI-DGKFTLAGLASFSVTDCSAPFPAVFARIS-------YFKRRRRPRSIDKQFPYR----------SRPYQ-----------PTSAFLAKESNVLLKIVD----------GTQSRLHAFPWAASLSFVGGFHGCGGSLIRNDMIITAAHCVETPGFAEFIRVTLGEHDLSRPDETSFTVTRRVKRVILHPSYTAFLIGLPGDIALIILEDP 688          

HSP 2 Score: 78.5666 bits (192), Expect = 8.182e-16
Identity = 72/255 (28.24%), Postives = 116/255 (45.49%), Query Frame = 0
Query:   15 ANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVT-TGGY--CTGSVLDENWIITARHCVKNDAWAG-IRV--GAHSIANGADEPNMQIRNSSQIHTSPI---------GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRW-----GWDII-----------YTNANSGRG-ICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRGVNGFARCT 237
            + P  P    L  + +V  KI+ G ++  H FPW A ++  GG+  C GS++  + IITA HCV+   +A  IRV  G H ++   +      R   ++   P          GD ALI LE P+  N+ ++P+CLPT +         +    GWG+   ++TN  ++    ++ ++        W ++             N   G G  C GDSGGPL   +E  K + +GV  F T +  D   + ++R T
Sbjct:  565 SRPYQPTSAFLAKESNVLLKIVDGTQSRLHAFPWAASLSFVGGFHGCGGSLIRNDMIITAAHCVETPGFAEFIRVTLGEHDLSRPDETSFTVTRRVKRVILHPSYTAFLIGLPGDIALIILEDPVPFNQGIKPVCLPTNSPVGT-FDNRMGIAAGWGLTE-NETN-PDVIRQVDLNIISLEQCTTEWRLLDGLELTPAMICTFNGPLGTGSTCRGDSGGPLMV-LEGTKQVLVGVTSFGTQNCSDPVSSVYSRVT 815          

HSP 3 Score: 57.3806 bits (137), Expect = 4.150e-9
Identity = 38/98 (38.78%), Postives = 50/98 (51.02%), Query Frame = 0
Query:  230 VNGFARCTGSVLDENWIITAKHCVLNDNWSE-IRV--GIHSTGNGADEPYKQTR---------TSTEFYESPTGDFALIKLEIPLELNEYVRPVCLPT 315
            V GF  C GS++  + IITA HCV    ++E IRV  G H      +  +  TR         + T F     GD ALI LE P+  N+ ++PVCLPT
Sbjct:  605 VGGFHGCGGSLIRNDMIITAAHCVETPGFAEFIRVTLGEHDLSRPDETSFTVTRRVKRVILHPSYTAFLIGLPGDIALIILEDPVPFNQGIKPVCLPT 702          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold199_size265817-snap-gene-1.56 (protein:Tk08952 transcript:maker-scaffold199_size265817-snap-gene-1.56-mRNA-1 annotation:"chymotrypsin-like protein")

HSP 1 Score: 91.6633 bits (226), Expect = 2.427e-20
Identity = 73/246 (29.67%), Postives = 114/246 (46.34%), Query Frame = 0
Query:   33 SKIIGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHTSP-------IGDFALIKLESPLKLNEYVRPICLPTR-ADANKPLIGALTTITGWGI-------NSFDKT-NYSELYFAKNVKVVR-WGWDIIYTN---ANSG--RGICFGDSGGPLNYEMEDGKYMQIGVNQFVTSSKCDRG-VNGFARCTGSVLDENWIITAKHCV 253
            ++I+GG EA +H+FPWL  ++     +C G+++ + WI+TA HC      + + +GAH+I     E    I  S + +  P         D ALIKL   +  +E + PICLP R  +A+  ++G      GWG+           +T N  +L+   N +  R +G  +  TN    N G     C GDSGG L        ++Q G+  F     C +   NG++R +   LD    +T  H V
Sbjct:  264 TRIVGGTEAQKHEFPWLVGISFNKKWFCGGTLISDQWILTAAHCTVRADSSYVYLGAHNIYE--KEEGRVIMFSEEFYEHPDYRDNVLANDVALIKLPRKVTYSEKIMPICLPLRNEEADDSVLGQFMITAGWGLVEAEGKDRKISRTLNKLKLHVISNKQCRRTYGSKVRPTNICAQNMGDRSSTCQGDSGGALQNSFRGAPWIQHGIVSFGPDLGCGKNHPNGYSRVS-HFLDFIGNVTGNHYV 506          

HSP 2 Score: 57.3806 bits (137), Expect = 3.170e-9
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 0
Query:  315 TGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYMQTRTSTEFYESP-------TGDFALIKL 399
             GG EA +H+FPWL  ++     +C G+++ + WI+TA HC +  + S + +G H+     +   +    S EFYE P         D ALIKL
Sbjct:  267 VGGTEAQKHEFPWLVGISFNKKWFCGGTLISDQWILTAAHCTVRADSSYVYLGAHNIYEKEEGRVIM--FSEEFYEHPDYRDNVLANDVALIKL 358          

HSP 3 Score: 54.6842 bits (130), Expect = 2.776e-8
Identity = 31/92 (33.70%), Postives = 46/92 (50.00%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIHSTGNGADEPYKQTRTSTEFYESP-------TGDFALIKLEIPLELNEYVRPVCLPTGGHEA 320
            C G+++ + WI+TA HC +  + S + +G H+      E  +    S EFYE P         D ALIKL   +  +E + P+CLP    EA
Sbjct:  291 CGGTLISDQWILTAAHCTVRADSSYVYLGAHNIYE--KEEGRVIMFSEEFYEHPDYRDNVLANDVALIKLPRKVTYSEKIMPICLPLRNEEA 380          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold963_size76285-snap-gene-0.15 (protein:Tk09000 transcript:maker-scaffold963_size76285-snap-gene-0.15-mRNA-1 annotation:"af461035_1collagenolytic serine protease")

HSP 1 Score: 83.9593 bits (206), Expect = 3.903e-18
Identity = 72/254 (28.35%), Postives = 114/254 (44.88%), Query Frame = 0
Query:    4 LVLLTIIGSVLANPK------------YPDICGL---ENKPSVDSKIIGGHEAARHQFPWLAFVTTGG--YCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGADEPNMQIRNSSQIHT--------SPIGDFALIKLESPLKLN-EYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIY-----------TNANSGRGICFGDSGGPLNYEMEDGKYMQIGVNQF 220
            LV L ++GS +A PK            YP        EN P    +I+GG EA  H +P++  ++     +C G++L + WI+TA HC+    +  +  GAH   N A   N Q++ +S   T        + I D A+I+L   L L+ ++++ + + T      P  G L T  GWGI S D  + S++    +V V+ +   + Y            +    +G C GDSGGP  Y        Q+G+  F
Sbjct:   74 LVSLALVGSSMAFPKVNRAGLQDRSVLYPHKIQKYIKENGPFPHQRIVGGQEAEPHSWPFIVALSIDDSFFCGGTILSDQWILTAAHCLDGAGYVEVTAGAH---NQATLENSQVKLTSTTFTVNPDYDSINIIEDTAVIQLPEKLDLSGDFIKAVKMATA----DPADGELVTSVGWGITS-DFGSVSDVLNQVDVPVLNYDECLDYWQGVLDPKQLCIDTKGSKGTCGGDSGGPTMY-----NGAQVGITSF 314          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold269_size230758-snap-gene-1.39 (protein:Tk08011 transcript:maker-scaffold269_size230758-snap-gene-1.39-mRNA-1 annotation:"proclotting enzyme")

HSP 1 Score: 82.4185 bits (202), Expect = 6.557e-18
Identity = 62/213 (29.11%), Postives = 95/213 (44.60%), Query Frame = 0
Query:   34 KIIGGHEAARHQFPWLAFVTTGG------YCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGAD--EPNMQIRNSSQIH-----TSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTN------------ANSGR-GICFGDSGGPLNYEMEDGKYMQIGVNQF 220
            +I+GG EA    +PW A +           C GS++D   +++A HC  N A   IR+G H + + +D  +P   +  S +IH      S   D A++ L  P+     + PICLP     +  L      I GWG NS      + L  A    V +   D+ Y +            A +GR   C GDSGGP+  +++D K+  +G+  F
Sbjct:   51 RIVGGTEARPGSWPWAAVLGRPSDSDFQVVCGGSLIDSTHVLSAAHCFPNSAITHIRLGEHDVKSTSDGAQPQDVLIQSVKIHEEWDSQSLKNDIAILTLSEPVSFTSTILPICLPQGLAGSDLLSLPQPFIIGWGSNSTGTGTVNALRQAPIDLVSQAECDLAYGDIARVTIGNDQVCAGNGRIDTCTGDSGGPIQSQIDD-KWTILGITSF 262          

HSP 2 Score: 49.6766 bits (117), Expect = 5.108e-7
Identity = 29/89 (32.58%), Postives = 45/89 (50.56%), Query Frame = 0
Query:  236 CTGSVLDENWIITAKHCVLNDNWSEIRVGIH---STGNGADEPYKQTRTSTEFYE-----SPTGDFALIKLEIPLELNEYVRPVCLPTG 316
            C GS++D   +++A HC  N   + IR+G H   ST +GA +P      S + +E     S   D A++ L  P+     + P+CLP G
Sbjct:   81 CGGSLIDSTHVLSAAHCFPNSAITHIRLGEHDVKSTSDGA-QPQDVLIQSVKIHEEWDSQSLKNDIAILTLSEPVSFTSTILPICLPQG 168          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold980_size74003-snap-gene-0.17 (protein:Tk08283 transcript:maker-scaffold980_size74003-snap-gene-0.17-mRNA-1 annotation:"proclotting enzyme")

HSP 1 Score: 81.6481 bits (200), Expect = 3.183e-17
Identity = 64/235 (27.23%), Postives = 101/235 (42.98%), Query Frame = 0
Query:   12 SVLANPKYPDICGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGG------YCTGSVLDENWIITARHCVKNDAWAGIRVGAHSIANGAD--EPNMQIRNSSQIH-----TSPIGDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYTN------------ANSGR-GICFGDSGGPLNYEMEDGKYMQIGVNQF 220
            S  + P     CG         +I+GG EA++  +PW A +           C GS++D   +++A HC  N A   +R+G H + + +D  +P      S++IH      S   D A++ L  P+     + PICLP     +  L      I GWG NS +    + L  A    V +   D  Y +            A +GR   C GDSGGP+  ++ + K+  +G+  F
Sbjct:  148 STTSRPDRFQSCGFS---PFSVRIVGGREASQGSWPWAAVLGQPSGSNFQVVCGGSLIDSTHVLSAAHCFPNSAITHVRLGEHDVRSTSDGAQPQDIFIQSTKIHEQWDSQSLKNDIAILTLSRPVSFTSTILPICLPQGLTGSNLLSLPQPFIIGWGSNSTNTRTVNALRQAPIDLVSQAECDQAYGDISRVTIGNDQVCAGNGRIDTCTGDSGGPIQSQINN-KWTILGITSF 378          

HSP 2 Score: 50.447 bits (119), Expect = 4.442e-7
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 0
Query:  229 GVNGFARCTGSVLDENWIITAKHCVLNDNWSEIRVGIH---STGNGADEPYKQTRTSTEFYE-----SPTGDFALIKLEIPLELNEYVRPVCLPTG 316
            G N    C GS++D   +++A HC  N   + +R+G H   ST +GA +P      ST+ +E     S   D A++ L  P+     + P+CLP G
Sbjct:  190 GSNFQVVCGGSLIDSTHVLSAAHCFPNSAITHVRLGEHDVRSTSDGA-QPQDIFIQSTKIHEQWDSQSLKNDIAILTLSRPVSFTSTILPICLPQG 284          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold424_size175595-processed-gene-0.2 (protein:Tk01541 transcript:snap_masked-scaffold424_size175595-processed-gene-0.2-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_305317")

HSP 1 Score: 80.8777 bits (198), Expect = 9.795e-17
Identity = 65/246 (26.42%), Postives = 108/246 (43.90%), Query Frame = 0
Query:   23 CGLENKPSVDSKIIGGHEAARHQFPWLAFVTTGG-----YCTGSVLDENWIITARHCVK---NDAWAGIRVGAHSIANGA---------DEPN-------------------MQIRNSSQIHTSPIGDFALIKLESPLKLNEYVRPICLPTRA--DANKPLIGALTTITGWG-INSFDKTNYSELYFAKNVKVV------------RWGWDIIYTNANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            CG+    + + +I+GG +A   QFPW A +   G      C G+++++ WI+TA HC +   N    GI +  H I             +EP                    M++R +  + + P  D AL+ L+  +KL   V PICLPT    D +    G  +T+ GWG +    K  +S +  A  + ++             +   I   N++S    C GDSGG L  + ++G++M +G+
Sbjct:  349 CGVSR--NANRRIMGGLDAGYGQFPWTAHIKIRGPSIDKECGGTLINQRWILTAGHCTQYCINVPLCGIEIPQHEITYKVILGEYDQLENEPVLPDAYMAIDVIRHPLYRNVMRLRENGYLESEPRYDLALLLLDREVKLAPNVAPICLPTPEFLDLDP---GTPSTVVGWGRVGRDSKAPHSNILQAATIPILSDSQCLSETGLSNFDDQICAGNSDSDISACPGDSGGALQVQDDEGRWMIVGI 589          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold756_size101639-snap-gene-0.17 (protein:Tk07951 transcript:maker-scaffold756_size101639-snap-gene-0.17-mRNA-1 annotation:"serine proteinase stubble")

HSP 1 Score: 78.9518 bits (193), Expect = 1.930e-16
Identity = 61/208 (29.33%), Postives = 99/208 (47.60%), Query Frame = 0
Query:   23 CGLENKPSVDSKIIGGHEAARHQFPWLAFVTTG-GYCTGSVLDENWIITARHCVKNDAWAGIRV--GAHSIANGADE-PNMQ-----IRNSSQIHTSPIG---DFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELYFAKNVKVVRWGWDIIYT-NANSGRGICFGDSGGPLNYEMEDGKYMQIGV 217
            CGL        +++GG  A   Q+PW A V  G   C G+++++  ++TA HCV       IRV  G +++ N  +  P+ Q     I      H +P     D A+++L+ P++   ++ P+CLP +          +  + GWG  + +         A +VKVV    D++   +   G+  C GDSGGPL   M DGK+  IG+
Sbjct:  129 CGLPR--IARRRVVGGSSAGFGQYPWQALVRIGNSRCGGALINKLNVVTAGHCVHEAKARTIRVYLGEYTLYNNLEPLPSQQFGVVDIFAHPHYHFTPQADRYDVAILRLDRPVRYQPHISPVCLPLKNQDIPEHTSGM--VAGWGAMNANAVERPVSLQAVDVKVVTIFEDMMCAGHEMGGKDACQGDSGGPLMTRM-DGKWYLIGI 331          
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold927_size80360-snap-gene-0.28 (protein:Tk12216 transcript:maker-scaffold927_size80360-snap-gene-0.28-mRNA-1 annotation:"serine proteinase")

HSP 1 Score: 78.1814 bits (191), Expect = 5.680e-16
Identity = 64/224 (28.57%), Postives = 100/224 (44.64%), Query Frame = 0
Query:   23 CGLENKPSVDSKIIGGHEAARHQFPWLAFV--------TTGGYCTGSVLDENWIITARHCVK--NDAWAGIRVGAHSIANGADE--PNMQIR--NSSQIHTSPI--GDFALIKLESPLKLNEYVRPICLPTRADANKPLIGALTTITGWGINSFDKTNYSELY------------FAKNVKVVRWGWDIIYTNANSGRGICFGDSGGPLN-YEMEDGKYMQIGV 217
            CGL N     +KI+GG +A + ++PWL  +        +TG +C G+++ +  ++TA HCV         IRVG +      +    + Q+   NS   ++S     D A+IKL+ P+  N  V PICLPT     +        + GWG   F     ++L              A   K+ R   + +    + G+  C GDSGGPLN     +G++   GV
Sbjct:  187 CGL-NAKRFQTKIVGGRDADKDEWPWLVAMIRPTTSADSTGQFCGGALISDQHVVTAAHCVVPFTKDQITIRVGEYDFKEKEESLSSDFQVESINSHADYSSRTFENDIAIIKLDKPITRNRSVYPICLPT---PERDYTNTRANVVGWGTIYFGGPTATKLQEISIRVWDNQQCAANYGKLNRDVTNSMMCAGDDGKDACQGDSGGPLNCLNSNNGRWELCGV 406          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000000580 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-4.473e-2232.64symbol:LOC618826 "Uncharacterized protein" species... [more]
-1.633e-2132.58symbol:OVCH2 "Uncharacterized protein" species:903... [more]
-2.774e-2024.87symbol:TMPRSS9 "Uncharacterized protein" species:9... [more]
-3.002e-2029.02symbol:ctrb1 "chymotrypsinogen B1" species:7955 "D... [more]
-3.054e-2029.05symbol:CTRB2 "Uncharacterized protein" species:961... [more]
-1.126e-1931.10symbol:CTRB2 "Chymotrypsinogen B2" species:9606 "H... [more]
-1.357e-1929.69symbol:CTRB1 "Chymotrypsinogen B" species:9606 "Ho... [more]
-1.565e-1930.00symbol:LOC100621820 "Uncharacterized protein" spec... [more]
-2.959e-1929.80symbol:zgc:112160 "zgc:112160" species:7955 "Danio... [more]
-4.942e-1932.06symbol:Ctrb1 "chymotrypsinogen B1" species:10090 "... [more]

Pages

back to top
BLAST of EMLSAG00000000580 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592778605|gb|GAXK01175963.1|1.915e-3535.56TSA: Calanus finmarchicus comp2611_c0_seq4 transcr... [more]
gi|592778602|gb|GAXK01175966.1|7.986e-3535.56TSA: Calanus finmarchicus comp2611_c1_seq3 transcr... [more]
gi|592778608|gb|GAXK01175960.1|8.869e-3535.56TSA: Calanus finmarchicus comp2611_c0_seq1 transcr... [more]
gi|592778606|gb|GAXK01175962.1|1.582e-3434.73TSA: Calanus finmarchicus comp2611_c0_seq3 transcr... [more]
gi|592778604|gb|GAXK01175964.1|2.180e-3435.56TSA: Calanus finmarchicus comp2611_c1_seq1 transcr... [more]
gi|592778607|gb|GAXK01175961.1|2.922e-3434.73TSA: Calanus finmarchicus comp2611_c0_seq2 transcr... [more]
gi|592778603|gb|GAXK01175965.1|3.410e-3434.73TSA: Calanus finmarchicus comp2611_c1_seq2 transcr... [more]
gi|592778599|gb|GAXK01175969.1|3.611e-3235.04TSA: Calanus finmarchicus comp2611_c1_seq6 transcr... [more]
gi|592778601|gb|GAXK01175967.1|1.061e-3135.04TSA: Calanus finmarchicus comp2611_c1_seq4 transcr... [more]
gi|592778600|gb|GAXK01175968.1|1.871e-3134.19TSA: Calanus finmarchicus comp2611_c1_seq5 transcr... [more]

Pages

back to top
BLAST of EMLSAG00000000580 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000005800.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s1098:1318... [more]
EMLSAP000000022112.231e-12170.66pep:novel supercontig:LSalAtl2s:LSalAtl2s1418:3241... [more]
EMLSAP000000040583.647e-11770.17pep:novel supercontig:LSalAtl2s:LSalAtl2s216:14704... [more]
EMLSAP000000046928.345e-11073.24pep:novel supercontig:LSalAtl2s:LSalAtl2s2467:3902... [more]
EMLSAP000000037622.808e-10570.09pep:novel supercontig:LSalAtl2s:LSalAtl2s202:26608... [more]
EMLSAP000000105658.883e-8564.50pep:novel supercontig:LSalAtl2s:LSalAtl2s701:20503... [more]
EMLSAP000000030308.202e-8372.12pep:novel supercontig:LSalAtl2s:LSalAtl2s171:72691... [more]
EMLSAP000000024411.257e-8262.31pep:novel supercontig:LSalAtl2s:LSalAtl2s1469:3343... [more]
EMLSAP000000082657.439e-7275.35pep:novel supercontig:LSalAtl2s:LSalAtl2s49:962253... [more]
EMLSAP000000058824.263e-5139.46pep:novel supercontig:LSalAtl2s:LSalAtl2s3194:2307... [more]

Pages

back to top
BLAST of EMLSAG00000000580 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|290457638|sp|Q6GPI1.2|CTRB2_HUMAN8.114e-2031.10RecName: Full=Chymotrypsinogen B2; Contains: RecNa... [more]
gi|1098883660|sp|P17538.2|CTRB1_HUMAN8.951e-2031.10RecName: Full=Chymotrypsinogen B; Contains: RecNam... [more]
gi|119771|sp|P16295.1|FA9_CAVPO1.723e-1933.01RecName: Full=Coagulation factor IX; AltName: Full... [more]
gi|129688|sp|P21902.1|PCE_TACTR1.887e-1928.22RecName: Full=Proclotting enzyme; Contains: RecNam... [more]
gi|81916772|sp|Q9CR35.1|CTRB1_MOUSE3.568e-1932.06RecName: Full=Chymotrypsinogen B; Contains: RecNam... [more]
gi|119257|sp|P05208.1|CEL2A_MOUSE4.924e-1929.53RecName: Full=Chymotrypsin-like elastase family me... [more]
gi|1706190|sp|P80646.1|CTRB_GADMO5.490e-1930.56RecName: Full=Chymotrypsin B; Contains: RecName: F... [more]
gi|461857|sp|Q00871.1|CTRB1_LITVA1.054e-1829.77RecName: Full=Chymotrypsin BI; Flags: Precursor[more]
gi|117612|sp|P04813.1|CTR2_CANFA1.721e-1829.57RecName: Full=Chymotrypsinogen 2; Contains: RecNam... [more]
gi|119775|sp|P16292.1|FA9_RABIT2.647e-1830.88RecName: Full=Coagulation factor IX; AltName: Full... [more]

Pages

back to top
BLAST of EMLSAG00000000580 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EFX82218.11.578e-3031.49hypothetical protein DAPPUDRAFT_33543, partial [Da... [more]
EFX82212.12.208e-2930.17hypothetical protein DAPPUDRAFT_49241 [Daphnia pul... [more]
EFX82341.11.182e-2831.06hypothetical protein DAPPUDRAFT_316896 [Daphnia pu... [more]
gb|EFA10697.1|3.061e-2832.06serine protease P127 [Tribolium castaneum][more]
EFX79604.12.199e-2732.35chymotrypsin-like protein [Daphnia pulex][more]
EFX89389.16.524e-2732.78hypothetical protein DAPPUDRAFT_230174 [Daphnia pu... [more]
gb|EFA10698.1|3.125e-2631.47serine protease P128 [Tribolium castaneum][more]
EFX82344.17.761e-2631.39hypothetical protein DAPPUDRAFT_49170 [Daphnia pul... [more]
EFX79602.19.933e-2631.30chymotrypsin-like protein [Daphnia pulex][more]
EFX82345.14.560e-2431.51putative chymotrypsin precursor-1 protein [Daphnia... [more]

Pages

back to top
BLAST of EMLSAG00000000580 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|155966294|gb|ABU41100.1|9.862e-12573.64serine proteinase [Lepeophtheirus salmonis][more]
gi|290563022|gb|ADD38905.1|1.076e-12473.64Collagenase [Lepeophtheirus salmonis][more]
gi|290562501|gb|ADD38646.1|5.647e-12072.27Chymotrypsin-like elastase family member 2A [Lepeo... [more]
gi|225718906|gb|ACO15299.1|4.751e-9560.67Collagenase precursor [Caligus clemensi][more]
gi|225708700|gb|ACO10196.1|3.978e-4738.02Chymotrypsin-C precursor [Caligus rogercresseyi][more]
gi|225717794|gb|ACO14743.1|7.010e-4137.45Collagenase precursor [Caligus clemensi][more]
gi|155966191|gb|ABU41050.1|3.428e-3538.21serine proteinase [Lepeophtheirus salmonis][more]
gi|1067061119|ref|XP_018016632.1|1.932e-3328.08PREDICTED: transmembrane protease serine 9-like [H... [more]
gi|1067064627|ref|XP_018016266.1|5.830e-3031.77PREDICTED: brachyurin-like [Hyalella azteca][more]
gi|998513659|ref|XP_015517470.1|5.811e-2928.70PREDICTED: uncharacterized protein LOC107222566 [N... [more]

Pages

back to top
BLAST of EMLSAG00000000580 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
maker-scaffold41_size498431-snap-gene-0.155.144e-3432.58protein:Tk00188 transcript:maker-scaffold41_size49... [more]
maker-scaffold28_size608977-snap-gene-3.112.717e-2530.07protein:Tk05750 transcript:maker-scaffold28_size60... [more]
maker-scaffold470_size172058-snap-gene-0.302.831e-2327.29protein:Tk09897 transcript:maker-scaffold470_size1... [more]
maker-scaffold199_size265817-snap-gene-1.562.427e-2029.67protein:Tk08952 transcript:maker-scaffold199_size2... [more]
maker-scaffold963_size76285-snap-gene-0.153.903e-1828.35protein:Tk09000 transcript:maker-scaffold963_size7... [more]
maker-scaffold269_size230758-snap-gene-1.396.557e-1829.11protein:Tk08011 transcript:maker-scaffold269_size2... [more]
maker-scaffold980_size74003-snap-gene-0.173.183e-1727.23protein:Tk08283 transcript:maker-scaffold980_size7... [more]
snap_masked-scaffold424_size175595-processed-gene-0.29.795e-1726.42protein:Tk01541 transcript:snap_masked-scaffold424... [more]
maker-scaffold756_size101639-snap-gene-0.171.930e-1629.33protein:Tk07951 transcript:maker-scaffold756_size1... [more]
maker-scaffold927_size80360-snap-gene-0.285.680e-1628.57protein:Tk12216 transcript:maker-scaffold927_size8... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1098supercontigLSalAtl2s1098:131845..138345 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionaugustus_masked-LSalAtl2s1098-processed-gene-0.1
Biotypeprotein_coding
EvidenceManual
NotePutative serine proteinase, peptidase S1A, chymotrypsin-type
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000000580 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000000580EMLSAT00000000580-696427Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s1098:131845..138345+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000000580-683346 ID=EMLSAG00000000580-683346|Name=EMLSAG00000000580|organism=Lepeophtheirus salmonis|type=gene|length=6501bp|location=Sequence derived from alignment at LSalAtl2s1098:131845..138345+ (Lepeophtheirus salmonis)
ATGAGAGCATTAGTGTTACTGACAATCATTGGATCTGTTTTGGCTAATCC CAAATATCCAGATATTTGTGGTTTGGAAAACAAGCCTTCTGTGGATTCAA AAATCATTGGAGGACATGAAGCAGCAAGACATCAGTTTCCATGGCTAGCT TTTGTCACTACCGGTGGTTATTGTACTGGTTCTGTTTTGGATGAAAATTG GATTATAACTGCTAGACATTGTGTAAAAAATGATGCTTGGGCTGGAATTC GGGTTGGAGCTCATAGCATTGCAAATGGTGCGGATGAACCAAATATGCAA ATACGAAATAGTTCCCAAATTCATACATCACCAATTGGAGACTTTGCTTT GATCAAATTGGAGAGTCCTTTGAAATTAAATGAATATGTCCGCCCCATTT GCTTACCAACACGTGCAGATGCTAATAAACCTCTTATTGGCGCATTAACG ACTATAACAGGATGGGGTATTAACAGTTTTGATAAGACCAATTACTCCGA ATTATACTTTGCTAAAAATGTAAAAGTCGTTAGGTGGGGCTGGGATATAA TCTATACCAATGCAAATTCAGGAAGAGGTATTTGTTTTGGTGACAGTGGT GGCCCTCTTAACTACGAAATGGAAGATGGAAAATATATGCAAATTGGAGT CAATCAATTTGTGACGAGTAGCAAATGTGATAGAGGTGTGAATGGATTTG CACGTGTAAGTGCACAACTAGATTTCATTCAAGAAATAACTGGAATATTT ATCAAATAATAGTTTAAAGATATCTCCAAAAATAGACCACAAAATAATTT TGTACATAACTCCATATTTATATACTATTATACAAATATTCTATAGTTGT CAATTTGGTGATGTTTGTGTTAGAAATTTTTATACATACAAGGAGAAGGA GTGGTTTAGATTTTAAGGGAGTACTCTTTGAAAAATAATTATAAGGACAT ACCTCCCTCACCCTTTTATTTCATACTTACGGTATTGCTTATGGAGGTTT TTCAGCTTTGGTACTTAAAAGTACTTAATAATTAAAGGTAGCCCATTCAA GATGTGCAAGCTATCTATGTCCCATTTTGGTACACTCCCTTAAGCAAAAA CTATCGTGATATCCGGATTCTMCMCCAGACTGTAAGGAGAGCTATTAATA AGGTTGATGGAAGGAAATTTATGTGGGTGAAAAGATCATCTTCGACACCA GCAATTAAAGAACCCCATCTCCGTCGTTGCCATACTCTTTGAAATGAGTC TTCTGACACTTTTGGCTTTTTACAACTCTGATTTATTTTTATTTTTTTGA AAAATCAGCATATTTTGTTCTAGAAATCCAAAAGGAAATTGTCAGTTCCT TTATTGTTTTTGCCGACAAAAAAAAAAATATACCAGCCCCTTCGTCTACA TATTTTTGATAAATGCAGAGGAGAAGGAGCGCAATGTCCCTCCACGCCAC AGTGAGCTAGCACTAGAATGCCATGGCAGAAGAATCTATCTGCAGCGGGT GCCAGGCCTTCCACAAACCGCCATCATTGCCACCACAAGCAGCTACATTA ATTATTAAGATAACTTAGACACAAATCTATTTAAAGTATTAATTTTGTTG AAATAATATTGTTACCTAGTATATTATCAGTCGGAATTTTAAAATTCAAA ATGTTCAGATTTGAATGGACCACTCCATAATTAATTAACATTTTCAATAT CTCTTAGTATTATGAAATACTTCTATCCATAGAAAATGTCGTTATATTCG AAAATAATTTATTAAATCTACCTTTGTCTATAATTTATGTCAGTCCATTT ATAGATTTTTTTTATTTATAAAATTTCAATTCAATGAAAATTAATATTAA GCAACAATCTACCAAAAGTTTTTTTTTGTTTTAATTTACCCTTTTTAAGA AGATAATTTGTGAGGATTTGTTTATTTAATAACATGTTTGTAATGAAAAA AAGAGTGCAAAGAAAGGCAGAAGCAAGACTTATGGTACTACTGAATTGAG CCTCTTTTTAATAATAATATAAAATAATGTATTAAGACTATTATTGAGAG AAGAGCCCTTTACATAGCATTAGTATTTGAAAAATAGTATAATTATATTG AAATTCATAGGTACTATTTTTACATTGTATTTTTAAAACAATTTACAGCA AATATAGAAAAGACTACTTACTACAGAGGGAGAAGTTAACACCACGACGA CCTATTAAGTAATGAATTAAAACAAACAAACGAAATTTTTGTATTAACTT AATAAGGACAAATTACGATCATAGTCTCTACTAGGAGAATTAATAATTCT ACTTGTAAAGAATACAATCCTATTCTTTCCTAGGACAAATTTCAATTTTA CTGAGGTAGATAATAGAATTGAATATTTGAAGAGGTTCCGTGTTTTCAAA AATATGACACCAAAATATGCGCTCTATGGTACCGTAACCGGTAATTTCAT TCCCAGCAAATTCATCTCCTGTCTTTTCATTCCTAGTAATTTCATTTCCA GTAAAATTTTTACCTGTAAAATTAATTAGAAACATGGTGGGACTTGTAAT AGATTTCTAGAATAGGTCCTTCATCCCCCTCAAATACAATCACAACTGTT CAAACTTCAATACGTACGTTTCAATGCATTTTGAAGGAATCACGGAATAC CACTACTATGGTCCGTTCCTAAGAATCATAGATATTAATGTCCAGTCCAT TTCTTCACCAAGAGGCTATGAACAGGATTGTACTAGAGTTATAGAACTAG ATCAAAAGGGGGATCTCATCCATGAAAGTCTGCATGCATTTCTGTATAAG ATATATAATATTATGTATATCTAAATAATTCAGTAATTTATCACAAATCA GAGATTGTGCTATGCTAATTTCTACCCTTCACATCTGCTTCCCTAACTGT AGTTCGGTAAACCACTTGGTTCTTTGTAACCATATCCTTTTTGATATTAC TGCGAAGATTTTGGATCCTAACGAATGGAAGTAAAACATGGTGTCAAGAT CCTTCCAAAATAATACATTATTCTTATTGGTTGATAAATACAAAAACCCG ATTGATCTGAGCTTTGAGAATTGAATAAGATAAGGAGATTTTCACAGTTT GAGGTTTAAGGTTGACATAAATTTACTAATAGAATAATAACTATAATTTT TATTTAATAATCAAATTCAAACCCAGAAAGTCTATATCTAGGATAGAACA TTGAATCGGTTCTAAGATACCCCCCTCACCCCAAATAAAGATACTTTTCT ACCTTTTTTCGGAATGATTCAAACTGATATTTAAAAAACCTCCATTGAAT CAATGTATGTAGAAAGACAAGATCCCTTGAACAGAACATGAAGAGAGTAT ACTTCCATCTATCCATGTTACTTTTTCTTCTATTTAATCTTTTTTTTTTT GTCGAAAGGTATACCAATATTTTTGAAAGATTATACATTTACCTCAATTT CTAAATTCATAATAATTTTTCTGATCCTTTCTTCATKTTCTGTTCAAGGG ATCTCGTCTCTGTGTGCTTCACTCAGTGGATCTCATCTTCTTTAATAAAA GGATCGTTCATTGTGCAGATGCCCCTTCCCTTTCAAGGTCTGTGATAGTG ACTTCTGACCTCGTGAATAATTGCCTCTTTGTTCAGAAATACATNGAAAT ACATAAATTCCTCTCCAGATCTTCTATGGAATAATCGTATACTGCTATAA GAACTTATGAGTTCCATAAAGAGACAGAATACTCCTCTGAAAGCCCAAGT GAGGCACAGAAAGATTTCTCATCGTCCATCCACTGCTCCTTCATTAATAT TCTGGAGTTCTTTTGTTCTTAAGTCAACTTTGCTTCGTCTCTTACTCGAA TAAAAATATTTCATTTATAAGAGTCTTTCAGTTTCCTTTATGTATGTATA TAATGCAGAAATAACTGATCTCAATCACAATTCCATTTATAAGGTGGGGT TTTTGATGTATAATCTGTATGGATTACCATTAGTTTTTTAATTTGAAATT CATCCTCAATTGACTCCACGATGATATCATCAAAATAGTCTGTACAATTG TAAACAAATGCAAATAAATCTCTTATGGATACATTTATATATAGTAATCT TCATTTAAGACAATGTATTTATACATAAAGGTGAGGCACCAAGGATCTTC TAAGGTAGTCTGATTGGCGTTAGCTGATGGAGTGACGTCACTGTTGCGGA AGCTCMGATACTTTCATTGAAGGGAAGTGCTCTAATTTGGATCTGTTAAG CAAAAATGGTATCATCTCGAGGTTCAAAGCGTGTTGTGCCCGGCCCTACT GTCCCAATCCACGGGATAATCAGTATTTTGTATTTACTTAGACAAATTTG ATGCTCCAGCATCTTTGGATCTCAGTCTGGAGGAGAAAAGATCCGATGAA TATTAAAACTGCTAAGATTTGTGATAGTTATTTTACAGGCAATGGTTTTG AACAGAATCTCTCTTCTTTACTTAAAGGCCAGGACGAAATTAAAAAGTGA TGCGTTCAAAAATAAATCATTATTTCAAAGTATCAAGGATAATGGATTGA AATTCATTTTAATCACTCATCTAAATCTGGATTGTCTGGAGAATGTATTC TCACAGATTCGTGCAATGCAGGAAACAATACTCATACATTCCAATATATT CTACCTATATAACCTTGACCCTTGATTTCTTAATTACATGTGCTCCTCTT TTCACATTGGAAAACGAGTAGCAGATAATTCTAGACTATTAAAGATAATA TGCCTCTCCTTTTTGCTCTGAAACCTATGTCTGAATTGCAAATGCATATT CTACTATGCTAATAAGTATATTTATTTCTGTATAAAAATGTTGCATTTCA TTTTTTATATGTGTAATGTCACACATAATTTGTTGGATCTATTTGTTTTA ATCTATATTAATAATTTCTATCATTTGTCCTTTAAAATTTGCTGATTCTC TGCTTATGACTTCTAGTTACAATTTATATAATTATTTTACCGTTGTAATT TTTTTTTATATTTGCCCATACTCATTTAACTTATTATTATAAGTATTGAA TTATTGAAATTCCCTACTCATCGTGAATGGATCTCTTCAATGTTGCAATC TTTTAACCTCCTTTGCAAGGAAGGAGTCGAATCTGCACTCTTGAAAAAGA TGATTAAGTTAAAAGTATCTTTCTTCGATTTCCTCAATCTGGTTTTGGTC TTATCTTTCGGAGATCATATCTGAAGTGTTGCCGTATTTTTGTCTCATCA AAAATAGATGCCCAGATTTTTGCAGTTGTATCTGGATTTACAAACAGTGA AGAACAACTCCCTGAATGGTCTCAATGATGGAATCCCGCATATTCACAGA CTCAAAGTTAAAAGTATGTGTTTTCTAATAGAAAAGGTTCAAAAAATTAT TTACATTTCATTGAGAATATAATTAAAACATAATGAAAGAATTTATCTAT TATTTTCAGTTATAAACGTTAATTAGTGTGTACAACATAAAAATAAGACT GTGGAACAATGTTAAAACTTTTTTTAATACTTTTTAGGTTCATTTATTTA ATAAAACTAGGTTATAGAGAGATAAAACTTGTATACAAAATAAGGGTTAA GTCCTAATATTTACTCGTCCCATTTTGACATTCAATAGTTAACAATTTCT TAAATATTGGAATTCAAAATTTGCCTATAAAATTACATACATATATACTC AAAAATTAGCTTTTATTAATTCTTTACACAACTTCCTAAGGCAAATTTAT GGGATGTGGTAGAGACGAGAGAAAGAAAAAAAATTCTGTTTCGCAAAAAA TTTACAAAAATTCTAAATATCGAACATCCCTTGAAATTTAAATATTAACA TTTTACTTATCAAAAATATCTTTTGTTCGTAATATCTATGCATTTACTTC CAGGAAAATTTGGATTTGTTTGATTGATCAGAACAGATAACAATATCTTT ATCATCATCCCATTCTATATAAATATGMGTAAATAATAATTAACTAGTGT ACTGGTTCTGTTTTGGATGAAAATTGGATTATAACTGCTAAACATTGTGT ATTAAATGATAATTGGTCCGAAATACGAGTTGGAATTCATAGCACTGGCA ATGGTGCGGATGAACCATATAAGCAAACCCGAACAAGTACTGAATTTTAC GAATCACCAACTGGAGACTTTGCTTTGATCAAATTGGAGATTCCTTTGGA ATTAAATGAATATGTCCGACCAGTTTGCTTACCAACNGGAGGACATGAAG CAGCAAGACATCAGTTTCCATGGCTAGCTTTTGTCACTACCGGTGGTTAT TGTACTGGTTCTGTTTTGGATGAAAATTGGATTATAACTGCTAAACATTG TGTATTAAATGATAATTGGTCCGAAATTCGAGTTGGAATTCATAGCACTG GCAATGGTGCGGATGAACCATATATGCAAACCCGAACAAGTACTGAATTT TACGAATCACCAACTGGAGACTTTGCTTTGATCAAATTGGAGATTCCTTA G
back to top
Add to Basket