EMLSAG00000001320, EMLSAG00000001320-684086 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592939525|gb|GAXK01019028.1| (TSA: Calanus finmarchicus comp268189_c0_seq2 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 6.811e-2 Identity = 20/66 (30.30%), Postives = 35/66 (53.03%), Query Frame = 0 Query: 1 MLITLLLC--VIILYRKKSKKLDHSYSYTQIRDNRR--GTTESQEEEYEKVEFLGLEDEDPDQENP 62 +++ LL+C + R+K+ +H+Y Y+Q++ NRR G + E +KV L + D E P Sbjct: 1568 LVLILLICCGACAIRRRKNIGKNHNYRYSQVKSNRRVEGRVDGSESTDDKVGLLTSSIMEEDFEEP 1765
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592939526|gb|GAXK01019027.1| (TSA: Calanus finmarchicus comp268189_c0_seq1 transcribed RNA sequence) HSP 1 Score: 33.113 bits (74), Expect = 7.035e-2 Identity = 20/66 (30.30%), Postives = 35/66 (53.03%), Query Frame = 0 Query: 1 MLITLLLC--VIILYRKKSKKLDHSYSYTQIRDNRR--GTTESQEEEYEKVEFLGLEDEDPDQENP 62 +++ LL+C + R+K+ +H+Y Y+Q++ NRR G + E +KV L + D E P Sbjct: 2094 LVLILLICCGACAIRRRKNIGKNHNYRYSQVKSNRRVEGRVDGSESTDDKVGLLTSSIMEEDFEEP 2291
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592949082|gb|GAXK01009471.1| (TSA: Calanus finmarchicus comp1248236_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.623e+0 Identity = 11/22 (50.00%), Postives = 17/22 (77.27%), Query Frame = 0 Query: 8 CVIILYRKKSKKLDHSYSYTQI 29 C+ I +R++SKKL S+S TQ+ Sbjct: 1518 CLAIFFRRQSKKLSSSFSQTQV 1583
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592803352|gb|GAXK01151216.1| (TSA: Calanus finmarchicus comp1015464_c0_seq3 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.021e+0 Identity = 19/59 (32.20%), Postives = 33/59 (55.93%), Query Frame = 0 Query: 10 IILYRKKSKKLDHSYSYTQIRDNRRGTTESQEEEYEKVEFLGLEDEDPDQENPHSDSES 68 + + ++KS +LD + T + +RRG+ +EE+ VE + +EDP PH D +S Sbjct: 26 VSILKRKSARLDMAL-ITCMSQSRRGSKTPEEEQVVLVERREVREEDP--HLPHEDGDS 193
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592780194|gb|GAXK01174374.1| (TSA: Calanus finmarchicus comp1110159_c0_seq3 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.085e+0 Identity = 11/19 (57.89%), Postives = 14/19 (73.68%), Query Frame = 0 Query: 51 GLEDEDPDQENPHSDSESD 69 GL D+D +QENPH SE + Sbjct: 1613 GLSDDDRNQENPHKCSECN 1669
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592803354|gb|GAXK01151214.1| (TSA: Calanus finmarchicus comp1015464_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 3.098e+0 Identity = 19/59 (32.20%), Postives = 33/59 (55.93%), Query Frame = 0 Query: 10 IILYRKKSKKLDHSYSYTQIRDNRRGTTESQEEEYEKVEFLGLEDEDPDQENPHSDSES 68 + + ++KS +LD + T + +RRG+ +EE+ VE + +EDP PH D +S Sbjct: 26 VSILKRKSARLDMAL-ITCMSQSRRGSKTPEEEQVVLVERREVREEDP--HLPHEDGDS 193
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592925458|gb|GAXK01032957.1| (TSA: Calanus finmarchicus comp314311_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.743e+0 Identity = 13/41 (31.71%), Postives = 23/41 (56.10%), Query Frame = 0 Query: 1 MLITLLLCVIILYRKKSKKLDHSYSYTQIRDNRRGTTESQE 41 M++T + C++I+Y K++D R+ +R TT S E Sbjct: 931 MVVTAIYCIVIIYIPSMKEIDSKIG----REPKRCTTTSVE 1041
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Match: gi|592932853|gb|GAXK01025700.1| (TSA: Calanus finmarchicus comp3870979_c0_seq2 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 6.813e+0 Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 0 Query: 14 RKKSKKLDHSYSYTQIRDNRRGT 36 RK S+ LDHS+S +IR+ RGT Sbjct: 93 RK*SRNLDHSHSTQEIRNLMRGT 161
BLAST of EMLSAG00000001320 vs. L. salmonis peptides
Match: EMLSAP00000001320 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1223:150550:162084:1 gene:EMLSAG00000001320 transcript:EMLSAT00000001320 description:"maker-LSalAtl2s1223-augustus-gene-1.7") HSP 1 Score: 157.918 bits (398), Expect = 1.602e-51 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0 Query: 1 MLITLLLCVIILYRKKSKKLDHSYSYTQIRDNRRGTTESQEEEYEKVEFLGLEDEDPDQENPHSDSESDHRDSNLQC 77 MLITLLLCVIILYRKKSKKLDHSYSYTQIRDNRRGTTESQEEEYEKVEFLGLEDEDPDQENPHSDSESDHRDSNLQC Sbjct: 1 MLITLLLCVIILYRKKSKKLDHSYSYTQIRDNRRGTTESQEEEYEKVEFLGLEDEDPDQENPHSDSESDHRDSNLQC 77 The following BLAST results are available for this feature:
BLAST of EMLSAG00000001320 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000001320 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 8
BLAST of EMLSAG00000001320 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000001320 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000001320 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000001320 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000001320 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1223:150550..162084+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000001320-684086 ID=EMLSAG00000001320-684086|Name=EMLSAG00000001320|organism=Lepeophtheirus salmonis|type=gene|length=11535bp|location=Sequence derived from alignment at LSalAtl2s1223:150550..162084+ (Lepeophtheirus salmonis)back to top Add to Basket
|