EMLSAG00000003292, EMLSAG00000003292-686058 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000003292
Unique NameEMLSAG00000003292-686058
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
P F154 (HCP1) HCP1 female
  1. PreAdult2
  2. Adult
-Missing-
no visible phenotype
07.03.2014 - 15:55
22.04.2014 (All day)
NAH F154 HCP1 unknown
  1. Nauplius I
  2. Adult
-Missing-
no visible phenotype
21.11.2014 (All day)
12.01.2015 (All day)
Homology
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CG15890 species:7227 "Drosophila melanogaster" [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 GO:GO:0016021 EMBL:AE014298 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 GeneTree:ENSGT00530000063076 KO:K14613 OrthoDB:EOG74N5GV EMBL:BT133123 RefSeq:NP_572968.1 UniGene:Dm.17426 SMR:Q9VY22 EnsemblMetazoa:FBtr0073939 GeneID:32401 KEGG:dme:Dmel_CG15890 UCSC:CG15890-RA FlyBase:FBgn0030576 InParanoid:Q9VY22 OMA:SFVYAFA GenomeRNAi:32401 NextBio:778278 Uniprot:Q9VY22)

HSP 1 Score: 205.682 bits (522), Expect = 2.684e-57
Identity = 126/465 (27.10%), Postives = 237/465 (50.97%), Query Frame = 0
Query:    5 WK-KTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEI-----QTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFE--LKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTS--CLYSIVGFLAIYLY 459
            W+ K R + +N+T+EP++  + +   L ++  Q+L + K C VN+ +   +CD + + +       +  VQ+ V+++ A+   +Q L   +  LF G WSD + R+   +L      F  V+ L+  V+F +  ++A  L        +GG+        SYI DIT +  RT R+  L+  F +G  +G+  SG++ K++GF   FS++      + +Y  FF++E  S  ++              +  +K  +   F  +H     +   K+ E+  +K ++ L+++ M+ +    G+ +V +L+ R RF W+E++FS F       GL+   F +  LSHKL   D  + +++    I++ F++ FA + W +Y+ G+V          +RS+ +K +  DE+GKV S+    +A++ M+ +P+Y+ +Y ATL   PG  FL+     L+S+  FL +Y +
Sbjct:   59 WREKIRLVANNVTVEPILAAYIMPSVLSNLATQNLNLEKACRVNMAYGDEVCDALTRRQTANYTLEEETVQQMVARMAAWKTVIQSLFPCLLILFWGSWSDRHRRRKPCILIPVVGEFLGVVGLMLCVYFEQAPMEAAALTEAIFPSLSGGWFTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAFVYGFFFLEEPQSRPEK--------------SAEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHGEMAVTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCVGILSHKLNIDDALVGVLSSTSKILSSFVYAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFGVAEALMPMVFAPMYTTLYAATLRVLPGAFFLLGGGLTLFSVFIFLWMYRF 509          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CG30345 species:7227 "Drosophila melanogaster" [GO:0005215 "transporter activity" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] InterPro:IPR005829 InterPro:IPR011701 Pfam:PF07690 PROSITE:PS00216 EMBL:AE013599 GO:GO:0016021 GO:GO:0055085 GO:GO:0005215 eggNOG:COG0477 InterPro:IPR016196 SUPFAM:SSF103473 KO:K14613 RefSeq:NP_724760.2 UniGene:Dm.23756 ProteinModelPortal:A1Z7R4 PRIDE:A1Z7R4 GeneID:246553 KEGG:dme:Dmel_CG30345 UCSC:CG30345-RA FlyBase:FBgn0050345 InParanoid:A1Z7R4 OrthoDB:EOG7G1V5W PhylomeDB:A1Z7R4 GenomeRNAi:246553 NextBio:842969 Bgee:A1Z7R4 Uniprot:A1Z7R4)

HSP 1 Score: 157.532 bits (397), Expect = 9.019e-41
Identity = 121/475 (25.47%), Postives = 226/475 (47.58%), Query Frame = 0
Query:    3 SIW-KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICD-----DIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAE---YLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENS 468
            S W K+ R    ++ LEP VFL      L     Q+  + + C   + ++ T C+     D    E+I+ +VQ+Y S +   +  L+     I SLF GPWSD  GR+ I++ +  GY+F+ +I ++ T     +      +LL      F+GG  A     + Y++D+  ++ R  RM  ++    +G + G   SG I    G +  F L       ++LY  FF+ E   SED    +                 I + F++   +  VK+ +++RE+  +  + F+++   L +F   G+ +V ++++RK+F +T  D+S F     +  +V     +  L   L      + L+A    ++   +   A     +Y+A +V  +   +S + ++++S    S E+GK+FS+  S Q++  + A+P+Y+ VY+AT++F+PG+   ++  LY  + F      FG++K   S
Sbjct:   32 SSWLKRPR----SLILEPAVFLVFFGRFLTDAVYQNQILYQTCVTVMKYNATECEPFLGTDRASDEKIEGQVQEYASTITMISSMLESTVPAIVSLFLGPWSDKFGRRPILLSTFTGYLFSAIILVVLTQITTAVNISPWWFLLSSVPSVFSGGTCALITILYCYVSDVATENKRAMRMVTMEAALGLGMMAGGVASGYIYAATGASILFILVGSIISIALLYVYFFVAESLKSEDLETGSR----------------IREFFRLDLVKVLVKTCIRKRENYDRAIIWFVMMSLTLCVFAMEGESTVNYMFMRKQFDYTVQDYSVFNAARVVIQVVGSTIAMILLRRLLGLSTIMMTLLAFACCVLESTVRATAVYGSEMYLALMVGMMRGVMSPMCKAILSHVTPSSELGKIFSLTTSLQSISPLGAAPLYTAVYQATVNFYPGIFNFISVGLY-FLCFCMSAAVFGIQKSMGS 485          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CG42514 species:7227 "Drosophila melanogaster" [GO:0004016 "adenylate cyclase activity" evidence=NAS] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 GO:GO:0016021 EMBL:AE014296 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 GO:GO:0004016 GeneTree:ENSGT00530000063076 KO:K14613 UniGene:Dm.19275 NextBio:815629 EMBL:BT100042 RefSeq:NP_730171.1 RefSeq:NP_730172.1 SMR:Q0E8E1 EnsemblMetazoa:FBtr0300655 EnsemblMetazoa:FBtr0300656 GeneID:8674108 KEGG:dme:Dmel_CG42514 UCSC:CG32158-RC FlyBase:FBgn0260388 InParanoid:Q0E8E1 OMA:CINAYIA OrthoDB:EOG7NSB22 GenomeRNAi:8674108 Uniprot:Q0E8E1)

HSP 1 Score: 134.42 bits (337), Expect = 8.304e-33
Identity = 112/463 (24.19%), Postives = 210/463 (45.36%), Query Frame = 0
Query:   10 YILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQ---LQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQD-FTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGL-SGIIKKKLGFTYCFSLAIVTSWSS--ILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIW-KMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPG------------LVFLVTSCLYSIVG 452
            +++ + ++EP +FL+  +  + S+  Q+ ++ K C VN N +  IC ++ + E  +   +  ++    LQ  N      P +I +LF G +SD  GRK  +++   G  F + + ++N           +    L    TG  VA F +C +YI+DI+    RT R+  LD I+     MG+ L S +       +Y     +  S  +  I+YT+  +K + +              Q +  ++     W   F  QH +  +   +K R+   + +L+ L++   L  F    +G  +++Y   +F W    +S F        +++    +P ++  L WRD TII I    + IA   F FA  + L+Y   +V  LG  +  ++R++ SK + + E GKVF++++     +  I+   YS +Y+ T +   G             VF++  CL+ ++G
Sbjct:   52 HVVKSTSVEPTMFLYMFAFMITSVVEQNFFLYKSCRVNRNFTEEICRNLNKPENEEFRTKAMLTNAWFLQWENISAHVFP-IILALFLGSFSDRRGRKLPLLMGLVGKFFYSTMIVVNARMTTWPVQNIIYSATLPSALTGADVAIFASCFAYISDISSLQQRTIRVTILDVIYLSAMPMGVALGSHLFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPR------------QRSLRELGCCGFWGDFFDKQHVKDSLAVLVKPRKGHRRSFLIILLVSMALYTF-QRDEGQYLYMYTLGKFDWDVSAYSNFKTFKSSAYVIAMLLAVPLMNKILGWRDTTIIFIGTWAHSIARLFFYFATNTDLLYAGAVVCSLGPIVGPMIRAMTSKIVPTSERGKVFALLSVCDNAVPFISGVCYSQLYRRTQNTNHGGNVFILTIATQIAVFVMILCLHIVLG 500          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:zgc:174356 "zgc:174356" species:7955 "Danio rerio" [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 ZFIN:ZDB-GENE-080215-21 GO:GO:0016021 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 GeneTree:ENSGT00530000063076 OrthoDB:EOG7DNNVC TreeFam:TF315701 EMBL:BX571832 Ensembl:ENSDART00000128863 OMA:SMIFVGG Uniprot:E7F3C5)

HSP 1 Score: 132.109 bits (331), Expect = 2.992e-32
Identity = 115/461 (24.95%), Postives = 223/461 (48.37%), Query Frame = 0
Query:    3 SIWK-KTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEE---IQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFN-----NVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDIT--DDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKW-RDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIV 451
            S WK K R I   +T+EPV+FL+  S  + +  +Q + I+KVC  ++  +++IC D   H+E   +QT       Q  A    +   PA++     G WSD  GR++++ L     + +      V  L N   ++ L A  L+       TGG+V+ F +  SY+ D+T    S+RT RMA  + +  +G  +G  L G ++++ G    F   I      +LY + ++++ +  ++         T +S + + +     ++F +++ +   K+  KRR    +  L FL+L   +   +  G+ S++ LYL   ++  E   + F +   ++ L+  + ++      ++  ++ T+  ++    I +  +   +N +W+V++  +V         ++RSL S  +  DE G +FS  AS +A   +IA+ I++ +Y  TL  FPG+ F++ +    IV
Sbjct:    2 SSWKEKLRRI---VTVEPVIFLYMSSSFIVTPAIQQMIITKVCQ-DVLKNVSICSDPEHHKEYEHVQTTSSYIFLQFNAILSLVSIPPAIML----GSWSDSAGRRSVMALPSVLSLLSGGLLLAVSLLDNISVYWTLMAAALM-----GLTGGHVSIFLSSFSYLADLTMGSSSTRTLRMAVAESMIFVGGTIGFLLGGFLEQEFGLQAAFGAYIGCHVLVLLYIVLWLRDPSVGKNTRLVLCKEETAESGSQEDQS----RLFILKYAKMSFKAVFKRRSGQERMKLHFLMLCTFINNLVAVGEQSILLLYLM--YEPREFTTALFGVFNSVKMLLLGFGLLGLFPLLMRCVKEMTLAKLSAVFRIASYILLALSNNTWMVFLVAVVGAPSGISQAVIRSLSSAIVGPDEQGAMFSFSASVEATCILIAATIFNGLYPLTLPTFPGMPFIIMAAFMLIV 443          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CG15553 species:7227 "Drosophila melanogaster" [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0022857 "transmembrane transporter activity" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 EMBL:AE014297 GO:GO:0016021 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 GeneTree:ENSGT00530000063076 FlyBase:FBgn0039817 NextBio:835211 RefSeq:NP_651841.3 UniGene:Dm.27461 ProteinModelPortal:Q9VA14 SMR:Q9VA14 EnsemblMetazoa:FBtr0290201 GeneID:43677 KEGG:dme:Dmel_CG15553 UCSC:CG15553-RB InParanoid:Q9VA14 OMA:MLIFSHM PhylomeDB:Q9VA14 GenomeRNAi:43677 Bgee:Q9VA14 Uniprot:Q9VA14)

HSP 1 Score: 126.331 bits (316), Expect = 3.619e-30
Identity = 108/480 (22.50%), Postives = 213/480 (44.38%), Query Frame = 0
Query:   17 LEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTIC------DDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGY----VFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKER---NSSEDQVDNTDDN-------------------STTQSANNKVKKEPIWK----------MFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMI----VFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSI 450
            +EPV+F+   SH L    +++  I + C V   ++ T C      +   + + I+TE+Q YV+ +       + +   I  LF G WSD  GRK ++++S  G+    + +++I  L++ +       Y L        GG+  F  A   +ITD TD  +R  RM F++ I  +    G  LS  +       +  SL+ +    + L+ IF++ E    +  ED++   + N                     T++ ++  K E   K          +F I+H +    +  K+RE++    +  + L   + +F+  G  +V +L++R++F +T  DF+ F      V  +  ++    +  F    +       +L  V  NI  GF    A +SW +Y++ ++    +    + R+++S  +   + GK+F++    Q+    +A+P+Y+ +YK +L   PG    +++  Y +
Sbjct:   23 IEPVLFMLIFSHMLSGTVMRNQLIYQACTVIFQYNETDCKLLDSKNTTTEIQAIETELQDYVANMFLTRTLFESIMPAICGLFVGSWSDQYGRKPLMIVSLVGFSASALISSIICWLSSYYMVN-PWWYTLAAVPHSVLGGWCVFSVAAFCFITDTTDMKTRPYRMIFMEIILFVALTSGSLLSSFVYAATSSAFVQSLSCLIVIIATLFIIFYLPESLGMSPEEDEIPEKEKNVVVTVLDHKNKTNEISAEAEKTENCDDPPKYESPEKPLEDKVEKAGLFSIKHVKDMFSTCFKKRENNAHTIIWLVTLAGFVSIFVADGVMTVNYLFVRQQFHFTVRDFTIFETFSQSVPMLGAVLGILILRKFFGLSVVALALLSLLSEVAANIARGF----AYLSWHLYLSVVLGIFRSIQGPMFRTIVSNIVPPSDTGKLFAIGNILQSFAPFVAAPLYTAIYKESLASNPGGFNFLSAAFYGL 497          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CG30344 species:7227 "Drosophila melanogaster" [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0005215 "transporter activity" evidence=IEA] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0031427 "response to methotrexate" evidence=IEP] InterPro:IPR005829 InterPro:IPR011701 Pfam:PF07690 PROSITE:PS00216 EMBL:AE013599 GO:GO:0016021 GO:GO:0055085 GO:GO:0005215 eggNOG:COG0477 InterPro:IPR016196 SUPFAM:SSF103473 InterPro:IPR020846 PROSITE:PS50850 GO:GO:0031427 GeneTree:ENSGT00530000063076 KO:K14613 EMBL:AY051590 RefSeq:NP_724759.1 UniGene:Dm.4554 MINT:MINT-741964 STRING:7227.FBpp0087664 EnsemblMetazoa:FBtr0088583 GeneID:246552 KEGG:dme:Dmel_CG30344 UCSC:CG30344-RA FlyBase:FBgn0050344 InParanoid:Q961H2 OMA:PMCRAIL OrthoDB:EOG7PK8ZN GenomeRNAi:246552 NextBio:842964 Uniprot:Q961H2)

HSP 1 Score: 124.79 bits (312), Expect = 1.035e-29
Identity = 108/465 (23.23%), Postives = 208/465 (44.73%), Query Frame = 0
Query:   17 LEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIY-------QHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAE---YLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQF---MIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENS 468
            LEP VFL   +  L     Q+  + + C      + T C+ +          +E++  VQ Y + +      L+ +     SLF GPWSD  GR+ I++ +  GY+   +I ++ T            +LL       +GG  A     + YI+D+  +  +  RM   +     G ++G   SG I         FS+A      +++Y + F+ E         N  D  T     ++V++      F+       +++  KRR +  +  +   ++   + +F   G+ +V +++++ +F WT  DFS F    IV  I G +    V   L   LK    T+ ++++   ++   +   A     +Y+   +  +   +  + R+++S    + E+GK+F++  S ++V  + A+P+Y+ VYKATL+ +PG    +++ LY  V ++ I + FG++K   S
Sbjct:   54 LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQTYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRRPILLTTFTGYLTGALILIVITYITRSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCAGIMVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPESL-------NPGDIHT----GSRVRE-----FFRFDLVTDLIRTCFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDFSLFNASRIVIQIVGSIVGMLV---LRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLGMTLGMMRGVMGPMCRAILSHVAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKATLENYPGAFNFISAALY-FVCYILIAVIFGIQKSMGS 498          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CELE_Y4C6B.5 "Protein Y4C6B.5" species:6239 "Caenorhabditis elegans" [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 GO:GO:0016021 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 EMBL:FO081369 GeneTree:ENSGT00530000063076 KO:K14613 eggNOG:NOG320287 PIR:T34013 RefSeq:NP_500781.2 UniGene:Cel.8883 ProteinModelPortal:Q9UAZ6 SMR:Q9UAZ6 STRING:6239.Y4C6B.5 PaxDb:Q9UAZ6 EnsemblMetazoa:Y4C6B.5.1 EnsemblMetazoa:Y4C6B.5.2 GeneID:189356 KEGG:cel:CELE_Y4C6B.5 UCSC:Y4C6B.5 CTD:189356 WormBase:Y4C6B.5 HOGENOM:HOG000021762 InParanoid:Q9UAZ6 OMA:YRIAGVE NextBio:942114 PRO:PR:Q9UAZ6 Uniprot:Q9UAZ6)

HSP 1 Score: 112.464 bits (280), Expect = 1.578e-25
Identity = 116/488 (23.77%), Postives = 217/488 (44.47%), Query Frame = 0
Query:    9 RYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI---YQHEEIQTEVQKYVSQLQAYNFFLQGL----PAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFM-IVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENS----RKNAHELREEELLNRN 484
            RY L  + +E  +FL+ L   L     Q+L   K C +    + T C ++   Y  ++IQ     +        +F+  L    P+++ +L  G  +D    K  +++   G +   + Y+  + F        L+ + L    GG++A      +Y    +    R+ R+A ++G   +G  +G  LSG I++  G+   F + +     ++LY +   KE   ++ +    D++++  S   K     I + +++             +    +  L+  +L F LE+ ++ G   + + YLR + +W +  +  F  + +GI    +  F+ P L  KL   DG +  + +   +I+ FMF F     + Y   ++      +ST  R+ IS  I+  E GK+FSVI+  + +  ++A+ IY+ VY  TL FFPGL++L++          A+ L   L  V  S    R +  E+ E  L +RN
Sbjct:    3 RY-LRMLGMEIPLFLYMLGSYLNYPVFQNLIYEKECLIKYQQNETFCRNVSAYYDDKDIQAAANHF--------YFISSLTLLCPSLVTTLLLGAATDYWSIKIPLIIPYIGCILGTINYVFQSYFIHTSVYFLLISDALFGLCGGFIAIISTTLTYGVKTSMLRYRSYRIAGVEGAIGLGGTVGFALSGTIREACGYAVTFLIILGLQLLALLYLLGLAKE---TKFEPVRPDEHTSLISTTGKQLVAVIREFYRV-----------ITKSRQFRLLLILNLLAFGLEMLVFSGLSDIQYSYLRYKLQWGDKKYGWFSGLSYGIT-TAAVLFLYPLLRMKL-MSDGMLATLGLFFKMISLFMFAFLQNEVMAYSIAVIVMFNRFVSTGFRAFISSLIDMQEQGKIFSVISLLEGITTLVATSIYNNVYPNTLTFFPGLLYLIS----------AVTLLIPLAIVSTSDFVVRTHRPEVSEGILNSRN 455          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CG31321 species:7227 "Drosophila melanogaster" [GO:0003674 "molecular_function" evidence=ND] [GO:0005575 "cellular_component" evidence=ND] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 EMBL:AE014297 GO:GO:0016021 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 GeneTree:ENSGT00530000063076 KO:K14613 eggNOG:NOG264356 EMBL:BT133464 RefSeq:NP_731899.1 UniGene:Dm.12882 SMR:Q8INF8 STRING:7227.FBpp0082385 EnsemblMetazoa:FBtr0082926 GeneID:318681 KEGG:dme:Dmel_CG31321 UCSC:CG31321-RB FlyBase:FBgn0051321 InParanoid:Q8INF8 OMA:GENDYWY OrthoDB:EOG74N5GV GenomeRNAi:318681 NextBio:845883 PRO:PR:Q8INF8 Uniprot:Q8INF8)

HSP 1 Score: 111.309 bits (277), Expect = 8.493e-25
Identity = 121/556 (21.76%), Postives = 231/556 (41.55%), Query Frame = 0
Query:    4 IWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKY--------------------------------VSQLQAYNFFLQGLP-----AVIYSLFAGPWSD-INGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLF--ECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGF-LMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE-----------------------RNSSED----QVDNTDDNSTTQSAN--------NKVKKEPIWKMFKIQHFQAG-----VKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVE-NSRKNAHELRE 477
            +W+   Y++    +EP  F + ++    ++ +Q+  + K C VNL ++  +CD +    E+  E   +                                 +Q+ A +   +  P      +I  LFAG W+D  N RK  +++   G   +    +++++FF  L  E+  +    +    GG      A +SYIT  T +  R  R      +F  G   +G  +SG++   LG+T+ F+ AIV    +I Y IFFIKE                       +    D    +  N D+    ++ N         KV+  P  +    + F        ++  L +R ++ +  L+ L+  + L +    G+    + +  K+  W   DFS ++ +     LV  +     LS  LK  D  I +++    + +  +F F++ +   YVAG+V    +     ++++ S  +  DE+ K++S+    + +   I  PI+S +YK+T+D FPG ++L     Y     + +  YF L++ + N  K+  E+ +
Sbjct:   30 LWRYRHYLV----IEPFFFFYFMASVFNAVAMQNFPLDKACRVNLGYNKIVCDTMLDKSELGIECDDFDFENTTQGATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGIF-AMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLLRRRKANEEKSVVEMEQ 580          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:slc46a1 "solute carrier family 46, member 1" species:7955 "Danio rerio" [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0005542 "folic acid binding" evidence=IEA] [GO:0006810 "transport" evidence=IEA] [GO:0016020 "membrane" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 ZFIN:ZDB-GENE-040426-1012 GO:GO:0016021 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 GO:GO:0005542 CTD:113235 eggNOG:NOG306680 HOGENOM:HOG000054191 HOVERGEN:HBG055334 KO:K14613 EMBL:BC049421 RefSeq:NP_956579.1 UniGene:Dr.17681 ProteinModelPortal:Q7ZWG6 STRING:7955.ENSDARP00000032054 GeneID:393255 KEGG:dre:393255 InParanoid:Q7ZWG6 NextBio:20814316 PRO:PR:Q7ZWG6 Uniprot:Q7ZWG6)

HSP 1 Score: 109.768 bits (273), Expect = 1.346e-24
Identity = 109/467 (23.34%), Postives = 201/467 (43.04%), Query Frame = 0
Query:   14 NITLEPVVFLFGLSHGLYS-ITVQSLYISKVCAVNLNHSLTI-CDDIYQHEEIQTEVQKYVSQLQAY---NFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKA-EYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYF--VIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKN 471
            ++T+EPV+FL   S  L + +  Q L+      V  N + T  C+    H+ +QTEV+   +    Y     FL GL  VI     G WSD  GR+ ++++   G      +YL  TV + +L    +L+       +G + A    C +Y+ D ++  SRT R+A L+    +  +    + G  ++  G+   F L + T+ ++ LY   F+ E                       V  +P  ++F  +H QA  +          +  L   IL F L + ++ G   +  LY L     W        +I +G       Y   +    + +    D  + L+ +  N++   + + A+ + L++    + FL  A + +LRS +SK ++  E G +F+ +A  + +  +++S +++ +Y ATL F  G  F+  + +  I     I    G ++   SR+N
Sbjct:   42 SVTVEPVMFLSTFSIVLQAPLCTQYLWDRLSEDVGYNGTKTGGCNASTVHDPLQTEVETLTAHWSLYINLGGFLVGLFMVI---LLGSWSDRAGRRLVLIIPSLGLAVQAAVYL--TVMYLKLPVFWFLIGRICSGLSGDFNAILAGCFAYVADTSERGSRTFRVAILEACLGLAGMFASIIGGQWRRAQGYINPFWLVLATNLTAALYAYLFVPE----------------------TVTPDPQARLFSTRHHQAVCRLYSSDAPPGRRSKLWLYILCFFLVVTVHLGCSDLYVLYELSAPLCW-----GPELIGYGSAAKHLAYLTSLTGLRAMQCCLEDSWVALVGLTSNMVGLVVISVADTTALMFTGYGLCFLFMASTPVLRSKLSKLVDPAEQGALFASVACVEGLCSLVSSGVFNALYPATLHFMKGFPFVFGAAILLIPA--GIIGGLGCQEKRESREN 474          
BLAST of EMLSAG00000003292 vs. GO
Match: - (symbol:CELE_F40F9.5 "Protein F40F9.5" species:6239 "Caenorhabditis elegans" [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] InterPro:IPR011701 Pfam:PF07690 GO:GO:0016021 GO:GO:0055085 InterPro:IPR016196 SUPFAM:SSF103473 eggNOG:NOG263633 EMBL:Z70753 OrthoDB:EOG7NSB22 PIR:T22041 RefSeq:NP_505506.2 UniGene:Cel.3643 ProteinModelPortal:Q20236 SMR:Q20236 STRING:6239.F40F9.5 EnsemblMetazoa:F40F9.5 GeneID:185544 KEGG:cel:CELE_F40F9.5 UCSC:F40F9.5 CTD:185544 WormBase:F40F9.5 HOGENOM:HOG000021641 InParanoid:Q20236 OMA:PFAWNDK NextBio:928650 Uniprot:Q20236)

HSP 1 Score: 99.3673 bits (246), Expect = 7.932e-21
Identity = 112/499 (22.44%), Postives = 215/499 (43.09%), Query Frame = 0
Query:   15 ITLEPVVFL----FGL---SHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHE-EIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLF--ECLQDFTGGYVAFFFACHSYITD-----ITDDSSRTK-RMAFLDGIFPIGFLMG------LGLSGII---KKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVI--PFLSHKLKW--RDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELLNRN 484
            + +EP++FL    FGL   ++ L++   + + I++      +++   C  I      +Q +V+K ++  + Y   +  +P +I S   G WSD NGRK+ ++ S FG   NN I L  T+ +  +   Y  F  E +    GG  A F    + +TD     +   SS    R+     +  IG L G      L +  II   +  L +  C  +    S  S++Y IFF++E +  + +  + +  +  +    +     I  M +   +   V   L  R     +  L + L F+   FL      ++ L  R  F W +  FS F +    + LV+ + +I  P L     W  +D  +I+ A+  +    F+  FA  +  ++   I   +   +    RS + + +  +E  ++ +V++   +   +++S I++ ++  TL ++PG  F V+ C    V    + ++  ++      K     REEE  +R+
Sbjct:   60 VNVEPILFLVMCGFGLMTTNNSLFTYWARCVQIAQTHRELADNATYTCASIASSNGTLQDDVEKDIANTKIYLQIMGTIPTLIVSPLIGNWSDRNGRKSPLLFSLFGLFINNFILLCATLTYETVNVYYWFFISEFMLGMFGGGAATFSTSLAIVTDDCRHKLKPGSSTVPFRVGLASFVQSIGMLNGTLIVSLLAVPAIISVERHALSYVECAFIQTALSLISLIYAIFFVRETHFPKKEDFSYNQLNEAEEVEAEELPPKIIGMRRFTSYLENVFGVLTVRRPGWTRLCLCVSLAFVFIEFLSFDPALLLLLVKRLPFAWNDKLFSYFSLT---RQLVNCFGMILCPILLTFSHWLGKDSLLIIAALACSAATSFLTAFATRTEHIFYTCIFGIVMGGMQPAYRSFLPRMVAKEETARLLTVVSIIISFSPILSSLIFNNIFNMTLTWWPGFAFFVSGCFQITVFIGQLVIHMLMRPQWKLDKQLRTRREEETDSRD 555          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592781617|gb|GAXK01172951.1| (TSA: Calanus finmarchicus comp133348_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 404.06 bits (1037), Expect = 2.119e-133
Identity = 209/470 (44.47%), Postives = 311/470 (66.17%), Query Frame = 0
Query:    9 RYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSS-----EDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNI--IAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKN 471
            R  L  IT+EP +F F LS GLY I  Q+LYI+KVC VN N +  ICDDI  +++ Q  VQ+ VS+LQAYN  LQ +P+++Y+LFAGPWSD  GRK +IV SCFG++FNN ++++NT +F+ELKAEYLLFECLQD TGG++ FF AC+SYI+DI+   +RTKR+A+LDG+FP GF MG+  SGIIK+K+GF   F+L +  +  S+ Y IFF+K+  +      + Q++    +S    A ++ +K  +  +F I + ++   S  K+R ++ +  +L L   F++E+FL  GKG  ++LY R++F W    F  F+  +G+ G+ +Q+  +PF+S +LKW D  I L+ + G I       FT   +++LVYV GI+SFL  +IST  RS+I+K I   EIGKVFSV+A+ QA++ ++ASP Y  +YK T+  FPG+  L ++CLY ++ FL     + ++K   + K 
Sbjct:   51 RGCLSGITVEPCLFFFALSQGLYVIIAQNLYIAKVCNVNFNFTREICDDILNNKDEQLVVQRKVSELQAYNGILQAIPSIVYALFAGPWSDQYGRKLLIVWSCFGFIFNNGVFIINTYWFYELKAEYLLFECLQDLTGGWIVFFLACYSYISDISTRENRTKRLAYLDGLFPAGFFMGMAASGIIKEKIGFYGNFTLGMFFALLSMFYAIFFLKDSRTMRPPEVQKQIERMQKHSGEAQAQSQ-EKGLLSSLFDIDNVKSAFASVFKKRSNNARSIMLLLGSCFLIEMFLITGKGPTLYLYYRRKFSWDAKTFGMFIGFYGLLGMFAQFVAVPFISKRLKWSDSRIALLGISGTIGQFVLVCFTPITMTYLVYVGGIISFLSVSISTAYRSMITKQIGPLEIGKVFSVLAAFQAMMPLLASPAYGFIYKRTVATFPGVFLLCSACLYVVMVFLLALANWRMRKAGGADKE 1457          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592913554|gb|GAXK01044821.1| (TSA: Calanus finmarchicus comp308449_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 326.25 bits (835), Expect = 7.349e-104
Identity = 181/468 (38.68%), Postives = 284/468 (60.68%), Query Frame = 0
Query:    4 IWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKN 471
            +  K    + +I+LEPV FLF ++ GL  I+ Q LY++K C VNLN++  +C +I+   EIQ E Q++VS++QAYN  LQ  PA++++LFAGP SD  GRK +I+ + FGY   N+++L+N+++FFELK EYLLFECLQD TGG + F+ AC+SY+ DIT   +RT+R++ LD   PIGF++GL     IK   G    +S+A   +  +++Y  F +K+   + D+    +   T         K+    +FKI     G+++ +K+R    +++++  +LIF L   +  G G + +++ R ++K  +   S    +F I   +SQ  V+PFLS  L+ RD TI+L AV  NIIA  +  F N  W++Y+A  +  L   I+T  RS +SK ++S EIGK FSV+   QA+  M   P +S +Y+ATL+ FPG   ++++ LY IV  L I+ + GLK+++    N
Sbjct:   71 LLNKVSEAVTHISLEPVFFLFCVNLGLIGISTQGLYLNKACLVNLNYTEEVCSNIHNQTEIQKETQRFVSEIQAYNGMLQSAPAIVFTLFAGPLSDTYGRKPLIISALFGYFVLNIVFLVNSIWFFELKVEYLLFECLQDLTGGAICFYLACYSYMVDITTPETRTRRLSILDSFMPIGFIVGLPFGTFIKNNHGLVVLYSIAAGITCIAMVYVFFVVKDSRKNFDEEKKQEVKDTKSDVVLGCNKDFFPGLFKIMI--VGIQTIVKKRPDGARRWVICFVLIFCLSKGIDSGAGGLSYMFYRLQYKIDDTIQSNLSSLFTILMFISQIAVVPFLSGYLRCRDTTILLAAVLFNIIAQLIVAFNNKIWVLYIAYGLWMLFNTITTTCRSNLSKLMDSTEIGKAFSVLGIIQALFPMATKPAFSFLYRATLETFPGTYRVLSAGLYCIVLGLLIFTHVGLKRMDARVAN 1468          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592790734|gb|GAXK01163834.1| (TSA: Calanus finmarchicus comp383868_c1_seq3 transcribed RNA sequence)

HSP 1 Score: 294.664 bits (753), Expect = 8.993e-92
Identity = 168/472 (35.59%), Postives = 279/472 (59.11%), Query Frame = 0
Query:    2 TSIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKER----NSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVA-GIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENS 468
            + +W     + +NIT+EPVV ++ L   L  I  + LY+ K C VNLNHS+ ICD+IY HE  Q E QK VS +Q+++  LQG+P +I++LFAGP SD  GRK +I++  FGY   N +YL+N+++F +LK E+LLFECLQD TGG + FF A   YI DIT + +RT RMA  D  + +G+L+GL +   IKK+ G+   FS+ +     +++Y   F+K+     ++ + +V + +        +  V K  I+KM  I  FQ    +  K+R +  + +++ ++L+F++   +  G G V F++ R ++K +   +   + ++ +    SQ  V+PFLS  LK+RD TI+++ +   ++  F   F +  W ++V   +   L   I T  RS +SK ++  EIGK FSV+   +A + ++A P Y L+Y+A+LD F G+  L+++ +  +   +AI L+FG+K+ +  
Sbjct:  128 SKVWIFACNVWNNITVEPVVAMYCLILALSGIPGEELYLKKACKVNLNHSMEICDNIYDHEAAQIETQKLVSGVQSHSAVLQGVPGIIFTLFAGPISDTYGRKPLIIIPLFGYFILNTVYLVNSIWFHQLKVEFLLFECLQDLTGGSIVFFLATKCYIVDITSEENRTTRMAVTDAFYGVGYLIGLPIGTYIKKEFGYVPLFSITLGLVICAMIYAAVFLKDSYQLISAEQKKVFDAEREENQLKCDRGVFKS-IFKM-TISSFQ----TVFKKRPNKDRLWIILMVLVFIIPTIINAGYGIVGFMFYRLQYKISTEMYGHLISMWFVVNFFSQMVVLPFLSKTLKFRDTTIMILGLAPALVGFFGEAFFSDVWALFVIWSVFYLLYFNIFTTTRSAMSKLMDPTEIGKAFSVLGVLEACLALVAKPFYGLLYQASLDIFAGMWILISNGILLVALIIAIALHFGMKRSQEE 1525          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592790735|gb|GAXK01163833.1| (TSA: Calanus finmarchicus comp383868_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 285.804 bits (730), Expect = 2.429e-88
Identity = 167/481 (34.72%), Postives = 281/481 (58.42%), Query Frame = 0
Query:    2 TSIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKER----NSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFL--GAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKK-----VENSRKN 471
            + +W     + +NIT+EPVV ++ L   L  I  + LY+ K C VNLNHS+ ICD+IY HE  Q E QK VS +Q+++  LQG+P +I++LFAGP SD  GRK +I++  FGY   N +YL+N+++F +LK E+LLFECLQD TGG + FF A   YI DIT + +RT RMA  D  + +G+L+GL +   IKK+ G+   FS+ +     +++Y   F+K+     ++ + +V + +        +  V K  I+KM  I  FQ    +  K+R +  + +++ ++L+F++   +  G G V F++ R ++K +   +   + ++ +    SQ  V+P LS  ++ RD TII++++  +++   +  F + +W +++   V FL      ST  RS +SK ++  EIGK FSV+   ++ + ++A PIY  +Y+++L  FPGL F+V++ +      +A  L+ G+K       EN  +N
Sbjct:  128 SKVWIFACNVWNNITVEPVVAMYCLILALSGIPGEELYLKKACKVNLNHSMEICDNIYDHEAAQIETQKLVSGVQSHSAVLQGVPGIIFTLFAGPISDTYGRKPLIIIPLFGYFILNTVYLVNSIWFHQLKVEFLLFECLQDLTGGSIVFFLATKCYIVDITSEENRTTRMAVTDAFYGVGYLIGLPIGTYIKKEFGYVPLFSITLGLVICAMIYAAVFLKDSYQLISAEQKKVFDAEREENQLKCDRGVFKS-IFKM-TISSFQ----TVFKKRPNKDRLWIILMVLVFIIPTIINAGYGIVGFMFYRLQYKISTEMYGHLISMWFVVNFFSQMVVLPLLSKTMQLRDTTIIILSLSFSLVGYSVEAFLSDAWTLFLVWFVFFLLYNNMFST-TRSAMSKLLDPTEIGKAFSVLGVLESCLALLAKPIYGFIYQSSLHIFPGLWFMVSNGVLLTALIIAFILHVGMKNSQEQLAENGEEN 1549          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592839976|gb|GAXK01117568.1| (TSA: Calanus finmarchicus comp607424_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 280.026 bits (715), Expect = 1.342e-86
Identity = 166/483 (34.37%), Postives = 271/483 (56.11%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFT--YCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMF--KIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKK---------VENSRKNA 472
            ++ ++ + +  NITLEPV FLF  + G+   T Q LY+ K C VNLN + ++C++I  H +IQ   QKYVS++QAYN  LQ LPAV+++L+AGP SD  GRK +I++S  GY   N+++L+N+ +F+ELK EYLLFECLQD TGG + F    +S + DIT +++RTKRMA LD    +G  +G    GIIKK  G+T  Y  S+A++     ILY +FFIKE   ++ +  +  +N    +          W  F   ++   +G KS  K+R    + +++  +    ++ F   G   +  ++ + ++     D S  M+ F +  ++SQ  ++P LS +LK+RD TII+ A+  +II   +F  +     + +  +     A I+T  RS ++K +   EIG V  ++   Q+++ +++ P Y  +YK+T+  FP     V+  L+S+     I  + GLKK         +EN+ + A
Sbjct:   41 ALCERVKNVFRNITLEPVYFLFMAAMGMTVFTSQELYLMKACKVNLNFTESLCENINNHTDIQIATQKYVSEIQAYNGILQSLPAVVFTLYAGPLSDKYGRKPLILVSFAGYFLLNLVFLVNSYWFYELKVEYLLFECLQDVTGGEIVFGLGMYSLMADITTEANRTKRMAVLDAFKFVGIAIGFVSGGIIKKMFGWTPLYLTSMALIV--IDILYVMFFIKESRMTKQKDQSEKENKGDLTC---------WDQFCGLVKLSLSGFKSLFKQRPSGGRIWIISFVFTMNIQRFAESGGSVINLMFFKIQYNADMADISYLMMFFSLLTIISQLVIVPVLSGRLKFRDTTIIIFAMSTSIIGYLIFALSYDLTFLLLGYVFWAFYANITTTSRSCLTKLVNPSEIGSVLGIVGIFQSLLSIVSKPFYGFLYKSTVAVFPATYLFVSISLFSVALVTLIVAHVGLKKRQGEMEALQLENANEKA 1456          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592790736|gb|GAXK01163832.1| (TSA: Calanus finmarchicus comp383868_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 280.796 bits (717), Expect = 1.838e-86
Identity = 163/477 (34.17%), Postives = 271/477 (56.81%), Query Frame = 0
Query:    2 TSIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFL--GAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKK-----VENSRKN 471
            + +W     + +NIT+EPVV ++ L   L  I  + LY+ K C VNLNHS+ ICD+IY HE  Q E QK VS +Q+++  LQG+P +I++LFAGP SD  GRK +I++  FGY   N +YL+N+++F +LK E+LLFECLQD TGG + FF A   +I DIT    RT R+A LD  + +G+L+G      IKK+ G+   FSL +  S  +++Y   FI++      +      NS   +   K  +     +F +    +  KS  K+R +  + +++ ++L+F +   +  G G + F++ R ++K +   +   +  + +    SQ  V+P LS  ++ RD TII++++  +++   +  F + +W +++   V FL      ST  RS +SK ++  EIGK FSV+   ++ + ++A PIY  +Y+++L  FPGL F+V++ +      +A  L+ G+K       EN  +N
Sbjct:  128 SKVWIFACNVWNNITVEPVVAMYCLILALSGIPGEELYLKKACKVNLNHSMEICDNIYDHEAAQIETQKLVSGVQSHSAVLQGVPGIIFTLFAGPISDTYGRKPLIIIPLFGYFILNTVYLVNSIWFHQLKVEFLLFECLQDLTGGTIVFFLATKCFIVDITSVEKRTTRLAVLDAFYGVGYLIGFPTGTFIKKQFGYVPLFSLTLGLSIFAMIYVAVFIQDSYHLSTEEHKIVFNSEQAANRLKCDRGVFRSIFNLT--ISSFKSLFKKRSNSDRLWIILMVLVFSISTIVRAGYGLLGFMFFRLQYKISTEMYGHLVSYWYVVNFFSQMVVLPLLSKTMQLRDTTIIILSLSFSLVGYSVEAFLSDAWTLFLVWFVFFLLYNNMFST-TRSAMSKLLDPTEIGKAFSVLGVLESCLALLAKPIYGFIYQSSLHIFPGLWFMVSNGVLLTALIIAFILHVGMKNSQEQLAENGEEN 1549          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592942902|gb|GAXK01015651.1| (TSA: Calanus finmarchicus comp504837_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 264.233 bits (674), Expect = 1.602e-79
Identity = 159/465 (34.19%), Postives = 260/465 (55.91%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANN--KVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENS 468
             K + +L +I LEPV FL  +  GL  +T Q LY+ K C VNLN ++  C++I  H  +Q   Q+YVS++QAYN  LQ +P ++ + FAGP SD  GRK +IV S FG++  ++++L+N+ +F ELK EYLLFECLQD TGG + F    +S + DIT   +RT+R+A LD  F +G  +GL LSGII+   G+   F  + +    +ILY IF I+E N  ED +   D     QS      + K P+           G KS  +++    + ++   ++   ++ F   G   ++F++L+ R+     D +   +VFG+  +++Q  ++P LS K ++RD +I++I +  +II   +    +   ++ ++     L  +I++  RS ++K ++  +IG +F +       + +++ P YSLVY+AT+  FP     +T  L  IV  L I  + G+KKVE S
Sbjct:  355 NKLKTMLSSIVLEPVAFLLMVFVGLIMLTSQELYLMKACKVNLNFTVAECENINNHSHVQIATQQYVSEIQAYNGVLQSVPGIVLAFFAGPLSDKFGRKPLIVFSLFGFLILSLVFLINSFWFDELKVEYLLFECLQDITGGEIVFGVGINSLMVDITTRENRTRRIAVLDTFFLLGLAVGLQLSGIIRHFFGWVPLFITSSLVLVLNILYVIFKIEESNKVEDDLPIKDKTKVEQSKATFLHMMKAPVL----------GFKSVWRKKPDGSRIWVFVFMMTMTIQKFGDIGSQGLLFMFLKLRYNAEITDVTNIALVFGLMMMINQLGLVPLLSGKFQFRDTSILIIGMSTSIIGCIILAIGDNLNIILLSCFFGSLYISINSTARSAMTKLVDPADIGSLFGMCGIIFVALSLVSKPFYSLVYRATVQTFPAAFLYLTLGLLVIVLVLIISAHVGMKKVEES 1719          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592776967|gb|GAXK01177601.1| (TSA: Calanus finmarchicus comp279172_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 259.996 bits (663), Expect = 2.436e-79
Identity = 145/347 (41.79%), Postives = 220/347 (63.40%), Query Frame = 0
Query:  120 IYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFM--FTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKK 464
            ++L+NT +F+ELKAEYLLFECLQD TGGYV FF AC++YI+DI+   +RTKR+AFLDG+FP GF  G+ +SGIIK+ LGF   F L +  +  ++ Y IFF+K+  +           +  + A+ +  K      F IQ+  +  K+  K+R+++++KY++ LI  F+LE+FL  GKG   +LY R++F W    F  ++  +GI G+ +QY  IP+LS  L   D TI LIA+ G I+   +  FT   +++L+Y+ G+ SFL   I+T  RSLI+KC+   E+G VFSV+ + QA++ + ASP Y  +YK T+  FPG+  L ++ LY IV  L   +  G+++
Sbjct:    5 VFLINTYWFYELKAEYLLFECLQDCTGGYVVFFLACYAYISDISTKETRTKRLAFLDGLFPAGFFSGMAVSGIIKEHLGFYGNFFLGMFFALLAMFYAIFFLKDSRTMRPPEVLKQIEAMKRPADLEETKGQFASFFNIQNVISAFKTVFKKRDNNIRKYIMLLIGSFILEIFLINGKGPTQYLYFRRKFNWNAKTFGSYVGFYGILGMFAQYVAIPYLSGNLHLHDTTIALIAICGVIVQHIIACFTPITMTYLIYIGGVFSFLSVCITTTCRSLITKCVSPLEVGAVFSVMGAFQAMVPLAASPTYGFIYKQTVATFPGVFLLFSAGLYVIVMMLLFAVNTGMRR 1045          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592913553|gb|GAXK01044822.1| (TSA: Calanus finmarchicus comp308449_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 256.529 bits (654), Expect = 5.667e-79
Identity = 138/357 (38.66%), Postives = 218/357 (61.06%), Query Frame = 0
Query:    4 IWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIA 360
            +  K    + +I+LEPV FLF ++ GL  I+ Q LY++K C VNLN++  +C +I+   EIQ E Q++VS++QAYN  LQ  PA++++LFAGP SD  GRK +I+ + FGY   N+++L+N+++FFELK EYLLFECLQD TGG + F+ AC+SY+ DIT   +RT+R++ LD   PIGF++GL     IK   G    +S+A   +  +++Y  F +K+   + D+    +   T         K+    +FKI     G+++ +K+R    +++++  +LIF L   +  G G + +++ R ++K  +   S    +F I   +SQ  V+PFLS  L+ RD TI+L AV  +IIA
Sbjct:   71 LLNKVSEAVTHISLEPVFFLFCVNLGLIGISTQGLYLNKACLVNLNYTEEVCSNIHNQTEIQKETQRFVSEIQAYNGMLQSAPAIVFTLFAGPLSDTYGRKPLIISALFGYFVLNIVFLVNSIWFFELKVEYLLFECLQDLTGGAICFYLACYSYMVDITTPETRTRRLSILDSFMPIGFIVGLPFGTFIKNNHGLVVLYSIAAGITCIAMVYVFFVVKDSRKNFDEEKKQEVKDTKSDVVLGCNKDFFPGLFKIMI--VGIQTIVKKRPDGARRWVICFVLIFCLSKGIDSGAGGLSYMFYRLQYKIDDTIQSNLSSLFTILMFISQIAVVPFLSGYLRCRDTTILLTAVLFHIIA 1135          
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Match: gi|592942903|gb|GAXK01015650.1| (TSA: Calanus finmarchicus comp504837_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 264.233 bits (674), Expect = 5.774e-79
Identity = 159/465 (34.19%), Postives = 260/465 (55.91%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANN--KVKKEPIWKMFKIQHFQAGVKSTLKRREHDXXXXXXXXXXXXXXXXXXXGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENS 468
             K + +L +I LEPV FL  +  GL  +T Q LY+ K C VNLN ++  C++I  H  +Q   Q+YVS++QAYN  LQ +P ++ + FAGP SD  GRK +IV S FG++  ++++L+N+ +F ELK EYLLFECLQD TGG + F    +S + DIT   +RT+R+A LD  F +G  +GL LSGII+   G+   F  + +    +ILY IF I+E N  ED +   D     QS      + K P+           G KS  +++    + ++   ++   ++ F   G   ++F++L+ R+     D +   +VFG+  +++Q  ++P LS K ++RD +I++I +  +II   +    +   ++ ++     L  +I++  RS ++K ++  +IG +F +       + +++ P YSLVY+AT+  FP     +T  L  IV  L I  + G+KKVE S
Sbjct:  542 NKLKTMLSSIVLEPVAFLLMVFVGLIMLTSQELYLMKACKVNLNFTVAECENINNHSHVQIATQQYVSEIQAYNGVLQSVPGIVLAFFAGPLSDKFGRKPLIVFSLFGFLILSLVFLINSFWFDELKVEYLLFECLQDITGGEIVFGVGINSLMVDITTRENRTRRIAVLDTFFLLGLAVGLQLSGIIRHFFGWVPLFITSSLVLVLNILYVIFKIEESNKVEDDLPIKDKTKVEQSKATFLHMMKAPVL----------GFKSVWRKKPDGSRIWVFVFMMTMTIQKFGDIGSQGLLFMFLKLRYNAEITDVTNIALVFGLMMMINQLGLVPLLSGKFQFRDTSILIIGMSTSIIGCIILAIGDNLNIILLSCFFGSLYISINSTARSAMTKLVDPADIGSLFGMCGIIFVALSLVSKPFYSLVYRATVQTFPAAFLYLTLGLLVIVLVLIISAHVGMKKVEES 1906          
BLAST of EMLSAG00000003292 vs. L. salmonis peptides
Match: EMLSAP00000003292 (pep:novel supercontig:LSalAtl2s:LSalAtl2s180:493171:494827:-1 gene:EMLSAG00000003292 transcript:EMLSAT00000003292 description:"maker-LSalAtl2s180-augustus-gene-4.19")

HSP 1 Score: 984.171 bits (2543), Expect = 0.000e+0
Identity = 484/484 (100.00%), Postives = 484/484 (100.00%), Query Frame = 0
Query:    1 MTSIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELLNRN 484
            MTSIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELLNRN
Sbjct:    1 MTSIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELLNRN 484          
BLAST of EMLSAG00000003292 vs. L. salmonis peptides
Match: EMLSAP00000002356 (pep:novel supercontig:LSalAtl2s:LSalAtl2s144:172548:174259:-1 gene:EMLSAG00000002356 transcript:EMLSAT00000002356 description:"maker-LSalAtl2s144-snap-gene-1.24")

HSP 1 Score: 323.168 bits (827), Expect = 1.058e-105
Identity = 171/415 (41.20%), Postives = 256/415 (61.69%), Query Frame = 0
Query:   69 QKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE-RNSSEDQVDNTDDNSTTQSANN--KVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEEL 480
            QK VS LQAYN  LQG+P V Y+LFAGPWSD NGR+ +++LS F Y                                          SYI+DITD  +RTKR+AFLDG+FP+G+ +G+ LSG+IK KLGF Y F   +  +  S+ Y IFF+K+ +     +V  +++  T     +     K     +F +Q+ +   + T K R +  +KYL+ L++ F++E+FL  GKG +MFLYLRK+FKW E+ F Q+  +FG  GL +QY V+PFL ++LK  D TI +IA+ G I+   +  +A V WL+Y AGI++FLG  I+T+ RSL++KC+   E+GKVFSV+A+ QA++ ++ASP+YS +YK+T++ FPG   L T+ +Y+++  + I +YFGLK++E   K A+E +  E+
Sbjct:    1 QKDVSTLQAYNGILQGIPPVFYALFAGPWSDKNGRRVLMMLSIFAY------------------------------------------SYISDITDVKTRTKRLAFLDGLFPVGWFIGMALSGVIKNKLGFLYNFGGGLTLALCSLFYVIFFVKDSQQMRPKEVTESEEYKTHLKERDLSHKNKNICQSIFDVQNVKEAFQCTFKERPYGKRKYLVLLVVCFVIEIFLMNGKGPIMFLYLRKQFKWDEVLFGQYSAIFGFLGLATQYVVVPFLINRLKLHDSTIAIIAIAGCIVQQIIAAYAKVDWLLYFAGIIAFLGVCITTVSRSLVTKCVSPFEVGKVFSVMAACQALVPLVASPVYSFMYKSTIETFPGAFLLFTAGIYTVLINIFIVVYFGLKEIE--AKEANEKKTAEM 371          
BLAST of EMLSAG00000003292 vs. L. salmonis peptides
Match: EMLSAP00000006022 (pep:novel supercontig:LSalAtl2s:LSalAtl2s327:123273:124660:1 gene:EMLSAG00000006022 transcript:EMLSAT00000006022 description:"augustus_masked-LSalAtl2s327-processed-gene-1.0")

HSP 1 Score: 208.764 bits (530), Expect = 3.242e-61
Identity = 140/461 (30.37%), Postives = 240/461 (52.06%), Query Frame = 0
Query:   15 ITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTY-CFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFL-AIYLYFGLKKVENSRKNAH 473
            IT+EPV   +G+   + S+    L+I KVC V+LN+S  IC ++ Q++EI+ EVQ+ V++L+  +  L  +PAV++SLF G WSD NGRK +++L   G +   ++Y+LN  FFFEL    LL+       GGYV         I D +  +SRT R+++L+GI  + F++G  + G +   +   Y  F ++I      I+Y+IFF+KE    +++ + T+                   +F + H +   K+  K R     ++ + ++++    +          +L +  +F W   DFS F+IV  I   V    ++P LS     RD  I L       ++  +      S L++VA +  F  + ++  +RS  +K    +E+GKVF+VIA GQ+++ ++++P++ LVY+ TL  FPG  +L+  C + +V  + A YLY         R+N+H
Sbjct:    5 ITVEPVQLFYGIMAMVSSVVRDHLFIEKVCQVHLNYSSNICSNLSQNKEIKDEVQEIVTELEIIDGTLVAIPAVVFSLFMGSWSDRNGRKFLLILPFIGNIIAFLVYILNYYFFFELGIYNLLWGSSVGMFGGYVCLNIGXXGXIADXSTITSRTTRLSYLNGITSLSFVIGSAIGGQLFNAMHNYYIIFGISIGFGILGIIYSIFFVKESIIPKEESEETNRG-----------------LFDLYHVKECFKTATKDRSTFYPRFGVIILVLHFASMMFCLNTSHYDYLLMVNKFDWGVHDFSNFLIVTRIVRFVGLLLLLPLLSSVFHIRDEAITLFGTILTCLSYLIIALGQSSILMFVAVVFQF-NSIVTVSIRSQCTKATSPEEVGKVFAVIALGQSLVPLVSNPLFGLVYRETLTTFPG-AYLIIVCAFLLVACVGAAYLY------NFKRRNSH 440          
BLAST of EMLSAG00000003292 vs. L. salmonis peptides
Match: EMLSAP00000003464 (pep:novel supercontig:LSalAtl2s:LSalAtl2s18:1125769:1129987:1 gene:EMLSAG00000003464 transcript:EMLSAT00000003464 description:"snap_masked-LSalAtl2s18-processed-gene-11.9")

HSP 1 Score: 106.686 bits (265), Expect = 1.658e-25
Identity = 78/293 (26.62%), Postives = 141/293 (48.12%), Query Frame = 0
Query:  154 ACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLY-GGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFA---NVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFL 442
            A  SYITDI+    R  R++ +DG   IG  +G   SG++ KK+G+   FS++I    +S +Y +F I       D   N    +   S    + KE               ++  K+R      +LL      M+ +FLY    G  ++ Y    ++W+E  +S F  VF     +  Y V PF  HK+   D T+ ++    + +   +  ++   N+  + Y+ G++   G+    ++RS ISK    + IGK+F+VI   +A++ +++S +++ +Y  T+D +PG +F+
Sbjct:   97 ATFSYITDISSVEQRNLRVSLIDGSLFIGLPLGSIFSGMMLKKIGYVGIFSISIAFMATSFIYVLFRIN------DSRSNLSVETEGSSGLTSILKET-------------YRAVFKKRPERTASFLL------MISMFLYVSCNGINVYYYTIVMYQWSEEMYSYFFSVFVFVDGIFSYIVYPFFMHKVHASDPTLGIVGELVSFVKSLILVYSFNTNIFIIGYIFGVI---GSYTGVVIRSTISKISPKENIGKIFAVIGFLEALVPIVSSAVFTYIYNNTVDIYPGWIFM 361          
BLAST of EMLSAG00000003292 vs. L. salmonis peptides
Match: EMLSAP00000001206 (pep:novel supercontig:LSalAtl2s:LSalAtl2s11:1153615:1160710:-1 gene:EMLSAG00000001206 transcript:EMLSAT00000001206 description:"maker-LSalAtl2s11-augustus-gene-12.19")

HSP 1 Score: 75.485 bits (184), Expect = 6.675e-15
Identity = 91/435 (20.92%), Postives = 180/435 (41.38%), Query Frame = 0
Query:   38 LYISKVCAVNLNHSLTICDDIYQ--HEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAE-YLLFECLQ-DFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSS-ILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTS--CLYSIVGFLAIYLYFGLKKV 465
            + I K C ++LN++  +CD++    +E+   +VQ  VS                         D  GRK I+ +     V +  + + N  F  E     Y+L   +     GG    F A  ++ITDI+       R+  L     I   +   +   +    GF   +    + S ++ +   +  +K + +  ++                 +K+   ++   + F    K+  K R   L+  L   ++  +L L    G+ ++ +LY+R R+KW   DFS +  +  +  +  Q  +IP LS+     +  +I I +    +       A   WL Y   ++  +G+   +++R+ IS  +   E+GKV S++ S + ++ +I+  IY  ++  T    PG V+ V++  C +++V  L I  +   K +
Sbjct:    1 MQIYKACRIDLNYTSQLCDNLLDDGNEDYNKKVQDTVSLFMV---------------------DAIGRKTILNVHALATVLSQALLIANGYFLVEWSNYIYILTVSVPIMLVGGKSTSFIATTAFITDISPPRMAXVRLGILHVTQSISEPLANIVGAFLLDSGGFVVVYLFGFIFSAAAYVSLYVCMMKYKTTITEK-----------------RKKSFRELMSPRIFIDCFKTFSKVRAGKLRMILYLSLVNLILILTSIIGEATIAYLYVRTRYKWEXTDFSFYKSIDKVTAIFFQSALIPLLSYVNINNENFLICIIISF-CLRHLTMGLAYEPWLYYAGTMLDVIGSYAFSIIRATISDILPKSEMGKVLSMVISLENIMIIISIKIYQTIWSMTDTILPGTVYFVSAFMCSWALVSTLIIKFHLKGKSI 396          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|81170641|sp|Q7ZWG6.1|PCFT_DANRE (RecName: Full=Proton-coupled folate transporter; AltName: Full=Heme carrier protein 1; AltName: Full=PCFT/HCP1; AltName: Full=Solute carrier family 46 member 1)

HSP 1 Score: 109.768 bits (273), Expect = 1.101e-24
Identity = 109/467 (23.34%), Postives = 201/467 (43.04%), Query Frame = 0
Query:   14 NITLEPVVFLFGLSHGLYS-ITVQSLYISKVCAVNLNHSLTI-CDDIYQHEEIQTEVQKYVSQLQAY---NFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKA-EYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYF--VIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKN 471
            ++T+EPV+FL   S  L + +  Q L+      V  N + T  C+    H+ +QTEV+   +    Y     FL GL  VI     G WSD  GR+ ++++   G      +YL  TV + +L    +L+       +G + A    C +Y+ D ++  SRT R+A L+    +  +    + G  ++  G+   F L + T+ ++ LY   F+ E                       V  +P  ++F  +H QA  +          +  L   IL F L + ++ G   +  LY L     W        +I +G       Y   +    + +    D  + L+ +  N++   + + A+ + L++    + FL  A + +LRS +SK ++  E G +F+ +A  + +  +++S +++ +Y ATL F  G  F+  + +  I     I    G ++   SR+N
Sbjct:   42 SVTVEPVMFLSTFSIVLQAPLCTQYLWDRLSEDVGYNGTKTGGCNASTVHDPLQTEVETLTAHWSLYINLGGFLVGLFMVI---LLGSWSDRAGRRLVLIIPSLGLAVQAAVYL--TVMYLKLPVFWFLIGRICSGLSGDFNAILAGCFAYVADTSERGSRTFRVAILEACLGLAGMFASIIGGQWRRAQGYINPFWLVLATNLTAALYAYLFVPE----------------------TVTPDPQARLFSTRHHQAVCRLYSSDAPPGRRSKLWLYILCFFLVVTVHLGCSDLYVLYELSAPLCW-----GPELIGYGSAAKHLAYLTSLTGLRAMQCCLEDSWVALVGLTSNMVGLVVISVADTTALMFTGYGLCFLFMASTPVLRSKLSKLVDPAEQGALFASVACVEGLCSLVSSGVFNALYPATLHFMKGFPFVFGAAILLIPA--GIIGGLGCQEKRESREN 474          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|81170644|sp|Q6DCX5.1|PCFT_XENLA (RecName: Full=Proton-coupled folate transporter; AltName: Full=Heme carrier protein 1; AltName: Full=PCFT/HCP1; AltName: Full=Solute carrier family 46 member 1)

HSP 1 Score: 101.293 bits (251), Expect = 7.282e-22
Identity = 104/451 (23.06%), Postives = 194/451 (43.02%), Query Frame = 0
Query:    6 KKTRYILD-NITLEPVVFLFGLSHGLY-SITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFA----GPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLF-ECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSH-------KLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVF 441
            +  R +L  ++T+EPV+FL   +  L   +  Q L+      +  N + T+   +   +    E Q+ V  L A+      L   +  LF+    GPWSD  GR+ +++L C G      +YLL  V + EL   Y L    +   +G +      C +YI D++D  SRT R+A L+    I  ++   + G  +K  G+   F L    +  + LY  F ++E                       VK +   ++F  +H+Q+  +    + E++ ++ L    L  ++ + ++ G  ++  LY L     W             + G  S    + +LS        +L   D  +  +    NI    + + A+ + +++    + F   A + ++RS +SK +E  E G +FS +A  + + F++A+ +++ +Y ATL F  G  F
Sbjct:   15 RPRRCLLPASVTVEPVIFLSMFALALQGPLATQYLWDRLSADIGFNGTRTVGCAMNGSKSAGPE-QQEVETLTAHWSLYINLGGFLVGLFSVMLLGPWSDKVGRRPVLMLPCIGLALQAAVYLL--VMYQELHVGYFLIGRFISGISGDFNMILAGCFAYIADVSDRQSRTFRVAVLEACLGIAGMVASIIGGHWRKAQGYINPFWLVFAVNLFTALYVYFCVEE----------------------SVKDKKPARLFTHRHYQSFFRLFTVQGENNRRRKLFLYSLALLVVVTVHMGAKNLFVLYELSYPLCWDS----------DLIGYGSAAEHLTYLSSLAGLRLFQLCLADSWVAEMGFISNISGLVVISLASTTPIMFTGYGLRFFAMATTPVIRSKLSKMVEEGEQGALFSSVACVEGLSFLLATGLFNSLYPATLHFMKGFPF 430          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|82125466|sp|Q5F4B8.1|S46A3_CHICK (RecName: Full=Solute carrier family 46 member 3; Flags: Precursor)

HSP 1 Score: 94.7449 bits (234), Expect = 1.079e-19
Identity = 121/450 (26.89%), Postives = 197/450 (43.78%), Query Frame = 0
Query:   17 LEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQ---LQAYNFF-----LQG-LPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL------LFECLQDFTGGYVAFFF-ACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGL-GLS-GIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCL 447
            +EPV+F++  +  L S  VQ     K+     N S  I  D   H E       YV +    +  +FF     L G +P++I +       D  GRK  +VL   G +  ++   + + F +     +L      LF  +  F GG  A+    CH       D+  +T R+A +D IF  G + GL GLS G   +++GFT+ F+ A +    +I+Y  FF++          +T   S  Q       KE + + F      +GV    K      +  ++ L+ IFM  LF   G  S+  LY L +   WTE+        F    L S +  +   S  LK  D  I+ I +   I    M  FA  + L+++  + S        +LRS++SK +   E G VF+ IA  + +   I+  +++++Y AT+ +F G  FL+++ L
Sbjct:    7 VEPVIFIYIFASSLTSPVVQQFIYRKLWEEEYN-STAISSDNSSHCERNKSSPTYVMEKAIQEKTSFFNMQLDLTGAVPSLIVAFIIVANGDHQGRKKSLVLPSIGALIADIFLTIVSYFSWPTSVLFLATFISGLFGSMATFLGGGFAYIADQCH-------DEKQKTTRIAVIDLIF--GVVSGLAGLSSGYFLREMGFTWTFATASLLHVVNIIYITFFLQ----------DTVHISEFQQQAPLSYKEHLKETF------SGVYMLFKTAPSKKRILIIVLLFIFMTYLFTMFGGSSLFTLYELDEPLCWTEVYIGYGAAAFTSISLTS-FLGVYLFSKCLK--DIYIVFIGIFSYIGGIVMAAFAKTTLLMFLVRVPSLFSIMPIPVLRSMLSKVVLPSEQGAVFACIACLEVLTGTISLSVFNVIYAATVAWFSGFSFLLSASL 427          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|81882604|sp|Q5BK75.1|S46A3_RAT (RecName: Full=Solute carrier family 46 member 3; Flags: Precursor)

HSP 1 Score: 92.0485 bits (227), Expect = 9.503e-19
Identity = 114/446 (25.56%), Postives = 208/446 (46.64%), Query Frame = 0
Query:   17 LEPVVFLFGLSHGL-YSITVQSLYISKVCAVNLNHSLTICDDIYQHEE--------IQTEVQKYVSQLQAYNFFLQGL-PAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFEC-LQDFTGGYVAFFFACHSYITDITDD-SSRTKRMAFLDGIFPIGFLMGL-GLS-GIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCL 447
            +EP + L+  +  L   +T Q +Y  ++     N++ T   ++ + E+         Q EVQK  S L +    + GL P ++ +      SD +GRK  +VLS  G +  N+   L  + +F+L  + L+    +    G Y  F+ AC +YI D   +   R  R+A LD  F +G + GL GLS G   ++LGF + + +  V    ++ Y +FF+       D +  +     T S +  +K +  ++ + +  F+ G   + KRR       L  LI   ++  F+  G   V  LY L     W E+ +  +    G    +S +  I   S+ LK  D  I  + +   ++   +  F   + ++++  I  F      ++LRS++SK + S E G +F+ IA  + +  + ++  Y+ +Y AT+ ++PG VFL+++ L
Sbjct:    6 IEPAILLYAFAMTLTIPLTAQYVY-RRIWEETGNYTFTSSSNVSECEQNKSSSTFAFQEEVQKKAS-LFSLQVEISGLIPGLVSTFMLLSSSDNHGRKLPMVLSSLGSLGTNL--WLCAMSYFDLPLQLLVASTFIGALFGNYTTFWGACFAYIVDQEKEYKHRIIRIAVLD--FMLGVVTGLTGLSSGYFIRELGFAWSYFIIAVVVLVNLAYILFFLS------DPIKESSSQIVTMSCSESLK-DLFYRTYML--FKNG---SCKRR-----SLLCLLIFTLVVYFFVVFGITPVFTLYELGPPLCWNEV-YIGYGSALGSLSFLSSFLGIWLFSYCLK--DIHIAYVGIFTTMVGMMLTAFTRTTLMMFLVRISFFFTIMPLSILRSMLSKVVHSTEQGVLFACIAFLETLGGVTSTSAYNGIYSATVAWYPGFVFLLSAGL 425          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|81906124|sp|Q9DC26.1|S46A3_MOUSE (RecName: Full=Solute carrier family 46 member 3; Flags: Precursor)

HSP 1 Score: 80.1073 bits (196), Expect = 7.450e-15
Identity = 93/392 (23.72%), Postives = 175/392 (44.64%), Query Frame = 0
Query:   61 HEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFEC-LQDFTGGYVAFFFACHSYITDITDD-SSRTKRMAFLDGIFPIGFLMGL-GLS-GIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCL 447
             EE+Q +   +  Q++        +P ++ +      SD +GRK  +VLS  G +  N    L  + +F+L  + L+    +    G Y  F+ AC +YI D   +   R  R+A LD  F +G + GL GLS G   ++LGF + + +  +    ++ Y +FF+       D +  +     T S    +K +  ++ + +           K      +  L  LI   ++  F+  G   +  LY L     W E+ +  +    G    +S +  I   S+ LK  D  I  I +   ++   +  F   + ++++  I         ++LRS++SK + S E G +F+ IA  + +  + ++  YS +Y AT+ ++PG +FL+++ L
Sbjct:   62 REEVQKKASLFNLQVEMSAL----IPGLVSTFMLLASSDNHGRKLPMVLSSLGSLGTNT--WLCMMSYFDLPLQLLIASTFIGALFGNYTTFWGACFAYIVDQQKEYKHRIIRIAILD--FMLGVVTGLTGLSSGYFIRELGFVWSYFITAMVLIVNLAYILFFLN------DPIKESSSQIVTMSCIESLK-DLFYRTYML----------FKNGSSKRQALLCLLIFTLVIYFFVIIGISPIFTLYELGPPLCWNEV-YIGYGSALGSVSFLSSFLGIWLFSYCLK--DIHIAYIGIFTTMVGMTLAAFTRTTLMMFLVRIPFIFTIMPLSVLRSMLSKVVHSTEQGALFACIAFLETLAGVTSTSAYSGIYSATVAWYPGFIFLLSAGL 425          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|74723295|sp|Q7Z3Q1.1|S46A3_HUMAN (RecName: Full=Solute carrier family 46 member 3; Flags: Precursor)

HSP 1 Score: 79.7221 bits (195), Expect = 8.035e-15
Identity = 109/442 (24.66%), Postives = 196/442 (44.34%), Query Frame = 0
Query:   17 LEPVVFLFGLSHGLY-SITVQSLYISKVCAVNLNHSLTICDDIYQHEE--------IQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFEC--LQDFTGGYVAFFFACHSYITD-ITDDSSRTKRMAFLDGIFPIGFLMGL-GLS-GIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKK--EPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVF 441
            +EP +FL   +  L   +T Q +Y  ++     N++ +   +I + E+         Q EVQK VS+          +P ++ +      SD  GRK  ++LS  G +  +V   L   F F  +   LL     +  F G Y  F+ AC +YI D   +   +T R+A +D  F +G + GL GLS G   ++LGF + F +  V+   +++Y +FF+       D V      + T S +   K      + +FK         ++ KRR        LF ++ +    F+  G   +  LY L     W E+ F  +    G    ++ +  I   S+ ++  D  +  I +   +    M  FA+ + ++++A +         ++LRS++SK + S E G +F+ IA  + +  + A   ++ +Y AT+ ++PG  F
Sbjct:    6 VEPAIFLSAFAMTLTGPLTTQYVY-RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQ---LLIASTFIGAFCGNYTTFWGACFAYIVDQCKEHKQKTIRIAIID--FLLGLVTGLTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLG------DPVKECSSQNVTMSCSEGFKNLFYRTYMLFK--------NASGKRRFLLCLL--LFTVITY---FFVVIGIAPIFILYELDSPLCWNEV-FIGYGSALGSASFLTSFLGIWLFSYCME--DIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTF 419          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|75055077|sp|Q5RBM3.1|S46A3_PONAB (RecName: Full=Solute carrier family 46 member 3; Flags: Precursor)

HSP 1 Score: 78.5666 bits (192), Expect = 2.457e-14
Identity = 107/442 (24.21%), Postives = 190/442 (42.99%), Query Frame = 0
Query:   17 LEPVVFLFGLSHGLYS-ITVQSLYISKVCAVNLNHSLTICDDIYQHEE--------IQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFEC--LQDFTGGYVAFFFACHSYITD-ITDDSSRTKRMAFLDGIFPIGFLMGL-GLS-GIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKK--EPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVF 441
            +EP +FL   +  L S +T Q +Y  ++     N++ +   +I + E+         Q EVQK VS+          +P ++ +      SD  GRK  ++LS  G +  +V   L   F F  +   LL     +  F G Y  F+ AC +YI D   +   +T R+A +D  F +G + GL GLS G   ++LGF + F +   +   +++Y +FF+       D V      + T S +   K      + +FK     A  K               F ++I         G   +  LY L     W E+ F  +    G    ++ +  I   S+ ++  D  +  I +   +    M  FA+ + ++++A +         ++LRS++SK + S E G +F+ IA  + +  + A   ++ +Y AT+ ++PG  F
Sbjct:    6 VEPAIFLSAFAMTLTSPLTTQYVY-RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCLLCYFAFPFQ---LLIASTFIGAFCGNYTTFWGACFAYIVDQCKEHKQKTIRIAVID--FLLGLVTGLTGLSSGYFIRELGFGWSFLIIAASLAVNLIYILFFLG------DPVKECSSQNVTMSCSEGFKNLFYRTYMLFK----NASGKRRFLLCLLLFTTITYFFVVI---------GIAPIFILYELDSPLCWNEV-FIGYGSALGSASFLTSFLGIWLFSYCME--DIHMAFIGIFTTMTGMVMTAFASTTLMMFLARVPFLFTIVPFSVLRSMLSKVVRSTEQGILFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTF 419          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|122131744|sp|Q05B81.1|PCFT_BOVIN (RecName: Full=Proton-coupled folate transporter; AltName: Full=Heme carrier protein 1; AltName: Full=PCFT/HCP1; AltName: Full=Retinal pigment epithelium transporter; AltName: Full=Solute carrier family 46 member 1)

HSP 1 Score: 77.411 bits (189), Expect = 4.407e-14
Identity = 107/462 (23.16%), Postives = 191/462 (41.34%), Query Frame = 0
Query:    7 KTRYILDNITLEPVVFLFGLSHGLY-SITVQSLY--ISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAY---NFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-----LFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKW--RDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFL 454
             TR +L    +EP+VFL   +  L   +T Q L+   S     N       C + +  + I  EV+   S    Y     FL GL     S   G WSD  GR+ ++VL+  G +   V+ +   V    L   YL     L   L DF+G   A F    + + D++   +RT RMA L+    +  ++   + G + ++  +   F LA+       LY  F   E                       VK+    ++F ++H ++ ++  + +     +K+L    L   + + ++ G   ++ LY L     W        +I +G       Y         L++   D  +  I +  NI+   +F FA ++ L++    + FL   ++ ++R+ +S+ +   E G +FS +A    +  ++AS I++ +Y ATL+   G  FL+ + L  I   L
Sbjct:   15 PTRSVLCRGCVEPLVFLANFALVLQGPVTTQYLWHRFSADLGYNGTRHRDSCSN-HSVDPIAQEVETLTSHWTLYMNVGGFLVGL---FSSTLLGAWSDCVGRRPLLVLASLGLLLQTVLSIF--VVQLHLHIGYLVLGRILCALLGDFSGLLAASF----ASVADVSSSRTRTIRMALLEACIGVAGMLASFIGGFLLQEQVYVNPFWLALAVLTVMTLYAAFCFGE----------------------TVKERTPTRLFTLRHHRSVIQLYVTQAPEKSRKHLALYSLAIFVMITVHLGAQDILTLYELSAPLCW-----DSRLISYGSAAQQLPYLTSLLGLRLLQYCLADTWVAEIGLVFNILGMMVFAFATITPLMFTGYGLLFLSLVVTPIIRAKLSRLVRQSEQGALFSALACVNGLAMLMASGIFNSLYPATLNLMKGFPFLLAAGLLFIPAIL 439          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|74732636|sp|Q96NT5.1|PCFT_HUMAN (RecName: Full=Proton-coupled folate transporter; AltName: Full=G21; AltName: Full=Heme carrier protein 1; AltName: Full=PCFT/HCP1; AltName: Full=Solute carrier family 46 member 1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.257e-13
Identity = 110/464 (23.71%), Postives = 192/464 (41.38%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLY-SITVQSLY--ISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAY---NFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAE-------YLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKW--RDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFL 454
            +    +L    +EP+VFL   +  L   +T Q L+   S     N       C +      +Q EV+   S    Y     FL GL     S   G WSD  GR+ ++VL+  G +   ++    +VF  +L+          +L   L DF GG +A  FA    + D++   SRT RMA L+    +  ++   L G   +  G+   F LA+    +  LY  F   E                       +K+    ++F  +H ++ V+  +       +K+L    L   + + ++ G   ++ LY       T + +   +I +G       Y         L++   D  +  I +  NI+   +F FA ++ L++    + FL   I+ ++R+ +SK +   E G +FS +A   ++  + AS I++ +Y ATL+F  G  FL+ + L  I   L
Sbjct:   14 RPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGTRQRGGCSNRSADPTMQ-EVETLTSHWTLYMNVGGFLVGL---FSSTLLGAWSDSVGRRPLLVLASLGLLLQALV----SVFVVQLQLHVGYFVLGRILCALLGDF-GGLLAASFAS---VADVSSSRSRTFRMALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGE----------------------TLKEPKSTRLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELS----TPLCWDSKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNFMKGFPFLLGAGLLLIPAVL 439          
BLAST of EMLSAG00000003292 vs. SwissProt
Match: gi|81170643|sp|Q5EBA8.1|PCFT_RAT (RecName: Full=Proton-coupled folate transporter; AltName: Full=Heme carrier protein 1; AltName: Full=PCFT/HCP1; AltName: Full=Solute carrier family 46 member 1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.184e-12
Identity = 105/459 (22.88%), Postives = 191/459 (41.61%), Query Frame = 0
Query:    8 TRYILDNITLEPVVFLFGLSHGLY-SITVQSLY--ISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAY---NFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAE---YLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYL-LFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFG--IQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFL 454
            T  +L    +EP+VFL   +  L   +T Q ++  IS     N       C +    + +  EV+   S    Y     FL GL    +S   G WSD  GR+ ++VL+  G +   V+    ++F  +L+     ++L   L    G +     A  + + D++ + SRT RMA L+    +   +   L G   +  G+   F LA+       LY  F   E                       VK+    ++F ++H ++ V+  +       + +L L+ + IF++    +G +  +    L     W        +I +G   Q L     ++     +    D  +  I +  NI+   +F FA ++ L++    + FL    + ++R+ +SK +   E G +FS +A   ++  ++AS I++ +Y ATL+F  G  FL+ + L  I   L
Sbjct:   16 TAAVLFRGPVEPLVFLANFALVLQGPLTTQYIWHRISTELGYNGTRHRENCGN-QSADPVLKEVETLTSHWTLYMNVGGFLVGL---FWSTLLGAWSDRVGRRPLLVLASLGLLLQAVV----SIFVVQLQLHIGFFVLGRALCALLGDFNGLLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALAVLIVMTLYAAFCFGE----------------------TVKEPKSTRLFTLRHHRSIVQLYVVPAPEKSRMHLALYSLAIFVVVTVHFGAQDILTLYELSTPLCWDSK-----LIGYGSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLAFNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVNSLAMLMASGIFNSLYPATLNFMKGFPFLLGAGLLFIPAIL 439          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: EFX69295.1 (hypothetical protein DAPPUDRAFT_329198 [Daphnia pulex])

HSP 1 Score: 216.468 bits (550), Expect = 1.640e-63
Identity = 151/453 (33.33%), Postives = 244/453 (53.86%), Query Frame = 0
Query:   15 ITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDD----IYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFEL-KAEYLLFECLQ-DFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE---RNSSEDQVDN-----TD--------DNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTS 445
            IT+EPV FLF ++  + +I +Q+LY++K C VN   +LT C      +    +  TE+QKYVS L  Y   ++ +P++I  LF GPWS+ NGRK  +++   G++ +  IY+LN  ++F L  AEY+LF  +     GG      A +SYI DIT   SRT R++ L G   I + +   +S  I    GF   +  ++    +++ Y IFFIK+   R S+E+Q+ N      D         NS T           +W+ F +         T + R +  K+  L ++L  M  +F+Y   GSV +LY RK F W +  F+ F  +  +  ++    ++P LS   + RD  I + A+ GNI       FA    ++Y+A     L A+I  ++RS++SK + SDE+  V+SV+AS ++++ ++++  Y+L+YKAT++FFPG VF+V S
Sbjct:   19 ITVEPVGFLFVVASIIQAIVIQNLYLNKTCVVNFQLNLTDCSTHNHTVESDSDHATEIQKYVSNLNIYGSLIENVPSIIMVLFLGPWSERNGRKLPMIIPLIGHICSVSIYILN--YYFTLWPAEYILFASIPLGLCGGTATLLMALNSYIADITTSHSRTSRISILYGCMVISYPVANFVSIYIYTYGGFFAIWGTSLGLGVTTLCYIIFFIKDSRGRESAENQIGNIYSPVVDYSQESEEFSNSGTTGCRCDSVAFNLWECFAV---------TFQPR-NGYKRACLSILLAAMC-VFVYQIPGSVTYLYARKLFDWDQPQFALFSTISSLTAVIGSLILLPLLSSYFEVRDVVIGIFAILGNIAGNLTIAFAVSPLMLYLASFGFVLTASIGVVIRSMLSKLVLSDELSHVYSVLASLESLVPLVSTFTYNLIYKATIEFFPGCVFVVFS 458          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: gb|EFA05964.2| (Solute carrier family 46 member 3-like Protein [Tribolium castaneum])

HSP 1 Score: 209.92 bits (533), Expect = 5.087e-61
Identity = 146/492 (29.67%), Postives = 252/492 (51.22%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIY--------QHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGR-KAIIVLSCFGYVFNNVIYLLNTVFFFELKAEY-LLFECLQD-FTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKK-EPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEID---FSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEE 479
            S+ KK + I  NIT+EPV+  + L   + SI  Q+L + K C VNL     ICD +         + +EI T  Q  ++ +  +   +Q L   +  LF G WSD + R K  I+L   G +     +LL+T FF++L  E+   FE +    TGG+ A F A  SY++ I+   +RT R+  ++    +   +G+ LSGI+  ++GF   FSLAI    ++++Y I ++K+   +E+ +   D N         VKK  P+   F ++H +  +    K    + K+ +  ++++ M+ +    G+  VM+L++R RFKW EID   +S F  V  + G V   F + F S  LK  D  + +I+    I A  ++ FA  S + Y+  I+  L       +RS+ISK +  +E+GK+ S+    +A++ ++  P+Y++VY+ T+   PG  FL+   L +     AI +++ L + E+ +    E +E+ 
Sbjct:   31 SLCKKIKLIFTNITVEPVLICYVLPSVMASIATQNLSLEKACRVNLQMDEDICDALSIRNRSGYNESDEIVT--QTLITSMNTWKSMIQSLVPSLLLLFLGSWSDRHQRRKPCIILPILGEICTCTGFLLSTYFFYQLPMEFNAFFEAVPPALTGGWFAMFMAVFSYVSRISSVETRTLRIGAVNLFSNVSVTVGIALSGILYNEIGFYGVFSLAIAMYTTALIYAIVYVKDMPKNEEVI--VDKN---------VKKVNPVLDFFNLKHIKETLNVAFKDGPRNRKRRICTIMILVMVIIGPMHGEMQVMYLFVRHRFKWNEIDYSLYSTFQFVIHVCGTV---FSLMFFSKFLKVDDAVLGMISSTSKIAASLVYAFAPTSTIFYLGAIIEALNGTSFIAMRSIISKLVPPEELGKINSLFGVSEALMPLVYGPMYNIVYETTIKVLPGSFFLLGGALTA----PAIVIFYWLYR-EHQKDQQEEAKEKP 501          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: XP_003249365.1 (PREDICTED: solute carrier family 46 member 3 isoform X1 [Apis mellifera])

HSP 1 Score: 209.534 bits (532), Expect = 1.905e-60
Identity = 144/454 (31.72%), Postives = 236/454 (51.98%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI-------YQHEEIQTEVQKYVSQLQAYNFFLQ-GLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-LFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSE-DQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCL 447
            +K  Y   NIT+EP++  + +   L S+  Q+L + K C VNL +   +C  +       Y+ EEI   VQ+ V+ +Q +   L  GLP ++  LF G WSD  G RK  ++L   G   ++V  LL T FF E+  E   + E L    TGG+   F    SYI DIT   SRT R+   +    +G  +G+ LSGI+  KLGF   FS++ V    S +Y +  IKE       +++  D+   +  A+       I   F  +H +   +   K+  ++ +K +L L++I M+ +    G+ +VM+LY+R R+ W E+ FS F     +  L+     +   SH LK  D  + +++    I+AGF++ FA   W++Y+A IV  +       +RS+ SK + + E+GKV S++   ++++ +I  P+YS +Y AT+  FPG  F+V +C+
Sbjct:   38 QKWSYFTRNITVEPMIACYVIPCMLASLATQNLSLEKACRVNLAYPDDVCTALARRNTTGYEKEEIA--VQQLVAGMQTWKTALSSGLPTILI-LFMGSWSDRTGLRKPCMLLPIVGEFLSSVSMLLCTYFFHEVPMEATGVLEALWPALTGGWFTMFMGVFSYIADITSVESRTLRIGAANVFLSLGVPIGMALSGILYLKLGFYGVFSISTVCYVLSFIYGLVVIKEPPKPHLRKMEKADNERMSVCAS-------ILDFFAFKHIEETFRVAFKQGRNNRQKRVLVLMVIVMVVIGPLYGEMAVMYLYMRYRYHWNEVMFSMFTTFAMVTNLIGTAISVGVFSHILKIDDAIVGIMSSMSKILAGFVYAFAITDWMIYLAAIVEIVNGTSFIAMRSIASKLVSTGELGKVNSLLGVCESLMPLIYGPMYSSIYAATMKTFPGTFFIVGACM 481          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: EFX69296.1 (hypothetical protein DAPPUDRAFT_329199 [Daphnia pulex])

HSP 1 Score: 208.764 bits (530), Expect = 2.033e-60
Identity = 138/446 (30.94%), Postives = 230/446 (51.57%), Query Frame = 0
Query:   15 ITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQ----HEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFE-LKAEYLLFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGV--------KSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSC 446
            IT+EP+ FL+ +++ + SI   +L++ KVCAVN   + T+CD   +    + ++   VQ YVS L  Y   +  +P++   LF  PWSD +GRK +++    G+V  ++  + N  ++ E L AEYLL   +    TGG   +F   H YI DIT   +RT R++ L GI  I   +G  +S  I    G    +  A+     + LY IFF+++   +   V++TD     +    K+  E +  + +++    G+          T KRR    K+  L +++  M  L        V +L+ RK+F W   D++ ++ +     +     ++P LS   K RDG I +I++  NI +     FA    ++Y++ I  F       ++RS+ SK + SDE+   +SV+AS +AV+ +I SP  +L+Y+ATL FFPG +FLV +C
Sbjct:   32 ITVEPLGFLYLIANIIQSIVTPNLFLYKVCAVNFQVNATLCDPRSKINRNNTQLADRVQSYVSTLNIYGSLIDNIPSIFLILFLLPWSDKHGRKPLMIAPLIGHVLCSLSDITN--YYIESLPAEYLLISTVFVGLTGGRGIYFMVLHRYIIDITTTEARTWRLSLLGGIVGISVPIGNLISAYIYASGGNIAIWGTALALYTVAFLYIIFFLEDSCGTSSIVESTDTQIIEKLKYGKL--ENMRLLPRVKESCVGILNNLILCFTETFKRRP-GYKRACLSILMASMCILIFANANNGVGYLFTRKKFGWDAPDWAFYVTIASAASVCGTLILLPILSGYFKVRDGIIGVISLLANIGSNLTVAFAVSPLIMYLSSIGHFFSPLAGIIIRSIFSKTLSSDELSYAYSVLASIEAVVPLITSPSINLIYRATLSFFPGCIFLVRAC 472          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: AHN59715.1 (uncharacterized protein Dmel_CG15890, isoform B [Drosophila melanogaster])

HSP 1 Score: 205.682 bits (522), Expect = 1.159e-58
Identity = 126/465 (27.10%), Postives = 237/465 (50.97%), Query Frame = 0
Query:    5 WK-KTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEI-----QTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFE--LKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTS--CLYSIVGFLAIYLY 459
            W+ K R + +N+T+EP++  + +   L ++  Q+L + K C VN+ +   +CD + + +       +  VQ+ V+++ A+   +Q L   +  LF G WSD + R+   +L      F  V+ L+  V+F +  ++A  L        +GG+        SYI DIT +  RT R+  L+  F +G  +G+  SG++ K++GF   FS++      + +Y  FF++E  S  ++              +  +K  +   F  +H     +   K+ E+  +K ++ L+++ M+ +    G+ +V +L+ R RF W+E++FS F       GL+   F +  LSHKL   D  + +++    I++ F++ FA + W +Y+ G+V          +RS+ +K +  DE+GKV S+    +A++ M+ +P+Y+ +Y ATL   PG  FL+     L+S+  FL +Y +
Sbjct:   59 WREKIRLVANNVTVEPILAAYIMPSVLSNLATQNLNLEKACRVNMAYGDEVCDALTRRQTANYTLEEETVQQMVARMAAWKTVIQSLFPCLLILFWGSWSDRHRRRKPCILIPVVGEFLGVVGLMLCVYFEQAPMEAAALTEAIFPSLSGGWFTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAFVYGFFFLEEPQSRPEK--------------SAEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHGEMAVTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCVGILSHKLNIDDALVGVLSSTSKILSSFVYAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFGVAEALMPMVFAPMYTTLYAATLRVLPGAFFLLGGGLTLFSVFIFLWMYRF 509          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: AAF48383.1 (uncharacterized protein Dmel_CG15890, isoform A [Drosophila melanogaster])

HSP 1 Score: 205.682 bits (522), Expect = 1.159e-58
Identity = 126/465 (27.10%), Postives = 237/465 (50.97%), Query Frame = 0
Query:    5 WK-KTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEI-----QTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFE--LKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTS--CLYSIVGFLAIYLY 459
            W+ K R + +N+T+EP++  + +   L ++  Q+L + K C VN+ +   +CD + + +       +  VQ+ V+++ A+   +Q L   +  LF G WSD + R+   +L      F  V+ L+  V+F +  ++A  L        +GG+        SYI DIT +  RT R+  L+  F +G  +G+  SG++ K++GF   FS++      + +Y  FF++E  S  ++              +  +K  +   F  +H     +   K+ E+  +K ++ L+++ M+ +    G+ +V +L+ R RF W+E++FS F       GL+   F +  LSHKL   D  + +++    I++ F++ FA + W +Y+ G+V          +RS+ +K +  DE+GKV S+    +A++ M+ +P+Y+ +Y ATL   PG  FL+     L+S+  FL +Y +
Sbjct:   59 WREKIRLVANNVTVEPILAAYIMPSVLSNLATQNLNLEKACRVNMAYGDEVCDALTRRQTANYTLEEETVQQMVARMAAWKTVIQSLFPCLLILFWGSWSDRHRRRKPCILIPVVGEFLGVVGLMLCVYFEQAPMEAAALTEAIFPSLSGGWFTMLMGVFSYIADITTEEDRTLRIGILNVCFSVGVPIGMAFSGVLLKQIGFYGVFSISAAFYVIAFVYGFFFLEEPQSRPEK--------------SAEQKSLLADFFDKEHVVQTFRVAFKKGENQRRKRVILLMIVVMVIIGPLHGEMAVTYLFTRFRFNWSEVEFSFFSTYAMFTGLIGVIFCVGILSHKLNIDDALVGVLSSTSKILSSFVYAFATLPWHMYLGGLVEIFNGTAFIAMRSIATKLVSKDELGKVNSLFGVAEALMPMVFAPMYTTLYAATLRVLPGAFFLLGGGLTLFSVFIFLWMYRF 509          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: EAL40562.4 (AGAP004562-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 200.675 bits (509), Expect = 4.339e-57
Identity = 138/487 (28.34%), Postives = 239/487 (49.08%), Query Frame = 0
Query:    2 TSIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI-------YQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-LFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEE 479
            +S+ +K  Y   NIT+EP++  + +   L  +  Q+L + K C VNL +   ICD +       Y HEE    VQ  V+++  +   LQ     +  LF G WSD +GR+   +L      F   I L+   +F  +  E   + E L    TGG+   F    SYI D+T    RT R+  ++  F +G  +G+  SGI+ K++GF   FS++      +  Y +F +KE       VD  ++    ++     +K  +   F  +H     +   K  E   +  ++ L+++ M+ +    G+ +V++L+ R RF W+E++FS F     + GL+   F +   SH LK  D  I +++    I++ F++ FA  +W +Y+  IV  L       +RS+ SK + SDE+GKV S+    +A++ ++ +P+Y+ VY  +++  PG  FL+   L S    + +++Y         R+ A EL EE+
Sbjct:   26 SSLREKYLYFKRNITVEPMLACYIMPSVLAGLATQNLNLEKACRVNLGYGDVICDALTRRDTANYTHEE--EMVQHLVARMAGWKTVLQSALPCMLILFWGSWSDRHGRRKPCMLIPIIGEFMTAIGLILCTYFKSVPMEVAGITEALFPALTGGWFTMFMGVFSYIADVTTTEERTLRIGIVNLCFSLGVPIGMAFSGILLKQIGFYGVFSISASLYLVAFFYGVFVVKE-------VDILNEKQRLRAQ----EKGLLADFFDREHVMETFRVAFKIGERQRRLRVIMLMIVVMVVIGPLHGEMAVIYLFTRYRFNWSEVEFSFFSTYGMLTGLIGTLFSVGVFSHLLKIDDALIGVMSCMSKILSSFVYAFAVTTWQLYLGPIVEMLNGTSFISMRSIASKLVASDELGKVNSLFGVAEALMPLVYAPLYTTVYTLSINVLPGAFFLLGGALTSPAVVIFLWMY------RVHRREARELAEEK 493          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: EFX69308.1 (hypothetical protein DAPPUDRAFT_329228 [Daphnia pulex])

HSP 1 Score: 198.364 bits (503), Expect = 1.354e-56
Identity = 131/438 (29.91%), Postives = 221/438 (50.46%), Query Frame = 0
Query:   15 ITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI----YQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFE-LKAEYLLFECLQ-DFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQS--ANNKVKKEPIWKMFKIQHFQAGVK---STLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVF 441
            IT+EP+ FL+  ++ L  I   +L++ KVCAVN   + T+CD      + + ++   VQ YVS L  Y   +  +P ++  LF  PWSD +GRK +++    G+V   +  + N  ++ E L AEYLL   +    TGG   FF + H Y+ DIT   +RT R+A + GI  I   +G  +SG I    G    +  ++     + LY +F   +   ++  V  TD  +  +   A+    +E + K   +      ++    T KRR    +  +  L+    L LF     G + +L+ RK+F W   D++ FM +     L     ++P LS   K RDG I ++++  NI +     FA    ++Y++ I   L      ++RS+ SK + S+E+   ++V+AS +A++ +I SP  +++Y+ATL FFPG +F
Sbjct:   32 ITVEPLGFLYLTANILQMIVTPNLFLQKVCAVNFRMNATLCDPRSKMNHNNTQLSDRVQGYVSTLNIYTSLIDNIPPILLMLFLLPWSDKHGRKPLMIAPLIGHVLGTLSDMAN--YYIESLPAEYLLISAVPVGLTGGRGIFFMSLHRYVIDITTTEARTWRLALIGGIIGISVPIGTLISGYIYASGGNIAIWGTSLAVYAVAFLYVLFGFSDSRGTKSIVKTTDAQTLEKFTFADQNNMREDMSKESCVGILNNLIRCFTETFKRRPGYKRACVSILMASMCLALFATENHG-IGYLFARKKFGWDAPDWAYFMTLASSTALCGTLIILPILSGYFKVRDGIIGVLSLLSNIGSNLTMAFAVSPLMMYLSTIGDVLVPLAGIVIRSIFSKTLISEELSYAYAVLASLEAIVPLITSPTINVIYRATLSFFPGCIF 466          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: gb|KYB25977.1| (Proton-coupled folate transporter-like Protein [Tribolium castaneum])

HSP 1 Score: 190.274 bits (482), Expect = 7.217e-54
Identity = 133/464 (28.66%), Postives = 225/464 (48.49%), Query Frame = 0
Query:   10 YILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECL--QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLD----GIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVM-FLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFV---IPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLK 463
            Y L  IT+EP + L+ ++    S+  Q+ +++K C VN   + +ICD++ ++EE+  EVQ  VS    YN     +  +I +LF G WSD  GRK  +++   G ++ +V+ ++N         EY+++       FTG  VA F A  +Y+ DI+   SRT R+  L+       P G  +G  L   +  K  +   F + +   + +I+Y+   +  R +S  Q  +   N  T               F   H     K+  K R ++ + YLL  ILI M+  + +      M +LY++  FKWT  +FS F  V   Q  +   F+   IP +S  L WRD  II+I    + +    F  A+ SW+ Y+ G+ + +G  ++ ++RS++SK + + E GK  +V+A     I +I+  +YS VY AT+   P  +F +T      V  L ++++   K
Sbjct:   17 YYLKLITVEPTMVLYMMAFMTTSVVEQAFFVNKACRVNHGLNASICDNLTEYEELNKEVQVTVSDFHLYNDVAGHVVPIILALFMGAWSDKRGRKLPLLIGLTGKLYYSVMVVVNATQD-TWPVEYIVYTATLPMAFTGADVAIFAAAFTYLVDISTQESRTMRVTLLEVCYLATMPTGIALGKVLFNQVVNK-SYAVMFGINVALLFLAIVYSFLRLDWRTNSRQQPLSEAPNLFTD-------------FFDYNHVVDTGKTLFKSRRNNQRCYLL--ILIAMMAFYTFQRDEKAMSYLYVQLIFKWTFDEFSNFRTV---QSAIQDVFLLCAIPLMSRVLGWRDTIIIMIGALAHSVGRIFFATADESWMFYLGGVFAAIGPIVAPVIRSMVSKLVANSEKGKTLAVLAVADNAIPLISGTMYSKVYNATIHTHPNAIFYLTMATQMTVFVLILFIHVKAK 460          
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Match: gb|EFA08602.2| (Proton-coupled folate transporter-like Protein [Tribolium castaneum])

HSP 1 Score: 189.889 bits (481), Expect = 1.060e-53
Identity = 133/464 (28.66%), Postives = 225/464 (48.49%), Query Frame = 0
Query:   10 YILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECL--QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLD----GIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVM-FLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFV---IPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLK 463
            Y L  IT+EP + L+ ++    S+  Q+ +++K C VN   + +ICD++ ++EE+  EVQ  VS    YN     +  +I +LF G WSD  GRK  +++   G ++ +V+ ++N         EY+++       FTG  VA F A  +Y+ DI+   SRT R+  L+       P G  +G  L   +  K  +   F + +   + +I+Y+   +  R +S  Q  +   N  T               F   H     K+  K R ++ + YLL  ILI M+  + +      M +LY++  FKWT  +FS F  V   Q  +   F+   IP +S  L WRD  II+I    + +    F  A+ SW+ Y+ G+ + +G  ++ ++RS++SK + + E GK  +V+A     I +I+  +YS VY AT+   P  +F +T      V  L ++++   K
Sbjct:   26 YYLKLITVEPTMVLYMMAFMTTSVVEQAFFVNKACRVNHGLNASICDNLTEYEELNKEVQVTVSDFHLYNDVAGHVVPIILALFMGAWSDKRGRKLPLLIGLTGKLYYSVMVVVNATQD-TWPVEYIVYTATLPMAFTGADVAIFAAAFTYLVDISTQESRTMRVTLLEVCYLATMPTGIALGKVLFNQVVNK-SYAVMFGINVALLFLAIVYSFLRLDWRTNSRQQPLSEAPNLFTD-------------FFDYNHVVDTGKTLFKSRRNNQRCYLL--ILIAMMAFYTFQRDEKAMSYLYVQLIFKWTFDEFSNFRTV---QSAIQDVFLLCAIPLMSRVLGWRDTIIIMIGALAHSVGRIFFATADESWMFYLGGVFAAIGPIVAPVIRSMVSKLVANSEKGKTLAVLAVADNAIPLISGTMYSKVYNATIHTHPNAIFYLTMATQMTVFVLILFIHVKAK 469          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|769863992|ref|XP_011643864.1| (PREDICTED: solute carrier family 46 member 3-like isoform X1 [Pogonomyrmex barbatus])

HSP 1 Score: 236.884 bits (603), Expect = 5.317e-68
Identity = 150/490 (30.61%), Postives = 251/490 (51.22%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI-------YQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKM----FKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEE 479
            SI +K  ++  NIT+EP+V  + +   L  +  Q+L + K C VNL +   +C  +       Y+ EE  T VQ+ V+++Q +   LQ     I  LF G WSD  G RK  ++L   G  F++V  +  T +F+EL  E ++ E L    TGG+   F    SYI DIT   SRT R+   +    +G  +G+ LSGI+  KLGF   FS+A+V    S +Y +  IKE            + S  +S  N+ K+  + +     F ++H +   +   K+  ++ +K ++ L+LI M+ +    G+ +V++LY+R R+ W E+ FS F     +  L+     +   SH LK  D  + +++    I+A F++ FA  +W+VYVA IV  +       +RS+ SK + +DE+GKV S+    ++++ ++  P+YS +Y AT++ FPG  F+   C+       A++ +F L       +   E +E E
Sbjct:   39 SIRQKWSFLTSNITVEPMVACYVIPSVLSQLATQNLILEKACRVNLAYPDEVCSALSARNTTGYEAEE--TAVQQLVARMQTWKTPLQSALPTILILFMGAWSDRTGLRKPCMLLPIIGEFFSSVTLIACTYWFYELPMEAVVLESLWPALTGGWFTMFMGIFSYIADITTVESRTLRIGAANVFLSLGVPIGMALSGILYTKLGFYGVFSIAMVCYVMSFVYGLVVIKEPPRV------LAERSRKKSLPNEGKRTSVCRFVLDFFSLRHIEETFRVAFKKGANNRQKRVIVLMLIVMVVIGPLYGEMAVLYLYMRYRYNWNEVTFSMFSTFGMVTNLIGTAISVGIFSHILKIDDAIVGIMSCMSKILASFVYAFATSAWMVYVAAIVEIVNGTSFIAMRSIASKLVPTDELGKVNSLFGVCESLMPLVYGPMYSAIYAATMNTFPGTFFIAGGCM----TMPAVFAFFWLYTEHRKDRMLKEQKEPE 516          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|826473116|ref|XP_012536545.1| (PREDICTED: solute carrier family 46 member 3-like [Monomorium pharaonis])

HSP 1 Score: 234.187 bits (596), Expect = 5.653e-67
Identity = 147/488 (30.12%), Postives = 247/488 (50.61%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI-------YQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELL 481
            SI +K  ++  NIT+EP+V  + +   L  +  Q+L + K C VNL +S  +C  +       Y+ EE  T VQ+ V+++Q +   LQ     +  LF G WSD  G RK  ++L   G  F++V  +  T +F EL  E ++ E L    TGG+   F    SYI DIT   SRT R+   +    +G  +G+ LSGI+  KLGF   FS+A+V    S +Y +  IKE       ++ +   S             +   F ++H +   +   K+  H+ +K ++ L++I M+ +    G+ +V++LY+R R+ W E+ FS F     +  L+     +   SH LK  D  + +++    I+A F++ FA  +W+VYVA IV  +       +RS+ SK + +DE+GKV S+    ++++ ++  P+YS +Y AT++ FPG  F+   C+       A++ +F L       +   E +E E +
Sbjct:   39 SIRQKWSFLTSNITVEPMVACYVIPSVLSQLATQNLILEKACRVNLAYSDEVCSALSARNTTGYEAEE--TAVQQMVARMQTWKTPLQSALPTMLILFMGAWSDRTGLRKPCMLLPIIGEFFSSVTLIACTYWFNELPMEVVVLESLWPALTGGWFTMFMGIFSYIADITTVESRTLRIGAANVFVSLGVPIGMALSGILYSKLGFYGVFSIAMVCYILSFVYGLVVIKE--PPRVIIERSRKKSLPSEGKRTSLCAFVLDFFSLKHIEETFRVAFKKGAHNRQKRVIVLMVIIMVVIGPLYGEMAVLYLYMRYRYNWNEVTFSMFSTFGMVTNLIGTAISVGIFSHILKIDDAIVGIMSCTSKILASFVYAFATSAWMVYVAAIVEIVNGTSFIAMRSIASKLVPTDELGKVNSLFGVCESLMPLVYGPMYSAIYAATINTFPGTFFIAGGCMT----MPAVFAFFWLYTEHRKDRMLKEQKEPEAM 518          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|936691629|ref|XP_014223806.1| (PREDICTED: solute carrier family 46 member 3-like [Trichogramma pretiosum])

HSP 1 Score: 234.572 bits (597), Expect = 1.314e-66
Identity = 158/493 (32.05%), Postives = 247/493 (50.10%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI-------YQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-LFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSED---QVDNTDDNSTTQSANNKVKKEPIW-----KMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLA-IYLYFGLKKVENSRKNAHELREEE 479
            +K R+I  NIT+EP+V L+ +   L ++  Q+L + K C VNL +S  +C  +       Y HEE    VQ  V+ +Q +   LQ     I  +F G WSD  G RK  ++L   G    +V  L  T +F+EL  E   +FE L    TGG+        SYI DIT   SRT R+  ++    +G  +G+ LSG++  +LGF   F +A V    S LY +  IKE   S +    +      S  Q     V     W       F ++H +   +   K    + +K ++ L++I M+ +    G+ SVM+L+ R RF W E+ FS F     +  L+   F++ F SH LK  D  I +++    I+AGF++ FA    L+Y+A +V  +      ++RS+ SK +  +E+GKV S+    +A++ ++  P+YS +Y AT D FPG  FLV   L +I G +A ++LY   KK E   +   +  E++
Sbjct:   79 EKARFIARNITVEPLVALYIIPSVLAALATQNLNLEKACKVNLGYSDLVCASLSARNTSGYAHEE--AAVQGLVASMQTWKTALQSFFPSILIVFMGAWSDRTGLRKPCMMLPIVGEFLTSVSLLACTYWFYELPMEAAGVFEALWPALTGGWFTMIMGTFSYIGDITSVESRTVRVGAVNAFLSLGVPIGMALSGVLYIELGFYGVFGIATVCYVLSFLYGLLVIKEAPRSRELRKSLKAAKLASNAQDLEAGVNSTRSWWAEVRDFFALRHVKETFRVVFKEGPRNRRKRVMVLMIIVMVLIGPMYGEMSVMYLFTRYRFNWNEVQFSFFSTYSMVTSLIGTLFMVGFFSHVLKMDDAMIGVLSCISKILAGFVYAFATTDMLIYIAPLVEIISGTSFIVMRSITSKLVPPEELGKVNSLFGVCEAIVPLVYGPMYSSIYAATFDNFPGTFFLVGGGL-TIPGVMAFLWLYIESKKDEALDRELQQKSEKQ 568          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|759050037|ref|XP_011334087.1| (PREDICTED: solute carrier family 46 member 3 [Cerapachys biroi] >gi|607363043|gb|EZA57287.1| Solute carrier family 46 member [Cerapachys biroi])

HSP 1 Score: 233.032 bits (593), Expect = 1.487e-66
Identity = 155/495 (31.31%), Postives = 256/495 (51.72%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI-------YQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKER----NSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELLNRN 484
            S+ +K  ++  NIT+EP+V  + +   L S+ VQ+L + K C VNL +S  +C  +       Y+ EE  T VQ+ V+++Q +   LQ     I  LF G WSD  G RK  ++L   G  F++V  +  T +F+EL  E ++ E +    TGG+   F    SYI DIT   SRT R+   +    +G  +G+ LSGI+ KKLGF   FS+++V    S +Y +  IKE     N S  ++  ++   T+  A        I   F ++H +   +   K   ++ +K ++ L++I M+ +    G+ +V++LY+R R+KW E+ FS F     +  L+     +   SH LK  D  + +++    I+A F++ FA  SW+VYVA IV  +       +RS+ SK + +DE+GKV S+    ++++ ++  P+YS +Y AT++ FPG  F+   C+     F   +LY   +K    RK   +   E  +N  
Sbjct:   33 SLRQKWSFLTSNITVEPMVACYVIPSVLSSLAVQNLILEKACRVNLAYSDEVCSALSARNTTGYEAEE--TAVQQMVARMQTWKTPLQSALPTILILFMGAWSDRTGLRKPCMLLPIIGEFFSSVTLIACTYWFYELPMEVVVLEAVWPALTGGWFTMFMGIFSYIADITSVESRTLRIGAANVFLSLGVPIGMALSGILYKKLGFYGVFSISMVCYVLSFVYGLVVIKEPGVLANRSRRKILPSEGKRTSVCAF-------ILDFFSLKHIKETFRVAFKNGANNRQKRVIVLMVIVMVVIGPLYGEMAVLYLYMRYRYKWNEVKFSMFSTFGMVTNLIGTAISVGIFSHILKIDDAIVGIMSCTSKILASFVYAFATTSWMVYVAAIVEIVNGTSFIAMRSIASKLVPTDELGKVNSLFGVCESLMPLVYGPMYSAIYAATMNTFPGTFFIAGGCMTMPAVFAFFWLYTEHRK---DRKLKEQKEPEAAINHK 515          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|987909922|ref|XP_015430616.1| (PREDICTED: uncharacterized protein LOC107187121 [Dufourea novaeangliae] >gi|1016161805|gb|KZC08967.1| Solute carrier family 46 member 3 [Dufourea novaeangliae])

HSP 1 Score: 230.335 bits (586), Expect = 9.664e-66
Identity = 158/500 (31.60%), Postives = 255/500 (51.00%), Query Frame = 0
Query:    2 TSIWK------KTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQ-----HEEIQTEVQKYVSQLQAYNFFL-QGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-LFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE----RNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELLN 482
            T +WK      K  Y   NIT+EP++  + +   L S+  Q+L + K C VNL +S  +C  +       +E  +T VQ+ V+ +Q++   L  GLP ++  LF G WSD  G RK  ++L   G   + V  LL T FF+E+  E   + E L    TGG+   F    SYI DIT   SRT R+   +    +G  +G+ LSGI+  KLGF   F ++ V    S +Y +  IKE         +QV   +  S   S  N          F ++H +   K   K  +++ KK LL L+++ M+ +    G+ +VM+LY+R R+ W E+ FS F     +  L+     +   SH LK+ D  + +++    I+AGF++ FA  +W++Y+A IV  +       +RS++SK + +DE+GKV S+    ++++ ++  P+YS +Y AT+  FPG  F+V +CL     F  ++LY         RK+  +L +E+  N
Sbjct:   18 TIVWKSMTMKEKWSYFTRNITVEPLLACYVIPCMLASLATQNLSLEKACRVNLGYSDEVCTALANRNTTGYEAEETAVQQLVTSMQSWKMALTSGLPTILI-LFMGAWSDRTGLRKPCMLLPIVGEFLSTVSMLLCTYFFYEVPMEVTGVLEALWPSLTGGWFTMFMGVFSYIADITTVESRTLRIGAANVFVSLGIPIGMALSGILYMKLGFYGVFGISTVCYVFSFVYGLVVIKEPPRPNKKQSEQVKPDEKMSVCGSIRN---------FFALKHIEETFKVAFKSGKNNRKKRLLVLMVVVMVVIGPLYGEMAVMYLYMRYRYHWNEVKFSMFTTFAMVTNLIGTTISVGVFSHILKFDDAIVGVMSSMSKILAGFVYAFATTNWMIYLAAIVEIVNGTSFIAMRSIVSKLVSTDELGKVNSLFGVCESMMPLVYGPMYSSIYGATMKTFPGTFFIVGACLTMPAVFAFLWLY------TEHRKDRQQLEQEKKTN 501          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|766939152|ref|XP_011502116.1| (PREDICTED: solute carrier family 46 member 3-like [Ceratosolen solmsi marchali])

HSP 1 Score: 229.18 bits (583), Expect = 2.002e-65
Identity = 150/495 (30.30%), Postives = 251/495 (50.71%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEI-----QTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-LFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWK----MFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLY--SIVGFLAIYLYFGLKKVENSRKNAHELREEELLNR 483
            +I +K  Y+L NIT+EP+V  + +   L S+  Q+L + K C VNL ++ +IC  +           +T VQ+ V+ +Q +   LQ     I  +F G WSD NG RK  ++L   G    ++  +  T +F+EL  E   +FE L    TGG+        SYI DIT   SRT R+  ++    +G  +G+ LSG++  KLGF   F +A      S +Y +  IKE   + +        S   +  +++KK   W      F ++H Q   +   KR   + +K ++ L+LI M+ +    G+ +VM+L+ R RF W E+ FS F     +  L+   F +   SH LK  D  + +++    I+A F++ F+   W++Y+A +V  +      ++RS+ SK +  DE+GKV S+    +A++ ++  P+YS +Y AT++ FPG  FLV   L    ++ FL +Y+       E+ +  A E  +E L ++
Sbjct:    2 TIGQKCSYVLRNITVEPMVAFYIMPSVLASLATQNLNLEKACKVNLGYTDSICAALAARNTSGLALEETAVQQLVAVMQTWKTALQSFFPSILIVFMGAWSDRNGLRKPCMMLPIVGEFLTSISLIACTYWFYELPMEAAGVFEALWPALTGGWFTMIMGTFSYIGDITSVESRTVRVGAVNSFLSLGVPVGMALSGVLYIKLGFYGVFGIAAACYVFSFMYGLLVIKEAPRALEL-----RKSIKLAQASELKKMTWWASVTDFFALRHVQETFRVAFKRGPRNRRKRVMVLMLIVMVLIGPMYGEMAVMYLFTRYRFNWNEVQFSFFSTYSMVINLIGTLFAVGVFSHFLKMDDALLGVLSCVSKILASFVYAFSTTDWMIYIAPLVEIINGTSFIVMRSITSKLVPPDELGKVNSLFGVCEAIVPLVYGPMYSSIYGATVNNFPGTFFLVGGGLMIPGVIAFLWLYM-------EHKKDEALEKEQEALASK 484          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|751220928|ref|XP_011163622.1| (PREDICTED: solute carrier family 46 member 3 [Solenopsis invicta] >gi|322791059|gb|EFZ15659.1| hypothetical protein SINV_09638, partial [Solenopsis invicta])

HSP 1 Score: 227.639 bits (579), Expect = 1.466e-64
Identity = 149/490 (30.41%), Postives = 253/490 (51.63%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDI-------YQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE--RNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREEELL 481
            SI +K  ++ +NIT+EP++  + +   L  + VQ+L + K C VNL +S  +C  +       Y+ EE  T VQ+ V+++Q +   LQ     +  LF G WSD  G RK  ++L   G  F+++  +  T +F EL  E ++ E +    TGG+ A F    SYI DIT   SRT R+   +    +G  +G+ LSGI+  KLGF   FS+A+V    S +Y +  IKE  R     +   ++D  T+  A        +   F ++H +   +   K   ++ KK ++ L++I M+ +    G+ +V++LY+R R+ W E+ FS F     +  L+     +   SH LK  D  + +++    I+A F++ FA  +W+VYVA IV  +       +RS+ SK + +DE+GKV S+    ++++ ++  P+YS +Y AT+D FPG  F+   C+       A++ +F +       +   E +E E +
Sbjct:   34 SIRQKWSFLTNNITVEPMIACYVIPSVLSQLAVQNLILEKACRVNLAYSDEVCSALSARNTTGYEAEE--TAVQQMVARMQTWKTPLQSALPTLLILFMGAWSDRTGLRKPCMLLPIIGEFFSSITLIACTYWFNELPMEVVVLEAVWPALTGGWTAMFMGIFSYIADITTVESRTLRIGAANVFLSLGVPIGMALSGILYTKLGFYGVFSIAMVCYVMSFVYGLVVIKEPPRERLRKKSLPSEDKRTSLCAF-------VIDFFSLKHVKETFRVAFKEGTNNRKKRVIVLMVIVMVVIGPLYGEMAVLYLYMRYRYNWNEVTFSMFSTFGMVTNLIGTAISVGIFSHILKIDDAIVGIMSCTSKILASFVYAFAKHAWMVYVAAIVEIVNGTSFIAMRSIASKLVPTDELGKVNSLFGVCESLMPLVYGPMYSAIYAATMDTFPGTFFIAGGCM----TMPAVFAFFWMYTQHRKDRMLKEQKEPEAM 510          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|817221765|ref|XP_012286336.1| (PREDICTED: uncharacterized protein LOC105702940 [Orussus abietinus])

HSP 1 Score: 224.172 bits (570), Expect = 3.336e-63
Identity = 147/490 (30.00%), Postives = 249/490 (50.82%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQH-----EEIQTEVQKYVSQLQAYNFFLQ-GLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-LFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKER----NSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLY--SIVGFLAIYLYFGLKKVENSRKNAHELRE 477
            ++ +K  ++  NIT+EP+V  + +   L S+  Q+L + K C VNL +   +C  +        E  +T VQ+ V+ +Q +   LQ GLP ++  LF G WSD  G RK  ++L   G    ++  +  T +F+EL  E   + E L    TGG+   F A  SYI DIT   SRT R+  ++    +G  +G+ LSG++  K+GF   F+++ V    S +Y +  IKE         D++D  D    +  A+           F ++H     +   K+   + +K ++ L++I M+ +    G+ +VM+L++R RF W E+ FS +     +  L+     +   SH LK  D  + L++    I+A F++ FA   W++YVA ++  +       +RS+ SK + +DE+GKV S+    ++++ ++  P+YS VY AT++  PG  FLV  CL   +++ FL +Y        E+ R  A E RE
Sbjct:   46 TVGQKWSFLTKNITVEPMVACYIMPSVLASLATQNLNLEKACRVNLAYPEEVCGALTARNTTGLEAEETAVQQLVAGMQTWKTALQSGLPTILI-LFMGAWSDRTGLRKPCMLLPIVGEFLTSISLIACTYWFYELPMEAAGVSEALWPALTGGWFTMFMAIFSYIGDITTVESRTLRIGAVNVFLSLGVPIGMALSGVLYLKIGFYGVFAISTVCYMLSFIYGLVVIKEPPRPPKGPADKMDQVDRAKMSFCAST-------LDFFALRHISETFRVAFKKGARNRQKRVIVLMIIVMVVIGPVYGEMAVMYLFVRYRFNWNEVKFSMYSTYSMVTNLIGTTVSVGVFSHILKIDDALVGLMSCTSRILASFVYAFATTDWMIYVAPLIEIVNGTSFIAMRSIASKLVPTDELGKVNSLFGVCESLMPLVYGPMYSSVYGATMNTLPGTFFLVGGCLTIPAVISFLWLY-------TEHRRDRALEERE 520          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|780613805|ref|XP_011690945.1| (PREDICTED: solute carrier family 46 member 3 [Wasmannia auropunctata])

HSP 1 Score: 223.787 bits (569), Expect = 3.810e-63
Identity = 147/484 (30.37%), Postives = 252/484 (52.07%), Query Frame = 0
Query:    3 SIWKKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICD-----DIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE--RNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLY--SIVGFLAIYLYFGLKKVENSRKNAHEL 475
            SI +K  ++  NIT+EP+V  + +   L  + VQ+L + K C VNL +   +C      +   +E  +TEVQ+ V+++Q +   LQ     I  LF G WSD  G RK  ++L   G  F++ I L+   ++ EL  E ++ E +    TGG+V  F    SYI DIT   SRT R+   +    +G  +G+ LSGI+  KLGF   FS+A+V    S +Y +  IKE  R  +E +   +    T+  A        +   F ++H +   +   K+  ++ +K ++ L+++ M+ +    G+ +V++LY+R R+ W E+ FS F     +  L+     +   SH LK  D  + +++    I+A F++ FA  +W+VYVA IV  +       +RS+ SK + +DE+GKV S+    ++++ ++  P+YS +Y AT+  FPG  FL   C+   +++GFL +Y      ++   +K    +
Sbjct:   36 SIRQKWSFLTSNITVEPMVACYVIPSVLSQLAVQNLILEKACRVNLAYPDELCSALSARNTTGYEAQETEVQQMVARMQTWKTPLQSALPTILILFMGAWSDRTGLRKPCMLLPIIGEFFSS-ITLIACTYWSELPMEVVVLESVWPALTGGWVCMFMGTFSYIADITTVESRTLRIGAANVFLSLGVPIGMALSGILYTKLGFYGVFSIAMVCYIMSFVYGLVVIKEPPRVHTEKKSLPSKGKRTSLCAF-------VLDFFSLKHIEETFRVAFKKGANNRQKRVIVLMVVVMVVIGPLYGEMAVLYLYMRYRYNWNEVTFSMFSTFGMVTNLIGTAISVGIFSHILKIDDAIVGIMSCTSKILASFVYAFATSTWMVYVAAIVEIVNGTSFIAMRSIASKLVPTDELGKVNSLFGVCESLMPLVYGPMYSAIYAATMKTFPGTFFLAGGCMTMPAVLGFLWLYTEHRKDRMLKEQKEPEAM 511          
BLAST of EMLSAG00000003292 vs. nr
Match: gi|380015515|ref|XP_003691746.1| (PREDICTED: solute carrier family 46 member 3 [Apis florea])

HSP 1 Score: 221.861 bits (564), Expect = 7.997e-63
Identity = 143/452 (31.64%), Postives = 236/452 (52.21%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQ-----HEEIQTEVQKYVSQLQAYNFFLQ-GLPAVIYSLFAGPWSDING-RKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYL-LFECL-QDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSE-DQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCL 447
            +K  Y   NIT+EP++  + +   L S+  Q+L + K C VNL +   +C  + +     +E  +T VQ+ V+ +Q +   L  GLP ++  LF G WSD  G RK  ++L   G   ++V  LL T FF E+  E   + E L    TGG+   F    SYI DIT   SRT R+   +    +G  +G+ LSGI+  KLGF   FS++ V    S +Y +  IKE       +++ TD    +  A+       I   F  +H +   +   K+  ++ +K +L L++I M+ +    G+ +VM+LY+R R+ W E+ FS F     +  L+     +   SH LK  D  + +++    I+AGF++ FA   W++Y+A IV  +       +RS+ SK + + E+GKV S++   ++++ +I  P+YS +Y AT+  FPG  F+V +C+
Sbjct:    5 QKWSYFTRNITVEPMIACYVIPCMLASLATQNLSLEKACRVNLAYPDDVCTALARRNTTGYETEETAVQQLVAGMQTWKTALSSGLPTILI-LFMGSWSDRTGLRKPCMLLPIVGEFLSSVSMLLCTYFFHEVPMEATGVLEALWPALTGGWFTMFMGVFSYIADITSVESRTLRIGAANVFLSLGVPIGMALSGILYLKLGFYGVFSISTVCYVLSFIYGLVVIKEPPKPYLKKMEKTDKERMSVCAS-------ILDFFAFRHIEETFRVAFKQGRNNRQKRVLMLMVIVMVVIGPLYGEMAVMYLYMRYRYHWNEVMFSMFTTFAMVTNLIGTAISVGVFSHILKIDDAIVGIMSSMSKILAGFVYAFAITDWMIYLAAIVEIVNGTSFIAMRSIASKLVSTGELGKVNSLLGVCESLMPLIYGPMYSSIYAATMKTFPGTFFIVGACM 448          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold321_size207582-snap-gene-1.31 (protein:Tk05199 transcript:maker-scaffold321_size207582-snap-gene-1.31-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_328037")

HSP 1 Score: 416.001 bits (1068), Expect = 7.202e-134
Identity = 198/446 (44.39%), Postives = 302/446 (67.71%), Query Frame = 0
Query:    9 RYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE-RNSSEDQV-----DNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLY 448
            + +   IT+EP++FLF LSHGLY I  Q+LYI KVC VNLN +  ICD+IY H + Q  VQKYVS+LQAYN  +Q +P++IY+LFAGPWSD  GR+ +I ++CFGY+FNN ++++N  +F+ELKAEYLLFECLQD TGG V FF  C++YI+D++   +RTKR+AFLDG+FPIGF  G+ +SG+IKK+ GF   F L ++ +  ++LYT+F +K+ +++  ++V     +    ++TT+ A    K+    ++F +++ +A  ++T K+R++ +   L  LI  F++E+F+  G+G+ MFLY RK F WTE  F QFM +FG+ GL +QY  +PFL+   K  D  + L  V G+ I   +         +Y+  +V+FLG  I+T  RSL++KC+   E+G VFS++ + QA + + A P +  +YKAT+D FPG+  ++++C Y
Sbjct:  805 KNLCSQITVEPILFLFSLSHGLYMIIAQTLYIEKVCNVNLNFTREICDNIYVHPDEQIAVQKYVSELQAYNGIIQAIPSIIYALFAGPWSDRYGRRTLIAMACFGYIFNNGVFIINAYWFYELKAEYLLFECLQDCTGGSVCFFLGCYAYISDVSTRKNRTKRLAFLDGLFPIGFFTGMSISGLIKKQWGFIPNFFLGMLAALLAVLYTVFVLKDSQDNRPEEVKAMLKEREAASTTTEPAR---KRNVCAQLFDLENLKASFRTTFKKRDNGMGSALTLLIFTFVVEIFMTHGRGATMFLYFRKEFAWTETQFGQFMALFGVVGLFTQYVAVPFLTDTCKIHDTLLGLGGVVGSGINLLIMALVRHDEWLYLGCVVAFLGPTITTSCRSLVTKCVGPFEVGAVFSIMGAIQATVPLAAFPFFGFIYKATVDTFPGMFLIISACFY 1247          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold67_size430214-snap-gene-1.17 (protein:Tk00772 transcript:maker-scaffold67_size430214-snap-gene-1.17-mRNA-1 annotation:"solute carrier family 46 member 3-like isoform x1")

HSP 1 Score: 176.022 bits (445), Expect = 2.402e-49
Identity = 125/476 (26.26%), Postives = 235/476 (49.37%), Query Frame = 0
Query:   14 NITLEPVVFLFGLSHGLYSITVQ--SLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERN-SSEDQ-----VDNTDDNST-TQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFK-WTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFA-NVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLKKVENSRKNAHELREE 478
            +++LEPV+FL+  S+ +     Q  +L ++K C + L ++ T C++   H +++ EVQ Y +       ++   P ++Y+L AG  SD  GRK +++    G +    I++L+ +F++EL      F    +  GG   ++   + Y ++      R  R+A  DG+  I  ++GL LS I     G+   F +    +  ++LY IF+  E   + ED+     +D+ D   T  +   ++V   PI  M           +  KRR  +L+  +      + + LF   G   + +LYL++ F  +   D + + ++     L++ + ++P  + K+ W +  I+ I     +++     FA N+    Y AGI+ FL   +    RSLI++CI+ DEIGK FS +A   +V   I+ P+Y L+Y ATLD FPG ++++T+ + ++   + +Y++   + ++     A    EE
Sbjct:   58 SVSLEPVIFLYVFSNYIMFGAEQGANLKMTKFCELQLGYNKTTCNNRAIHRDVELEVQLYTNMFDLRRQYISMGPILLYTLVAGALSDDFGRKPLLLFPILGRIVGKSIHVLSAIFYYELPLWMYYFTEFHELMGGIPIYYMGVYGYGSNTVKQEKRAARLARFDGVEQIANVVGLALSPIAFMTTGYLGSFLMGTGCNILALLYLIFYTPEPILTREDKGILKCLDSNDPLGTKAKKMLHRVMVTPIVDM---------CTTIFKRRAFNLRMIMFLAFANYGIYLFTL-GNNRLQYLYLKRVFPNFKGEDMAIYNVIVKTFALINLFVLMPLFNGKMGWHETKILSIISSSLVVSFLCRGFARNLVPEFYAAGILGFLQMGLFCTNRSLITRCIQDDEIGKAFSGVAILTSVCMAISQPVYRLLYDATLDGFPGAIYVLTALVLAVASVVNVYMFTQRRHIQVGESEADVPVEE 523          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold345_size201316-snap-gene-0.11 (protein:Tk12164 transcript:maker-scaffold345_size201316-snap-gene-0.11-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_329199")

HSP 1 Score: 167.933 bits (424), Expect = 4.793e-45
Identity = 131/475 (27.58%), Postives = 234/475 (49.26%), Query Frame = 0
Query:    1 MTSIWKKTRYILDNITLEPVVFLFGLSHGLYSITV--QSLYISKVCAVNLNHSLTICD--DIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQV----DNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYG------GKGSVMFLYLRKRFK-WTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVS-WLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLY 459
            M  I ++      +IT+EP +FL+ L     +      +L I KVC    N++ TICD  ++ ++E  +  VQ  V+  Q    ++  +P ++YSLFAG  SD  GRK +++L  FG   ++ + +LN VFF  L  E+   E L  + GG   ++   + Y T ++    RT R+A  DG+   G L+G  LS ++   +G+  C+ L IV    + LY +   KE   ++  +      T +     S    + K  +W +F IQ     V +  + R   L+       +I +++LF+YG       + ++M+LY  K    +     S +  +  I G++    V+P +S +L+  +G +IL  +   +  G + T  +V+ W    +  ++ +     +  RS I+KCIE DE+GK+FS IA   A++ + ++P +  +Y +TL+ FP    L+ + L  ++  L  ++Y
Sbjct:   40 MAGIKERLSRYFGSITIEPAIFLYMLGSVFVNGAALNSNLLIQKVCLQEFNYNATICDHLELEENEYFENNVQTRVNNFQMNAQWIGSVPTLVYSLFAGGLSDEVGRKPLLLLPLFGSALSSCLDILNVVFFDSLPMEFFYVEQLMSYFGGTSVYYLGFYGYGTTVSTPKERTARLARFDGLEQGGALVGTLLSPVLFGWIGYEGCYGLRIVLHIIAFLYVLMVAKEPLKNKGTIFKRSVETPEGPKQLSVLQCIGKG-LWNIF-IQPVIGMVTAVFRSRGKRLR-------MIVLIQLFIYGVYWFIVEENALMYLYSLKVIPGYDGTIHSYYQTLTQIVGVICLLVVMPIVSLRLQLHEG-LILTGISFLLTLGNLLTAFSVNLWQFLASQALASVRICQYSTARSQITKCIEPDEVGKIFSFIALMAALMPVFSNPAFRQLYNSTLNTFPAAFLLLATSLCFLLMCLNFFVY 504          

HSP 2 Score: 68.1662 bits (165), Expect = 2.905e-12
Identity = 69/259 (26.64%), Postives = 125/259 (48.26%), Query Frame = 0
Query:  197 LGFTYCFSLAIVTSWSSILYTIFFIKE----RNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLY-LRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTII-----LIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTS 445
            +G+  C+ L IV    + LY +   KE    + +   +   T +     S    + K  +W +F IQ     + +  + R   L+  +L  + I+ +  F+Y  + ++M+LY L+    +     S +  +  I  +     V+P +S +L+  +G I+     LI +G N++  F     N+  L+    +VS      STL RS I+KCIE DE+GK+FS IA   A++ + ++P +  +Y +TL+ FP    L+ +
Sbjct:  587 IGYEGCYGLRIVLHIIAFLYVLMVAKEPLKNKGTIFKRTVETPEGPKQLSVLQCIGKG-LWNIF-IQPVIGMLTAVFRSRGKRLRMIVLIQLFIYGVYWFIYEEE-ALMYLYNLKVIPGYDGTIHSYYQTLTRIVSVFCLLVVMPIVSLRLQLHEGLILTGISFLITLG-NLLTAFS---VNLWQLLASQALVSVRICQYSTL-RSQITKCIEPDEVGKIFSFIALIAALMPVFSNPAFRQLYNSTLNTFPAAFLLLAT 837          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold517_size150149-snap-gene-0.20 (protein:Tk02938 transcript:maker-scaffold517_size150149-snap-gene-0.20-mRNA-1 annotation:"adenylate cyclase ")

HSP 1 Score: 162.155 bits (409), Expect = 5.327e-43
Identity = 115/448 (25.67%), Postives = 209/448 (46.65%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIY--QHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIF-FIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSI 450
            +K   +  N+T+EPVVF    S GL SI+ + L I K C  +L+    IC+++    + +I  EVQ  V+  + Y    + +  + ++ + G W D+ GR+ I+ L     + +  + +LNTVF    K   L    +    GG  AF  A  ++I+DI+   +R  R+ F+     +   +   +   + ++ GFT   S++ V     +L  IF +I  R             S       + + E I      +H    +K+  K R H  + Y+  +++   + L  + G+  V +LY+RK+F W   +FS +  +    G++ +   IP  +  L   +  + LIA    ++   +   AN  W+ Y       +G   + + ++L+S C    E GK+ S +    ++I MI +P YS ++K T + FPG VFL+++ + +I
Sbjct:   10 QKVALVWSNVTVEPVVFFIHFSQGLDSISEEQLVIIKTCYNDLDFEANICENLLSPNNTDINDEVQDMVADYKVYQTLAKSIFPLFFAFYVGSWCDVFGRRLIMYLFLGAQLVSQALLILNTVFMSWPKEILLAGPLITGIVGGQSAFSLALAAFISDISKPQNRALRIGFIHIATSLPRPIASPIGAWLLREGGFTCVTSVSFV---GIVLGMIFLYINLR-------------SYQWKPPQRPRGEKI-SFLSWKHPYEALKTVFKERPHHRRMYMHLILVALAMILVPFSGESQVQYLYVRKKFGWEVDEFSTYRSIDSTIGILGEIICIPLFAW-LSLNETLVFLIASLSPLLRHILQGVANSEWVFYAGAAADVIGRYSNPVAKALLSACAPLTEFGKILSFVTILDSLIPMIIAPGYSALWKMTDNSFPGAVFLLSAAITTI 439          

HSP 2 Score: 126.331 bits (316), Expect = 5.544e-31
Identity = 107/479 (22.34%), Postives = 211/479 (44.05%), Query Frame = 0
Query:   14 NITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHE-EIQTE-VQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFE---------------------------CLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKERNSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAIYLYFGLK 463
            NIT+EP +FL   S G+ +++V  L I K C  +   S  IC ++      ++ + VQ   SQ   Y  +   +   + +++ G W DI GRKAI++++    +   V  +LN+  F + K E+LL +                           CL   +GG VAF  A  S+++DI+    R  RM  +  +      +       I ++ GF     LA+ +           +     +   +             ++     +  +F   H    VK+  K R  + + YL+ L+++  + +  + G   + FLY R R+ W   +FS F+   G+  +++    +P + +    R+ T++++     ++   +   AN  WL Y    +   G+    + R+L+S C+++ E+GK+ S  A    ++ +I +  Y+ +++AT + FPG V  + + +  +  F+  +++F L+
Sbjct:  508 NITVEPALFLLFFSDGMDNVSVDQLKILKTCKNDFEFSDEICQNLLSGNYTLENDLVQDEASQFNTYVTYASSILPTLLAVYVGAWCDIFGRKAILIMNVSFKLVAQVFLILNS-HFLDWKKEWLLVQPILISLSGSLKKVLLLYSSVTRMLDLFCL--LSGGMVAFQVAVFSFLSDISTPEQRVVRMGMVSIVGAAASPLAHVAGAWILEQGGF-----LAVTS-----------VTGGGIALALIYLLIILRQYHWTPSRAVPRGVLYVFSPTHPVESVKTLFKPRLGNRRMYLILLLVMITVIMAPFAGMSGLYFLYTRTRYGWEVTEFSNFVSFDGVLQVIATAVAMPSI-NCCNIRETTLLIVLSVLGLVRHIVQGLANKPWLFYFGSTLDAAGSFAMPITRALMSMCVDATELGKLLSCQALVNNLVPIIIAQPYASLWQATNESFPGAVMFLCAGITLLGLFVMFFIHFHLR 966          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold428_size174301-snap-gene-0.23 (protein:Tk03106 transcript:maker-scaffold428_size174301-snap-gene-0.23-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_328004")

HSP 1 Score: 103.605 bits (257), Expect = 5.338e-24
Identity = 103/448 (22.99%), Postives = 212/448 (47.32%), Query Frame = 0
Query:    6 KKTRYILDNITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQ--HEEIQTEVQKYVS-QLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYLLNTVFFFELKAEYLLFECLQDFTGGYVAFFFACHSYITDITDDSSRTKRMAFLDGIFPIGFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKE--RNSSEDQVDNTDDNSTTQSANNKVKKEPIWK-MFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQ---GLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVT 444
            +  + ++ ++T+EPV+FL+ L   L     Q+L   KVC  + N   T+C ++Y   HE++  +VQK  S  ++A    + G P+++   + G WSDI GRK  ++L   G +   ++Y +  +F   + A  LL   L    G +        +Y++  +  + RT R++ +  +  +   MG  LSG +  ++     F   +V  +  ILYT+  +K    ++S D+   T                  W+ +F ++H ++  ++   +R    ++ ++ L ++ +  + +  G+  + FL+L+   K  ++D + F   FG +     +    ++P L  K +  D  I LI +   I A  +   +    + ++   +  LG+     +R+++S  +E  E GK+F +++  + V  +  + +++ +Y  T  FF G +FLV+
Sbjct:    3 RTIQRLVRSVTVEPVLFLYMLGVYLLFSVFQNLVYEKVCLQHANA--TVCANLYLPIHEDVLDQVQKDASFWIKASTLAMVG-PSILVDCYMGAWSDIFGRKPPLLLPPLGALLGGLVYCMMELFASHV-AWILLASGLFGIFGSFTGMLTGVLAYMSAASPVAQRTSRISIVISMNFLAGTMGPFLSGFLATRVSPLCVFVCIVVCHFLCILYTLLCVKNIFNHTSSDRSGWT------------------WRQLFSLRHLKSSFETCFIQRSGMERRNIILLFIMAVALMVITSGELDIAFLFLKD--KPMKMDLAIFSYWFGSRYGLSSLMLLVLMPILKQKWEMPDQWICLIGLISKISALILLGLSTTPLMAFLDVPLGCLGSFALASIRAMLSLNVEDHEQGKLFGLLSVVEDVSALCGALLFNSLYPITRSFFNGTMFLVS 426          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold424_size175595-snap-gene-0.26 (protein:Tk01548 transcript:maker-scaffold424_size175595-snap-gene-0.26-mRNA-1 annotation:"proton-coupled folate transporter-like")

HSP 1 Score: 95.1301 bits (235), Expect = 3.686e-22
Identity = 75/278 (26.98%), Postives = 141/278 (50.72%), Query Frame = 0
Query:  182 GFLMGLGLSGIIKKKLGFTYCFSLAIVTSWSSILYTIFFIKER---NSSEDQVDNTDDNSTTQSANNKVKKEPIWKMFKIQHFQAGVKSTLKRREHDLKKYLLFLILIFMLELFLYGGKGSVMFLYLRKRFKWTEIDFSQFMIVFGIQGLVSQYFVIPFLSHKLKWRDGTIILIAVGGNIIAGFMFTFANVSWLVYVAGIVSFLGAAISTLLRSLISKCIESDEIGKVFSVIASGQAVIFMIASPIYSLVYKATLDFFPGLVFLVTSCLYSIVGFLAI 456
            GF +GL  S  +   LG+   F + I  +  ++++    +KE    +SS   +DN +  + TQ  N     E  W +F I++ ++  K   +RREH  ++ LL L+ I ++   ++   G++ +LY R +F W E  +S +  +       +    +P LS  L   DG I +      I    +  F    W++YV   +     + + ++R+++SK    +++GK+F++++  ++ + + A P+ + VY AT+D  PG VFLV + ++ IV FL I
Sbjct:    3 GFPVGLYTSSKVFLLLGYYGVFGITIGINILNVVFIFSMVKETCGPSSSYQLLDNEEVETDTQDTNTS---EANWGLFDIRNVRSVFKVCFRRREHRRRQVLLLLLFIMIVNTTVFN-TGTITYLYTRLKFDWNEQSYSLWTSISATMTSCATVIALPVLSFGLGISDGIIGMFGAVSGIANNILIAFITKDWMMYVCSAIGAFSTSSAIVMRAMLSKVGAKEDLGKIFALVSCLESTVPIFAMPLMTYVYNATIDTLPGTVFLVQAGIFLIV-FLVI 275          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold424_size175595-snap-gene-0.28 (protein:Tk01550 transcript:maker-scaffold424_size175595-snap-gene-0.28-mRNA-1 annotation:"c-type lectin precursor")

HSP 1 Score: 89.7373 bits (221), Expect = 4.547e-20
Identity = 41/108 (37.96%), Postives = 64/108 (59.26%), Query Frame = 0
Query:   15 ITLEPVVFLFGLSHGLYSITVQSLYISKVCAVNLNHSLTICDDIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFAGPWSDINGRKAIIVLSCFGYVFNNVIYL 122
            IT+EP VFLF  ++G ++I  Q+L I KVC VNLN S  +C  +  H+E Q  +Q+ V+ +  Y      +P++   LF GPWSD +GRK +++    G + + +  L
Sbjct:   32 ITIEPAVFLFTFAYGFHNIIAQNLLIEKVCHVNLNLSSEVCAHLEHHKEDQIAIQRTVALISLYTNIASSIPSLFLPLFLGPWSDRHGRKPLLIFPILGAILSQIHKL 139          
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold345_size201316-snap-gene-0.10 (protein:Tk12165 transcript:maker-scaffold345_size201316-snap-gene-0.10-mRNA-1 annotation:"YTP1")

HSP 1 Score: 50.0618 bits (118), Expect = 5.329e-7
Identity = 31/99 (31.31%), Postives = 54/99 (54.55%), Query Frame = 0
Query:    1 MTSIWKKTRYILDNITLEPVVFLF---GLSHGLYSITVQSLYISKVCAVNLNHSLTICD--DIYQHEEIQTEVQKYVSQLQAYNFFLQGLPAVIYSLFA 94
            M  I ++      +IT+EP +FL+   G+  G  ++   +L I KVC    N++ TICD  ++ ++E  +  VQ  V+  Q    ++  +P ++YSLFA
Sbjct:  163 MAGIKERLSRYFGSITIEPAIFLYMLGGVIVGGAALN-SNLLIQKVCLQEFNYNATICDHLELEENEYFENNVQTRVNNFQMNAQWIGSVPTLVYSLFA 260          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000003292 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-2.684e-5727.10symbol:CG15890 species:7227 "Drosophila melanogast... [more]
-9.019e-4125.47symbol:CG30345 species:7227 "Drosophila melanogast... [more]
-8.304e-3324.19symbol:CG42514 species:7227 "Drosophila melanogast... [more]
-2.992e-3224.95symbol:zgc:174356 "zgc:174356" species:7955 "Danio... [more]
-3.619e-3022.50symbol:CG15553 species:7227 "Drosophila melanogast... [more]
-1.035e-2923.23symbol:CG30344 species:7227 "Drosophila melanogast... [more]
-1.578e-2523.77symbol:CELE_Y4C6B.5 "Protein Y4C6B.5" species:6239... [more]
-8.493e-2521.76symbol:CG31321 species:7227 "Drosophila melanogast... [more]
-1.346e-2423.34symbol:slc46a1 "solute carrier family 46, member 1... [more]
-7.932e-2122.44symbol:CELE_F40F9.5 "Protein F40F9.5" species:6239... [more]

Pages

back to top
BLAST of EMLSAG00000003292 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592781617|gb|GAXK01172951.1|2.119e-13344.47TSA: Calanus finmarchicus comp133348_c0_seq1 trans... [more]
gi|592913554|gb|GAXK01044821.1|7.349e-10438.68TSA: Calanus finmarchicus comp308449_c0_seq1 trans... [more]
gi|592790734|gb|GAXK01163834.1|8.993e-9235.59TSA: Calanus finmarchicus comp383868_c1_seq3 trans... [more]
gi|592790735|gb|GAXK01163833.1|2.429e-8834.72TSA: Calanus finmarchicus comp383868_c1_seq2 trans... [more]
gi|592839976|gb|GAXK01117568.1|1.342e-8634.37TSA: Calanus finmarchicus comp607424_c0_seq1 trans... [more]
gi|592790736|gb|GAXK01163832.1|1.838e-8634.17TSA: Calanus finmarchicus comp383868_c1_seq1 trans... [more]
gi|592942902|gb|GAXK01015651.1|1.602e-7934.19TSA: Calanus finmarchicus comp504837_c0_seq2 trans... [more]
gi|592776967|gb|GAXK01177601.1|2.436e-7941.79TSA: Calanus finmarchicus comp279172_c0_seq1 trans... [more]
gi|592913553|gb|GAXK01044822.1|5.667e-7938.66TSA: Calanus finmarchicus comp308449_c0_seq2 trans... [more]
gi|592942903|gb|GAXK01015650.1|5.774e-7934.19TSA: Calanus finmarchicus comp504837_c0_seq1 trans... [more]

Pages

back to top
BLAST of EMLSAG00000003292 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 5
Match NameE-valueIdentityDescription
EMLSAP000000032920.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s180:49317... [more]
EMLSAP000000023561.058e-10541.20pep:novel supercontig:LSalAtl2s:LSalAtl2s144:17254... [more]
EMLSAP000000060223.242e-6130.37pep:novel supercontig:LSalAtl2s:LSalAtl2s327:12327... [more]
EMLSAP000000034641.658e-2526.62pep:novel supercontig:LSalAtl2s:LSalAtl2s18:112576... [more]
EMLSAP000000012066.675e-1520.92pep:novel supercontig:LSalAtl2s:LSalAtl2s11:115361... [more]
back to top
BLAST of EMLSAG00000003292 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
gi|81170641|sp|Q7ZWG6.1|PCFT_DANRE1.101e-2423.34RecName: Full=Proton-coupled folate transporter; A... [more]
gi|81170644|sp|Q6DCX5.1|PCFT_XENLA7.282e-2223.06RecName: Full=Proton-coupled folate transporter; A... [more]
gi|82125466|sp|Q5F4B8.1|S46A3_CHICK1.079e-1926.89RecName: Full=Solute carrier family 46 member 3; F... [more]
gi|81882604|sp|Q5BK75.1|S46A3_RAT9.503e-1925.56RecName: Full=Solute carrier family 46 member 3; F... [more]
gi|81906124|sp|Q9DC26.1|S46A3_MOUSE7.450e-1523.72RecName: Full=Solute carrier family 46 member 3; F... [more]
gi|74723295|sp|Q7Z3Q1.1|S46A3_HUMAN8.035e-1524.66RecName: Full=Solute carrier family 46 member 3; F... [more]
gi|75055077|sp|Q5RBM3.1|S46A3_PONAB2.457e-1424.21RecName: Full=Solute carrier family 46 member 3; F... [more]
gi|122131744|sp|Q05B81.1|PCFT_BOVIN4.407e-1423.16RecName: Full=Proton-coupled folate transporter; A... [more]
gi|74732636|sp|Q96NT5.1|PCFT_HUMAN7.257e-1323.71RecName: Full=Proton-coupled folate transporter; A... [more]
gi|81170643|sp|Q5EBA8.1|PCFT_RAT1.184e-1222.88RecName: Full=Proton-coupled folate transporter; A... [more]

Pages

back to top
BLAST of EMLSAG00000003292 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EFX69295.11.640e-6333.33hypothetical protein DAPPUDRAFT_329198 [Daphnia pu... [more]
gb|EFA05964.2|5.087e-6129.67Solute carrier family 46 member 3-like Protein [Tr... [more]
XP_003249365.11.905e-6031.72PREDICTED: solute carrier family 46 member 3 isofo... [more]
EFX69296.12.033e-6030.94hypothetical protein DAPPUDRAFT_329199 [Daphnia pu... [more]
AHN59715.11.159e-5827.10uncharacterized protein Dmel_CG15890, isoform B [D... [more]
AAF48383.11.159e-5827.10uncharacterized protein Dmel_CG15890, isoform A [D... [more]
EAL40562.44.339e-5728.34AGAP004562-PA [Anopheles gambiae str. PEST][more]
EFX69308.11.354e-5629.91hypothetical protein DAPPUDRAFT_329228 [Daphnia pu... [more]
gb|KYB25977.1|7.217e-5428.66Proton-coupled folate transporter-like Protein [Tr... [more]
gb|EFA08602.2|1.060e-5328.66Proton-coupled folate transporter-like Protein [Tr... [more]

Pages

back to top
BLAST of EMLSAG00000003292 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|769863992|ref|XP_011643864.1|5.317e-6830.61PREDICTED: solute carrier family 46 member 3-like ... [more]
gi|826473116|ref|XP_012536545.1|5.653e-6730.12PREDICTED: solute carrier family 46 member 3-like ... [more]
gi|936691629|ref|XP_014223806.1|1.314e-6632.05PREDICTED: solute carrier family 46 member 3-like ... [more]
gi|759050037|ref|XP_011334087.1|1.487e-6631.31PREDICTED: solute carrier family 46 member 3 [Cera... [more]
gi|987909922|ref|XP_015430616.1|9.664e-6631.60PREDICTED: uncharacterized protein LOC107187121 [D... [more]
gi|766939152|ref|XP_011502116.1|2.002e-6530.30PREDICTED: solute carrier family 46 member 3-like ... [more]
gi|751220928|ref|XP_011163622.1|1.466e-6430.41PREDICTED: solute carrier family 46 member 3 [Sole... [more]
gi|817221765|ref|XP_012286336.1|3.336e-6330.00PREDICTED: uncharacterized protein LOC105702940 [O... [more]
gi|780613805|ref|XP_011690945.1|3.810e-6330.37PREDICTED: solute carrier family 46 member 3 [Wasm... [more]
gi|380015515|ref|XP_003691746.1|7.997e-6331.64PREDICTED: solute carrier family 46 member 3 [Apis... [more]

Pages

back to top
BLAST of EMLSAG00000003292 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 8
Match NameE-valueIdentityDescription
maker-scaffold321_size207582-snap-gene-1.317.202e-13444.39protein:Tk05199 transcript:maker-scaffold321_size2... [more]
maker-scaffold67_size430214-snap-gene-1.172.402e-4926.26protein:Tk00772 transcript:maker-scaffold67_size43... [more]
maker-scaffold345_size201316-snap-gene-0.114.793e-4527.58protein:Tk12164 transcript:maker-scaffold345_size2... [more]
maker-scaffold517_size150149-snap-gene-0.205.327e-4325.67protein:Tk02938 transcript:maker-scaffold517_size1... [more]
maker-scaffold428_size174301-snap-gene-0.235.338e-2422.99protein:Tk03106 transcript:maker-scaffold428_size1... [more]
maker-scaffold424_size175595-snap-gene-0.263.686e-2226.98protein:Tk01548 transcript:maker-scaffold424_size1... [more]
maker-scaffold424_size175595-snap-gene-0.284.547e-2037.96protein:Tk01550 transcript:maker-scaffold424_size1... [more]
maker-scaffold345_size201316-snap-gene-0.105.329e-731.31protein:Tk12165 transcript:maker-scaffold345_size2... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s180supercontigLSalAtl2s180:493171..494827 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Biotypeprotein_coding
Descriptionmaker-LSalAtl2s180-augustus-gene-4.19
EvidenceIEA
Logic nameensemblgenomes
NoteProton-coupled folate transporter
NoteProton-coupled folate transporter
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000003292 (primary cross-reference)
Add to Basket