EMLSAG00000003935, EMLSAG00000003935-686701 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Match: gi|592801960|gb|GAXK01152608.1| (TSA: Calanus finmarchicus comp1824764_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 3.951e-1 Identity = 12/50 (24.00%), Postives = 30/50 (60.00%), Query Frame = 0 Query: 9 EAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLYRESSI 58 EA +++ C N+++ + +N+ L +++F Y V+ Y +++ E++I Sbjct: 919 EACSMTSCQNMEVRQINNFCTRLEIK*KKIIFGYMQVL*YTMDVGEEATI 1068
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Match: gi|592874944|gb|GAXK01082633.1| (TSA: Calanus finmarchicus comp351461_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.317e+0 Identity = 12/31 (38.71%), Postives = 20/31 (64.52%), Query Frame = 0 Query: 29 NGLRASTFRLVFAYSSVMHYGLNLYRESSIP 59 +G+R+ F+L+F+ S+MH NL R + P Sbjct: 427 SGIRSIDFKLLFSMKSLMHSAKNLNRFTPGP 519
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Match: gi|592874945|gb|GAXK01082632.1| (TSA: Calanus finmarchicus comp351461_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 1.320e+0 Identity = 12/31 (38.71%), Postives = 20/31 (64.52%), Query Frame = 0 Query: 29 NGLRASTFRLVFAYSSVMHYGLNLYRESSIP 59 +G+R+ F+L+F+ S+MH NL R + P Sbjct: 427 SGIRSIDFKLLFSMKSLMHSAKNLNRFTPGP 519
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Match: gi|592862260|gb|GAXK01095302.1| (TSA: Calanus finmarchicus comp1395496_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 3.276e+0 Identity = 12/35 (34.29%), Postives = 18/35 (51.43%), Query Frame = 0 Query: 19 IDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 +D +Y Y+G + Y+SVMHY LN + Sbjct: 809 VDGTDYSTCYSGWTVDACGFGYDYTSVMHYRLNSF 913
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Match: gi|592896999|gb|GAXK01061376.1| (TSA: Calanus finmarchicus comp4002107_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 3.359e+0 Identity = 12/35 (34.29%), Postives = 19/35 (54.29%), Query Frame = 0 Query: 19 IDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 +D +Y N Y+G + Y+S+MHY LN + Sbjct: 356 VDGTDYSNCYSGWTVDAGFFSYDYTSIMHYRLNSF 460
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Match: gi|592781601|gb|GAXK01172967.1| (TSA: Calanus finmarchicus comp133223_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.5646 bits (57), Expect = 7.000e+0 Identity = 11/36 (30.56%), Postives = 18/36 (50.00%), Query Frame = 0 Query: 13 ISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHY 48 I F N DI++YD ++ + YS ++HY Sbjct: 277 IHFLINTDINQYDEHWQPIALRCRMCQLDYSHILHY 384
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Match: gi|592828015|gb|GAXK01128940.1| (TSA: Calanus finmarchicus comp2181697_c0_seq1 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 8.883e+0 Identity = 13/24 (54.17%), Postives = 14/24 (58.33%), Query Frame = 0 Query: 29 NGLRASTFRLVFAYSSVMHYGLNL 52 NGL RLV S V H+GLNL Sbjct: 21 NGLMVVDIRLVDFESIVFHFGLNL 92
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000003935 (pep:novel supercontig:LSalAtl2s:LSalAtl2s211:470969:473694:1 gene:EMLSAG00000003935 transcript:EMLSAT00000003935 description:"snap_masked-LSalAtl2s211-processed-gene-4.1") HSP 1 Score: 123.635 bits (309), Expect = 1.464e-38 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0 Query: 1 MTKVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLYRESSIP 59 MTKVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLYRESSIP Sbjct: 1 MTKVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLYRESSIP 59
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000004642 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2429:10582:11934:-1 gene:EMLSAG00000004642 transcript:EMLSAT00000004642 description:"maker-LSalAtl2s2429-snap-gene-0.4") HSP 1 Score: 65.4698 bits (158), Expect = 1.663e-14 Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE EA TI +CGN+ ID+YDN Y G R STF + + Y S+MHYGL + Sbjct: 178 RALGENEAATIPYCGNVGIDQYDNCYAGFRTSTFGMAYDYGSIMHYGLTYF 228
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000010457 (pep:novel supercontig:LSalAtl2s:LSalAtl2s693:239007:240470:1 gene:EMLSAG00000010457 transcript:EMLSAT00000010457 description:"maker-LSalAtl2s693-augustus-gene-1.22") HSP 1 Score: 64.6994 bits (156), Expect = 3.899e-14 Identity = 28/51 (54.90%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE E TI +CGN+ ID+YDN Y G RASTF L + Y S+MHYGL + Sbjct: 178 RALGENEPATIPYCGNVGIDQYDNCYAGFRASTFGLDYDYGSIMHYGLKYF 228
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000008419 (pep:novel supercontig:LSalAtl2s:LSalAtl2s515:105196:106792:1 gene:EMLSAG00000008419 transcript:EMLSAT00000008419 description:"augustus_masked-LSalAtl2s515-processed-gene-1.4") HSP 1 Score: 63.1586 bits (152), Expect = 1.266e-13 Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE EA +I +CGN+ ID+YD+ Y G R STF L + Y SVMHYGL + Sbjct: 192 RALGENEAASIPYCGNVGIDQYDSCYAGFRTSTFGLAYDYGSVMHYGLTYF 242
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000002719 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1573:23837:25175:-1 gene:EMLSAG00000002719 transcript:EMLSAT00000002719 description:"maker-LSalAtl2s1573-snap-gene-0.5") HSP 1 Score: 62.003 bits (149), Expect = 2.295e-13 Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE E TI +CG + +D+YDN Y G RASTF L + Y S+MHYGL + Sbjct: 140 RALGENEPATIPYCGRVGVDQYDNCYAGFRASTFGLNYDYGSIMHYGLRYF 190
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000011131 (pep:novel supercontig:LSalAtl2s:LSalAtl2s756:274080:275679:1 gene:EMLSAG00000011131 transcript:EMLSAT00000011131 description:"maker-LSalAtl2s756-augustus-gene-2.11") HSP 1 Score: 61.2326 bits (147), Expect = 6.212e-13 Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE E TI +CGN+ ID+YDN G RA+TF L + Y S+MHYGL + Sbjct: 191 RALGENEPATIGYCGNVGIDQYDNCIAGFRAATFGLDYDYGSIMHYGLRFF 241
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000007463 (pep:novel supercontig:LSalAtl2s:LSalAtl2s427:23035:25185:1 gene:EMLSAG00000007463 transcript:EMLSAT00000007463 description:"maker-LSalAtl2s427-augustus-gene-0.3") HSP 1 Score: 60.4622 bits (145), Expect = 1.304e-12 Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE EAVTI +CG + ID+YDN G R STF + + Y S+MHYGL + Sbjct: 178 RALGENEAVTIPYCGIVGIDQYDNCNAGFRTSTFGMAYDYGSIMHYGLTYF 228
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000006562 (pep:novel supercontig:LSalAtl2s:LSalAtl2s35:27234:28536:-1 gene:EMLSAG00000006562 transcript:EMLSAT00000006562 description:"maker-LSalAtl2s35-augustus-gene-0.13") HSP 1 Score: 60.077 bits (144), Expect = 1.388e-12 Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE E I +CG++ +D+YDN Y G RASTF L + Y S+MHYGL + Sbjct: 178 RALGENEPAAIPYCGSVGVDQYDNCYAGFRASTFGLNYDYGSIMHYGLRYF 228
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000002545 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1504:22086:22572:-1 gene:EMLSAG00000002545 transcript:EMLSAT00000002545 description:"maker-LSalAtl2s1504-snap-gene-0.5") HSP 1 Score: 57.3806 bits (137), Expect = 2.556e-12 Identity = 26/48 (54.17%), Postives = 32/48 (66.67%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGL 50 + GE E+ TIS C + ID+YDN Y G R STF L + Y S+MHYGL Sbjct: 83 RALGENESPTISTCRKVGIDQYDNCYVGFRTSTFGLAYDYESIMHYGL 130
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Match: EMLSAP00000008430 (pep:novel supercontig:LSalAtl2s:LSalAtl2s515:66838:105398:-1 gene:EMLSAG00000008430 transcript:EMLSAT00000008430 description:"maker-LSalAtl2s515-augustus-gene-1.20") HSP 1 Score: 52.7582 bits (125), Expect = 8.623e-10 Identity = 23/47 (48.94%), Postives = 35/47 (74.47%), Query Frame = 0 Query: 6 GERE-AVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLN 51 GE+E A ++ C ++ ID+YDN ++G RASTF + + +SS+MHYG N Sbjct: 251 GEKEKATSLPDCKSVGIDQYDNCHSGFRASTFDIEYDFSSIMHYGWN 297
BLAST of EMLSAG00000003935 vs. nr
Match: gi|155966197|gb|ABU41053.1| (metalloproteinase [Lepeophtheirus salmonis]) HSP 1 Score: 60.4622 bits (145), Expect = 2.279e-9 Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 0 Query: 3 KVAGEREAVTISFCGNIDIDEYDNYYNGLRASTFRLVFAYSSVMHYGLNLY 53 + GE EAVTI +CG + ID+YDN G R STF + + Y S+MHYGL + Sbjct: 137 RALGENEAVTIPYCGIVGIDQYDNCNAGFRTSTFGMAYDYGSIMHYGLTYF 187 The following BLAST results are available for this feature:
BLAST of EMLSAG00000003935 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000003935 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 7
BLAST of EMLSAG00000003935 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 10
BLAST of EMLSAG00000003935 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000003935 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000003935 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 1
BLAST of EMLSAG00000003935 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s211:470969..473694+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000003935-686701 ID=EMLSAG00000003935-686701|Name=EMLSAG00000003935|organism=Lepeophtheirus salmonis|type=gene|length=2726bp|location=Sequence derived from alignment at LSalAtl2s211:470969..473694+ (Lepeophtheirus salmonis)back to top Add to Basket
|