EMLSAG00000004251, EMLSAG00000004251-687017 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926731|gb|GAXK01031721.1| (TSA: Calanus finmarchicus comp20470_c2_seq18 transcribed RNA sequence) HSP 1 Score: 30.0314 bits (66), Expect = 7.367e-1 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 245 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 346
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926733|gb|GAXK01031719.1| (TSA: Calanus finmarchicus comp20470_c2_seq16 transcribed RNA sequence) HSP 1 Score: 30.0314 bits (66), Expect = 7.708e-1 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 386 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 487
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926734|gb|GAXK01031718.1| (TSA: Calanus finmarchicus comp20470_c2_seq15 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 2.998e+0 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 696 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 797
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926736|gb|GAXK01031716.1| (TSA: Calanus finmarchicus comp20470_c2_seq13 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.079e+0 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 965 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 1066
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926744|gb|GAXK01031708.1| (TSA: Calanus finmarchicus comp20470_c2_seq5 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.194e+0 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 1751 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 1852
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926745|gb|GAXK01031707.1| (TSA: Calanus finmarchicus comp20470_c2_seq4 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.195e+0 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 1769 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 1870
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926746|gb|GAXK01031706.1| (TSA: Calanus finmarchicus comp20470_c2_seq3 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.197e+0 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 1791 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 1892
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926747|gb|GAXK01031705.1| (TSA: Calanus finmarchicus comp20470_c2_seq2 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.200e+0 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 1821 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 1922
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926748|gb|GAXK01031704.1| (TSA: Calanus finmarchicus comp20470_c2_seq1 transcribed RNA sequence) HSP 1 Score: 28.4906 bits (62), Expect = 3.205e+0 Identity = 13/34 (38.24%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S R+ ELL WQ HL+ Sbjct: 1881 LAMTCPALPLSQWTRGSTRLCGELLGWQREPHLL 1982
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Match: gi|592926729|gb|GAXK01031723.1| (TSA: Calanus finmarchicus comp20470_c2_seq20 transcribed RNA sequence) HSP 1 Score: 27.335 bits (59), Expect = 5.249e+0 Identity = 12/34 (35.29%), Postives = 18/34 (52.94%), Query Frame = 0 Query: 33 LRISSTLLQTKKWPRFSVRIASELLVWQNSSHLI 66 L ++ L +W R S ++ ELL WQ HL+ Sbjct: 20 LAMTCPALPLSQWTRGSTKLYGELLEWQREPHLL 121
BLAST of EMLSAG00000004251 vs. L. salmonis peptides
Match: EMLSAP00000004251 (pep:novel supercontig:LSalAtl2s:LSalAtl2s222:654528:655752:1 gene:EMLSAG00000004251 transcript:EMLSAT00000004251 description:"maker-LSalAtl2s222-augustus-gene-6.18") HSP 1 Score: 186.422 bits (472), Expect = 3.538e-62 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 0 Query: 1 MSSETLLERRKLLVPNALNSFGPILRNMISKILRISSTLLQTKKWPRFSVRIASELLVWQNSSHLICLNYVPLKFLSFVRLFCKRLMYFDSYI 93 MSSETLLERRKLLVPNALNSFGPILRNMISKILRISSTLLQTKKWPRFSVRIASELLVWQNSSHLICLNYVPLKFLSFVRLFCKRLMYFDSYI Sbjct: 1 MSSETLLERRKLLVPNALNSFGPILRNMISKILRISSTLLQTKKWPRFSVRIASELLVWQNSSHLICLNYVPLKFLSFVRLFCKRLMYFDSYI 93 The following BLAST results are available for this feature:
BLAST of EMLSAG00000004251 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000004251 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 11
Pagesback to top
BLAST of EMLSAG00000004251 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000004251 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000004251 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000004251 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000004251 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s222:654528..655752+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000004251-687017 ID=EMLSAG00000004251-687017|Name=EMLSAG00000004251|organism=Lepeophtheirus salmonis|type=gene|length=1225bp|location=Sequence derived from alignment at LSalAtl2s222:654528..655752+ (Lepeophtheirus salmonis)back to top Add to Basket
|