EMLSAG00000004874, EMLSAG00000004874-687640 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000004874
Unique NameEMLSAG00000004874-687640
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
AV F353 female
  1. PreAdult2
normal
no visible phenotype
14.03.2019 - 09:00
24.04.2019 - 09:00
AV F352 female
  1. PreAdult2
normal
no visible phenotype
14.03.2019 - 09:00
24.04.2019 - 09:00
Homology
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:Epx "eosinophil peroxidase" species:10116 "Rattus norvegicus" [GO:0002215 "defense response to nematode" evidence=IEA;ISO] [GO:0003674 "molecular_function" evidence=ND] [GO:0004601 "peroxidase activity" evidence=IEA;ISO] [GO:0005575 "cellular_component" evidence=ND] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0008150 "biological_process" evidence=ND] [GO:0020037 "heme binding" evidence=IEA] [GO:0032693 "negative regulation of interleukin-10 production" evidence=IEA;ISO] [GO:0032714 "negative regulation of interleukin-5 production" evidence=IEA;ISO] [GO:0032753 "positive regulation of interleukin-4 production" evidence=IEA;ISO] [GO:0055114 "oxidation-reduction process" evidence=ISO] [GO:0072677 "eosinophil migration" evidence=IEA;ISO] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 RGD:1311882 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 EMBL:CH473948 SUPFAM:SSF48113 GO:GO:0032753 Gene3D:1.10.640.10 GO:GO:0032693 GO:GO:0032714 GO:GO:0002215 GeneTree:ENSGT00550000074325 CTD:8288 KO:K10788 OMA:MHVALGL OrthoDB:EOG7M0NQW TreeFam:TF314316 GO:GO:0072677 EMBL:AABR06065051 RefSeq:NP_001100507.1 UniGene:Rn.17695 Ensembl:ENSRNOT00000011735 GeneID:303414 KEGG:rno:303414 NextBio:651330 PRO:PR:D3ZSY4 Uniprot:D3ZSY4)

HSP 1 Score: 306.22 bits (783), Expect = 5.676e-88
Identity = 203/564 (35.99%), Postives = 288/564 (51.06%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIA------STMVSQWGMFVAHDLSFVPNSHEAKC------CEG--AKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSST---PREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGKGS--------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISE--------NIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKIS 620
            KYR + G+CNN   P  G+    L R+LP +YED  S P   +  K R G +    LP  R VS+ +   V  PS         S M  QWG F+ HDL F P S           CE   A+   C PI+I  ND    +    C+ F+RS   C       R Q N +TSF+DAS VYGS     L L+   +YL          D+G+ LLP D                  F+ GD+RA  T  LA++HTLFVREHNR++ +L ++NP ++ + ++ E R+I+GAM+Q I Y +FLP +LG+  M  +   L     Y   ++P VA+VF   A+RFGH+M+Q  + RL  +  + + N  +       A++      GI+ IL GL   PA+    D  +V E+ + LF   +  G DL A  + R RDHGLP Y  WR FCGL       ++P  +++        N+      LY +P++IDI    +AE  +P + +GP   C+   QF   +DGDRF++    + G FT +Q KALR+ SLSR++CDNTGI  +S
Sbjct:  144 KYRTITGRCNNRRRPWLGASNQALARWLPAEYEDHRSLPFGWTPGKRRNGFL----LPLVRAVSNQI---VRFPSKKLTSDQGRSLMFMQWGQFIDHDLDFTPESPARVTFNMGVDCEKTCAQLPPCFPIKIPPNDPRIKS-QRDCIPFFRSAPACPQNRNKVRNQINSLTSFVDASMVYGSEVSLALRLRNRTNYLGLLATNQQFQDNGRALLPFDNLHEDPCLLTNRLVRIPCFLAGDSRASETPKLAALHTLFVREHNRLATELKRLNPHWSGDKLYNEARKIVGAMVQIITYRDFLPLVLGKARMRRT---LGPYRGYCSNVDPRVANVFT-LAFRFGHTMLQPFMFRLDSQYRTSAPNSHVLLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDSMLVDELRDKLFQQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGL-------SQPRNLAQLSRVLKNRNLARKFLNLYKTPDNIDIWVGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQ---KWGVFTKRQRKALRRISLSRIVCDNTGISTVS 685          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:CG10211 species:7227 "Drosophila melanogaster" [GO:0004601 "peroxidase activity" evidence=ISS] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 EMBL:AE014134 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 Gene3D:1.10.640.10 eggNOG:NOG262194 GeneTree:ENSGT00550000074325 OrthoDB:EOG7B5WV5 OMA:GSTKCEA EMBL:AY051952 RefSeq:NP_609883.1 UniGene:Dm.455 SMR:Q9VJ80 IntAct:Q9VJ80 MINT:MINT-974149 EnsemblMetazoa:FBtr0081069 GeneID:35106 KEGG:dme:Dmel_CG10211 UCSC:CG10211-RA FlyBase:FBgn0032685 InParanoid:Q9VJ80 GenomeRNAi:35106 NextBio:791894 Uniprot:Q9VJ80)

HSP 1 Score: 316.235 bits (809), Expect = 6.149e-88
Identity = 200/569 (35.15%), Postives = 302/569 (53.08%), Query Frame = 0
Query:   79 LIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP---NSHEA----KCCEGAKD--DRCLPIRIYENDLFYSNFNVT-----CLNFYRSVRFCSST-PREQYNEITSFIDASNVYGSSDEELLLLKEENSY--LMKSTLTDDGKELLP-------KDGKG-SFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASV----FVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PY-GADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGI 616
            L+   + +L+ C      CD N  +R ++G+CNN  NP +G       R LP +YED  S P        R   ++   LPN R +S+T+H D+    T  S MV Q+  FV HDL+  P     HE+    + C   +     C P  +   D +Y   NVT     C    RS+    S  PR+Q N+ T F+D S VYG   E   L  +   +   M ST    GKELLP       K   G  F+GGD RA    GL ++HT F+REHNRI   L  +NP +  E +F   R+I+ A +Q+IV++EFLP +L   ++N  GL L  P  Y+++ NP+ + +    F AAA+R GHS+++ ++ RL+++         L +D F   +   + G+ I+EIL GL   P ++ D+F+  EVTN+LF + K P+ G DL A  I R RDHG+PSY ++R  C L+   +WN+   EI   +    +++Y+S +DID+    + E P+   ++GPT  CIIG QF  L+  DRF++ +      FT  Q+  +R+ +L++++C+N  I
Sbjct:  695 LLGGAQKQLDTCPEPSQQCDANSPFRTLSGRCNNLRNPNWGKSLTTFSRLLPAQYEDGISAP--------RLTGVTGTALPNPRTISTTIHPDISNLHTRYSLMVMQFAQFVDHDLTLTPIHKGFHESIPSCRPCNSRQTVHPECNPFPVPAGDFYYPEVNVTSGERFCFPSMRSLPGQQSLGPRDQINQNTHFLDGSMVYG---ETTCLSNKLRGFSGRMNSTQVR-GKELLPLGPHPECKSRNGLCFLGGDDRASEQPGLTAIHTAFLREHNRIVEGLRGVNPHWNGEQLFHHARKIVSAQVQHIVFNEFLPRILSWNAVNLYGLKL-LPQGYYKDYNPSCSPIVFNEFAAAAFRIGHSLLRPHIPRLSVQHQPVEPPL-LLRDGFFRMDALLQPGI-IDEILRGLVATPMETLDQFITGEVTNHLFEDRKIPFSGIDLIALNIQRARDHGIPSYNNYRALCNLKRATNWNDLSREIPTEVINRFQKIYASVDDIDLFPGAMTERPLQGGLVGPTLACIIGIQFRQLRKCDRFWYENQNPEVKFTEAQLAEVRKVTLAKIVCENLEI 1248          

HSP 2 Score: 166.007 bits (419), Expect = 5.195e-40
Identity = 147/544 (27.02%), Postives = 229/544 (42.10%), Query Frame = 0
Query:   96 DCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTV--HTDVDVPSTIASTMVSQWGMFVAHDLSFV---PNSHEAKCCE---GAKDDRCLPIRIYENDLFYSNFNVTCLNFYRS-----VRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFC------------GLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMC 611
            D  P  KYR    +CNN  +  +G++    QR L   Y D  S P  +    A         LP+A  V   +  H + ++     + M+  WG  +A+DL  V   P S   KCCE     KD         E    +      C  + RS     +  C    R+Q N  +++ID S +YGS+  E   L+         T    G ++  +  K   V G   AL        H   +++HN I  +L+ +NP ++ E VF E RRI+ A +Q+I Y+EFLP +LG+++  + GL L   K+ S+Y   +   + + F  AA     SM    +    +  +   S  +L K    +      N  G  E+                                    A  + RGRDHG+ SY    + C              + L   +N P E   N    L+++Y + NDID+    L E P+  ++ GPT +C++  QF  LK  DRF++ ++    SFT  Q+K++RQT+LS ++C
Sbjct:   62 DVCPPSKYRQPTAECNNVSHRKWGARGDIFQRLLAADYADGVSQPRTSKGTHA---------LPDAEVVIEQLQRHVEGELRHAHITAMLPAWGQLLANDLVEVGQLPIS--GKCCERDSAVKDPS-------ELQHCFVRAGPDCKEYKRSAPGFDLEACQKHTRQQMNIASAYIDGSGLYGSTRHEFDQLR---------TYISGGVKV--ESCKYCQVAGATGAL--------HRALLQQHNNIGERLSHINPDWSEEDVFLEARRIITATIQHITYNEFLPLVLGQETTAKEGLRLTAEKHSSNYSSSVRGGIYNEFATAAMPAFWSMYPPEMLAKKMSAHELLSIAALQKSLVPSQT----NAEGWSEL------------------------------------ALAVHRGRDHGVASYVHALDLCERRFADQSAANVSFDTLAQVSNIPEEYITN----LRDIYQNANDIDLLVGALLEEPVVGALFGPTISCLLSLQFEQLKQTDRFWYENEIPPSSFTLDQLKSIRQTTLSGLLC 524          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:CELE_T06D8.10 "Protein T06D8.10" species:6239 "Caenorhabditis elegans" [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 EMBL:Z49130 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 OrthoDB:EOG7B5WV5 EMBL:Z49129 PIR:F88311 PIR:T24502 RefSeq:NP_496407.1 UniGene:Cel.14438 ProteinModelPortal:G5ECK5 SMR:G5ECK5 IntAct:G5ECK5 PRIDE:G5ECK5 EnsemblMetazoa:T06D8.10 GeneID:174717 KEGG:cel:CELE_T06D8.10 CTD:174717 WormBase:T06D8.10 OMA:GSTKCEA NextBio:885196 Uniprot:G5ECK5)

HSP 1 Score: 314.309 bits (804), Expect = 4.313e-87
Identity = 193/568 (33.98%), Postives = 293/568 (51.58%), Query Frame = 0
Query:   79 LIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCEGAKDDR----CLPIRIYENDLF----YSNFNVTCLNFYRSVRFCSSTP-REQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLP-----KDGKGS--------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLF--NNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT 614
            L +D +   EEC   M  CD   +YR  NG CNN   P + +    L+  LPP+Y+D    P        R    S  PLPN R+VS+ V  D DV     + MV Q+G  + H+L+  P     N     C +    ++    C+PIR+ ++D F    Y N    CL F RS+    +   R Q N++T+++D S +YGS+  E   L+     L+  T    G+ +LP     KD + +        FV GD R     GL  +HT FVREHNRI+ +L+ +NP + ++TVF+E RRI+ A MQ+I ++EFLP ++G   +N   L  K   Y   Y    + +++  F  AA+RFGH++I+R   R+     + S    L + F +     ++   G++ +L GL   P+ + DR +   V N+LF     K  G DL    ILR RDHG+  Y D REFCGL     W++   E+ ++   +L+ LY S +D+D+    ++E P+  ++LG T +CII  QF  LK  DRF++ +D  A  FTP Q+  +R+  L+ + C N+
Sbjct:  823 LSEDGQSSQEECSPKMLPCDHTTRYRTFNGWCNNLKFPEYANSFAPLRHLLPPQYDDGFDAP--------RTRAKSGRPLPNPRRVSNLVCEDKDVSHVKFTHMVMQFGQLLDHELTHSPVARGPNDEILNCTKCDSPEKISVHCMPIRVEKDDPFFPTNYPNGEPRCLPFARSLLGQLNLGYRNQLNQLTAYVDGSAIYGSTKCEAKNLRLFTRGLLNFTDFGHGQMMLPQGNQEKDCRSTLEKRHMPCFVAGDERNSHQPGLTIMHTFFVREHNRIAMQLSALNPQWNDDTVFEEARRIVTAEMQHITFAEFLPKIIGLDLLNAQNLVPKKNGYFGGYDNTCDASISQPFATAAFRFGHTLIRRMFPRMNYNYKNMSEPVDLAQHFGHVGPLYEQEKGGMDSMLMGLLGTPSMAFDRHITDAVRNHLFMRRGEKTSGMDLIVLNILRARDHGVQPYNDLREFCGLRRAVKWDDLKGEMDQDNINILQSLYESVDDVDLFPGLVSERPLRGALLGTTMSCIIAEQFGRLKKCDRFYYENDNSAAKFTPGQLNEIRKVKLASIFCSNS 1382          

HSP 2 Score: 211.46 bits (537), Expect = 4.530e-54
Identity = 156/543 (28.73%), Postives = 253/543 (46.59%), Query Frame = 0
Query:  103 YRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDL-SFVP-------NSHEAKCCE-GAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSV----RFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKST-------LTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVF-VAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTAN-YEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNN-KPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKI 619
            YR  +G CNN   P +G+    + R + P Y D  S P             +S PLP+ R +S T+ T      +  +TM+  W   +A D+ + VP        S    CC+ G     C  I I   D  Y    + C+   RS+      C   PREQ N  +S++DAS +YGS+ E+   L+   +  +++         TD   +      + +  G D   +L + +A++HT+F+R HNRI+  L  +N  +T++ +++E R+I+ A +Q+I Y+EFLP LLG ++M   GLNL    + S+Y   +  T  + F V   Y F                ++   +   F DF N +  YE      I ++L    Y P   A+     EV +    +   +G DL +  + +GRDHG+P Y   R  CGL  +  +N+ +   + E  +  +   Y+   D+D+    LAE P+  S++GPT  CIIG+Q    +  DRF++ +      F   Q+  +R T L+ ++C N  I +I
Sbjct:  160 YRSFSGICNNVARPEWGASHTPMARIVRPDYADGVSEP---------RAAAASKPLPSVRSLSLTIFTPRGEVHSDVTTMMGLWMQLIASDMVNIVPFQAVNEGTSSALPCCKRGFNHSECDAIDIPAADPAYRT-RLNCIPHARSIIAPREACRLGPREQANFASSYLDASFIYGSNMEKAKQLRTFRNGQLRTAGSIGELPATDGTLQCQATHSRCALSGTDEVNILPS-VAALHTVFIRHHNRIADNLRSINRHWTDDKLYEEARKIVAAQVQHITYNEFLPVLLGRENMRNYGLNLHSAGFDSNYEMNLEGTTFNEFAVTITYYF----------------WALLPSEKSFVDFNNPSRLYEQGPVQIIRQVLNTNIYQPTLRAN----DEVKSGFLKDNHEFGLDLISIALKQGRDHGIPGYTALRASCGLGRIASFNDLREIFLPEVKFEQVSSAYTRVEDVDLLVGVLAEKPLKGSLVGPTMACIIGKQMQRTRRADRFWYENYFAQSGFNEAQLSEIRNTKLAEIICSNIDIRRI 671          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:F1P3V5 "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 OrthoDB:EOG7M0NQW TreeFam:TF314316 EMBL:AADN03007730 Ensembl:ENSGALT00000001447 Uniprot:F1P3V5)

HSP 1 Score: 301.982 bits (772), Expect = 1.549e-86
Identity = 202/591 (34.18%), Postives = 302/591 (51.10%), Query Frame = 0
Query:   70 DSAHQKVIQLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTV-HTDVD--VPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKD------DRCLPIRIYEND--LFYSNFNVTCLNFYRSVRFCS--STPREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGKGS--------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLL--------LKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKI 619
            D   +++I      +Y++   K     C  +  YR + G+CNN   P  G   +   R+LP  YED  S P   S+ K      ++ PLP  RKVS+ + HT  +        S    QWG +V HD+   P+S      E   D        C PI+   +D  +  SN   +C+ F +S   C+  +  REQ N +TSFIDAS VYGS +     L+ + + L    +    TD G ELLP + K                F  GD R     GL+++HT+F+REHNR+  KL ++NP +  E ++QE+R I+ AM Q I Y ++LP LL E    E+   +   S YHE ++PTV++VF + A+RFGH+ +Q  V+RL        S   +       A++      GI+ ++ G+    A+    ++ +++E+ N+LF   +  G DL A  + RGRDHGLP Y  WR FCGL       ++P  + E   +L        L +LY +P++ID+    +AE  IP   +GP   CIIG QF  L+DGDRF++ +    G FTP+Q++ L + S+SRV+CDNT I K+
Sbjct:  119 DRKQKEMISKETGCDYQIRSIK-----CPEDDTYRTITGECNNRKEPHLGVSNHAFARWLPAAYEDGVSVPRGASEGK----LYNAFPLPLVRKVSNEIAHTANENITQDQELSLFFMQWGQWVNHDIDLAPSSGMGANPELHCDADCTFRSPCFPIKFPPDDPRMLRSN---SCMPFIQSASVCNPRTFTREQINAVTSFIDASMVYGSEESVAKSLRNQTNQLGLMAVNQNFTDAGLELLPFENKTKSVCVLTNKSTNIPCFRAGDKRVTENLGLSALHTVFLREHNRLVTKLGKLNPHWDGEKLYQESRNIIAAMTQIITYRDYLPLLLAE----ETSKWIPLYSGYHETVDPTVSNVF-SLAFRFGHTSVQPFVSRLDDSFQPMGSLPHVPLHLTFCASWRIIMEGGIDPLIRGMVVDHAKLMKQNQMLIEELQNHLFEQTEIMGLDLAALNLQRGRDHGLPGYNAWRRFCGL-------SQPQTVDELSEVLGNTELTKKLMDLYGTPDNIDLWIGAIAEPLIPRGRVGPLLACIIGTQFRNLRDGDRFWWEN---PGVFTPQQLEELTKISMSRVICDNTRIKKL 682          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:Epx "eosinophil peroxidase" species:10090 "Mus musculus" [GO:0002215 "defense response to nematode" evidence=IMP] [GO:0004601 "peroxidase activity" evidence=IDA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0016491 "oxidoreductase activity" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0032693 "negative regulation of interleukin-10 production" evidence=IMP] [GO:0032714 "negative regulation of interleukin-5 production" evidence=IMP] [GO:0032753 "positive regulation of interleukin-4 production" evidence=IMP] [GO:0042744 "hydrogen peroxide catabolic process" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0055114 "oxidation-reduction process" evidence=IDA] [GO:0072677 "eosinophil migration" evidence=IMP] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 EMBL:L77979 MGI:MGI:107569 GO:GO:0046872 GO:GO:0020037 GO:GO:0004601 GO:GO:0042744 SUPFAM:SSF48113 PROSITE:PS00435 GO:GO:0032753 Gene3D:1.10.640.10 EMBL:AL606805 GO:GO:0032693 GO:GO:0032714 GO:GO:0002215 eggNOG:NOG262194 GeneTree:ENSGT00550000074325 HOGENOM:HOG000016084 CTD:8288 HOVERGEN:HBG000071 KO:K10788 OMA:MHVALGL OrthoDB:EOG7M0NQW TreeFam:TF314316 GO:GO:0072677 EMBL:D78353 RefSeq:NP_031972.2 UniGene:Mm.1315 ProteinModelPortal:P49290 SMR:P49290 PeroxiBase:3346 PhosphoSite:P49290 PaxDb:P49290 PRIDE:P49290 DNASU:13861 Ensembl:ENSMUST00000049768 GeneID:13861 KEGG:mmu:13861 UCSC:uc007kuw.1 InParanoid:Q5SW51 NextBio:284746 PRO:PR:P49290 ArrayExpress:P49290 Bgee:P49290 CleanEx:MM_EPX Genevestigator:P49290 Uniprot:P49290)

HSP 1 Score: 301.597 bits (771), Expect = 2.152e-86
Identity = 202/566 (35.69%), Postives = 292/566 (51.59%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIAST------MVSQWGMFVAHDLSFVPNSHEAKC------CEG--AKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSST---PREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGKGS--------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRL--AIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKE--------LYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKIS 620
            KYR + G+CNN  +P  G+    L R+LP +YED  S P   +  K R G +    LP  R VS+ +   V  PS   ++      M  QWG F+ HDL F P S           CE   A+   C PI+I  ND    N    C+ F+RS   C       R Q N +TSF+DAS VYGS     L L+   ++L          D+G+ LLP D                  F+ GD R+  T  L ++HTLFVREHNR++ +L ++NP ++ + ++ E R+I+GAM+Q I Y +FLP +LG   +  +   L     Y   ++P VA+VF   A+RFGH+M+Q  + RL    +  + +S+  L   FF  A++   +  GI+ IL GL   PA+    D  +V E+ + LF   +  G DL A  + R RDHGLP Y  WR FCGL       ++P  +++   +L  +        LY +P++IDI    +AE  +P + +GP   C+   QF   +DGDRF++    + G FT +Q KALR+ SLSR++CDNTGI  +S
Sbjct:  145 KYRTITGRCNNKKHPWLGASNQALARWLPAEYEDHRSLPFGWTPGKRRNGFL----LPLVRDVSNQI---VRFPSKKLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFSMGVDCEKTCAQLPPCFPIKIPRNDPRIKN-QRDCIPFFRSAPACPQNRNKVRNQINALTSFVDASMVYGSEVTLALRLRNRTNFLGLLATNQRFQDNGRALLPFDNLHEDPCLLTNRSARIPCFLAGDTRSSETPKLTALHTLFVREHNRLAAELRRLNPHWSGDKLYNEARKIVGAMVQIITYRDFLPLVLGRARIRRT---LGPYRGYCSNVDPRVANVFT-LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSVFF--ASWRIIHEGGIDPILRGLMATPAKLNRQDSMLVDELRDKLFQQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGL-------SQPRNLAQLSRVLKNQDLARKFLRLYKTPDNIDIWVGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQ---KWGVFTKRQRKALRRISLSRIVCDNTGITTVS 686          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:MPO "Uncharacterized protein" species:9913 "Bos taurus" [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0006979 GO:GO:0020037 GO:GO:0004601 SUPFAM:SSF48113 Gene3D:1.10.640.10 TreeFam:TF314316 EMBL:AAFC03007028 EMBL:AAFC03007029 EMBL:AAFC03007030 EMBL:AAFC03085503 EMBL:AAFC03085507 Ensembl:ENSBTAT00000016989 Uniprot:F1MVB0)

HSP 1 Score: 301.212 bits (770), Expect = 3.637e-86
Identity = 203/568 (35.74%), Postives = 298/568 (52.46%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTV---HTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKC------CEGA--KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS---TPREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKD--------------GKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSN--YSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLL--LKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLII 626
            C    +YR + GQCNN  +P  G+      R+LP +YED  S P   +    R G     P+P AR VS+ +    T+   P    S M  QWG  + HDL F P             CE +  +   C P++I  ND    N    C+ F+RS   C+    T R Q N +TSF+DAS VYGS D   + L+   + L    + +   D+G+ LLP D                  F+ GD+RA     L S+HTLFVREHNR++++L ++N  +  E ++QE R+I+GAM+Q I Y ++LP +LG ++M +    L+   SY++ ++P +++VF   A+R+GH++IQ  + RL  +      N    L K FF  A++      GI+ IL GL   PA+    ++  V E+   LF      G DL A  + R RDHGLP Y  WR FCGL P+ +   +   +  N+ L   L +LY +PN+IDI   G+AE    +  +GP   C+IG QF  L+DGDRF++ +    G F+ KQ +AL + SL R++CDNTGI  +S  N+ +
Sbjct:  141 CPEKDEYRTITGQCNNRRSPTLGASNRPFVRWLPAEYEDGFSLPFGWTPRVKRNGF----PVPLARAVSNEIVRFPTEKLTPDQQRSLMFMQWGQLLDHDLDFSPEPAARVSFLTGINCETSCLQQPPCFPLKIPPNDPRIKN-QQDCIPFFRSSPACTQSNITIRNQINALTSFVDASMVYGSEDPLAMRLRNLTNQLGLLAVNTRFQDNGRALLPFDTLRHDPCRLTNRSANIPCFLAGDSRASEMPELTSMHTLFVREHNRLAKELKRLNAHWNGERLYQEARKIVGAMVQIITYRDYLPLVLGREAMRKY---LRPYCSYNDSVDPRISNVF-TNAFRYGHTLIQPFMFRLNSRYQPMQPNPREPLTKVFF--ASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGL-PVPNTVGELGTVLRNLDLARRLMKLYQTPNNIDIWIGGVAEPLNKNGRVGPLLACLIGTQFRKLRDGDRFWWQNK---GVFSKKQQQALAKISLPRIICDNTGITFVSKNNIFM 693          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:MPO "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0001878 "response to yeast" evidence=IEA] [GO:0002149 "hypochlorous acid biosynthetic process" evidence=IEA] [GO:0002679 "respiratory burst involved in defense response" evidence=IEA] [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0005615 "extracellular space" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0008201 "heparin binding" evidence=IEA] [GO:0019430 "removal of superoxide radicals" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0030141 "secretory granule" evidence=IEA] [GO:0034374 "low-density lipoprotein particle remodeling" evidence=IEA] [GO:0042744 "hydrogen peroxide catabolic process" evidence=IEA] [GO:0044130 "negative regulation of growth of symbiont in host" evidence=IEA] [GO:0050832 "defense response to fungus" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0005739 GO:GO:0005615 GO:GO:0050832 GO:GO:0030141 GO:GO:0008201 GO:GO:0020037 GO:GO:0034374 GO:GO:0044130 GO:GO:0004601 GO:GO:0042744 GO:GO:0019430 SUPFAM:SSF48113 GO:GO:0001878 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 GO:GO:0002679 KO:K10789 GO:GO:0002149 EMBL:CU571372 RefSeq:XP_003131703.2 Ensembl:ENSSSCT00000019199 GeneID:100517120 Uniprot:F1RRP1)

HSP 1 Score: 300.056 bits (767), Expect = 8.304e-86
Identity = 206/579 (35.58%), Postives = 294/579 (50.78%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSG-PLPNARKVSSTV---HTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKC------CEGA--KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS---TPREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGK--------------GSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSN--YSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKEL---------YSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVS 629
            C    KYR + GQCNN  +P  G+      R+LP +YED  S P     F    G   +G P+P AR VS+ +    T+   P    S +  QWG  + HDL F P             CE +  +   C P++I  ND    N    C+ F+RS   C     T R Q N +TSF+DAS VYGS D   + L+   + L    + +   D+G+ LLP D                  F+ GD+RA    GL S+HTL +REHNR++ +L ++NP +  E ++QE R+I+GAM+Q I Y ++LP +LG ++M +    L     Y++ ++P +A+VF   A+R+GH++IQ    RL  +      N    L K FF T         GI+ +L GL   PA+    ++ VV E+   LF      G DL A  + R RDHGLP Y  WR FCGL        +P+ + E +  +LK L         Y +P +IDI   G+AE       +GP   C+IG QF  L+DGDRF++ +    G F+ +Q +AL + SLSR++CDNTGI  +S  N  IF+S
Sbjct:  141 CPEKDKYRTITGQCNNRRSPTLGASNRAFVRWLPAEYEDGHSLP-----FGWTPGVKRNGFPVPLARAVSNAIVRFPTEQLTPDQERSLLFMQWGQLLDHDLDFTPEPAARVAFLTGINCETSCLQQPPCFPLKIPPNDPRIKN-QRDCIPFFRSCPACPRSNITIRNQINALTSFVDASMVYGSEDPLAMKLRNLTNQLGLLDVNNRFRDNGRALLPFDNMHDDPCLLTNRSANIPCFLAGDSRASEMPGLTSLHTLLLREHNRLATQLKRLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPEAMKKY---LPKYRCYNDSVDPRIANVFT-NAFRYGHTLIQPFTFRLDSRYRPMQPNPRVPLSKAFFATWRVVLEG--GIDPLLRGLMATPAKLNRQNQIVVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYKAWRRFCGLP-------EPSTVGE-LGTVLKNLDLARKLMAQYGTPANIDIWMGGVAEPLNRKGRVGPLLACLIGTQFRKLRDGDRFWWQNK---GVFSKQQQQALAKISLSRIICDNTGITVVSKKN--IFMS 694          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:EPX "Eosinophil peroxidase" species:9606 "Homo sapiens" [GO:0002215 "defense response to nematode" evidence=IEA] [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0032693 "negative regulation of interleukin-10 production" evidence=IEA] [GO:0032714 "negative regulation of interleukin-5 production" evidence=IEA] [GO:0032753 "positive regulation of interleukin-4 production" evidence=IEA] [GO:0042744 "hydrogen peroxide catabolic process" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0072677 "eosinophil migration" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0046872 GO:GO:0020037 GO:GO:0004601 GO:GO:0042744 SUPFAM:SSF48113 PROSITE:PS00435 GO:GO:0032753 Gene3D:1.10.640.10 CleanEx:HS_EPO GO:GO:0032693 GO:GO:0032714 GO:GO:0002215 eggNOG:NOG262194 HOGENOM:HOG000016084 EMBL:M29913 EMBL:M29904 EMBL:M29905 EMBL:M29906 EMBL:M29907 EMBL:M29908 EMBL:M29909 EMBL:M29910 EMBL:M29911 EMBL:M29912 EMBL:DQ054598 EMBL:X14346 PIR:A34408 RefSeq:NP_000493.1 UniGene:Hs.279259 ProteinModelPortal:P11678 SMR:P11678 IntAct:P11678 STRING:9606.ENSP00000225371 ChEMBL:CHEMBL2438 PeroxiBase:3317 PhosphoSite:P11678 DMDM:1352738 PaxDb:P11678 PRIDE:P11678 DNASU:8288 Ensembl:ENST00000225371 GeneID:8288 KEGG:hsa:8288 UCSC:uc002ivq.3 CTD:8288 GeneCards:GC17P056270 H-InvDB:HIX0202542 HGNC:HGNC:3423 HPA:HPA050507 MIM:131399 MIM:261500 neXtProt:NX_P11678 PharmGKB:PA27841 HOVERGEN:HBG000071 InParanoid:P11678 KO:K10788 OMA:MHVALGL OrthoDB:EOG7M0NQW PhylomeDB:P11678 TreeFam:TF314316 GeneWiki:Eosinophil_peroxidase GenomeRNAi:8288 NextBio:31057 PRO:PR:P11678 Bgee:P11678 CleanEx:HS_EPX Genevestigator:P11678 GO:GO:0072677 Uniprot:P11678)

HSP 1 Score: 299.671 bits (766), Expect = 8.815e-86
Identity = 201/566 (35.51%), Postives = 292/566 (51.59%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIAST------MVSQWGMFVAHDLSFVPNSHEAKC------CEG--AKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTP---REQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGKGS--------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRL--AIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKE--------LYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKIS 620
            KYR + G+CNN   PL G+    L R+LP +YED  S P   +  + R G +    LP  R VS+ +   V  P+   ++      M  QWG F+ HDL F P S           CE   A+   C PI+I  ND    N    C+ F+RS   C       R Q N +TSF+DAS VYGS     L L+   +YL    +     D+G+ LLP D                  F+ GD R+  T  LA++HTLF+REHNR++ +L ++NP +  + ++ E R+I+GAM+Q I Y +FLP +LG+     +   L +   Y   ++P VA+VF   A+RFGH+M+Q  + RL    +  + +S+  L   FF  A++      GI+ IL GL   PA+    D  +V E+ + LF   +  G DL A  + R RDHGLP Y  WR FCGL       ++P  +++   +L  +        LY +P++IDI    +AE  +P + +GP   C+   QF   +DGDRF++    + G FT +Q KAL + SLSR++CDNTGI  +S
Sbjct:  144 KYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFL----LPLVRAVSNQI---VRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKN-QRDCIPFFRSAPSCPQNKNRVRNQINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDFLPLVLGKARARRT---LGHYRGYCSNVDPRVANVFT-LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFF--ASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGL-------SQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQ---KRGVFTKRQRKALSRISLSRIICDNTGITTVS 685          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:MPO "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0001878 "response to yeast" evidence=IEA] [GO:0002149 "hypochlorous acid biosynthetic process" evidence=IEA] [GO:0002679 "respiratory burst involved in defense response" evidence=IEA] [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0005615 "extracellular space" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0008201 "heparin binding" evidence=IEA] [GO:0019430 "removal of superoxide radicals" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0030141 "secretory granule" evidence=IEA] [GO:0034374 "low-density lipoprotein particle remodeling" evidence=IEA] [GO:0042744 "hydrogen peroxide catabolic process" evidence=IEA] [GO:0044130 "negative regulation of growth of symbiont in host" evidence=IEA] [GO:0050832 "defense response to fungus" evidence=IEA] InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR019791 Pfam:PF03098 PRINTS:PR00457 PROSITE:PS50292 GO:GO:0005739 GO:GO:0005615 GO:GO:0050832 GO:GO:0030141 GO:GO:0008201 GO:GO:0020037 GO:GO:0034374 GO:GO:0044130 GO:GO:0004601 GO:GO:0042744 GO:GO:0019430 SUPFAM:SSF48113 GO:GO:0001878 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 GO:GO:0002679 OrthoDB:EOG7M0NQW TreeFam:TF314316 OMA:QDKYRTI GO:GO:0002149 EMBL:CU571372 Ensembl:ENSSSCT00000035412 Uniprot:K7GRV6)

HSP 1 Score: 300.442 bits (768), Expect = 1.073e-85
Identity = 206/579 (35.58%), Postives = 294/579 (50.78%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSG-PLPNARKVSSTV---HTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKC------CEGA--KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS---TPREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGK--------------GSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSN--YSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKEL---------YSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVS 629
            C    KYR + GQCNN  +P  G+      R+LP +YED  S P     F    G   +G P+P AR VS+ +    T+   P    S +  QWG  + HDL F P             CE +  +   C P++I  ND    N    C+ F+RS   C     T R Q N +TSF+DAS VYGS D   + L+   + L    + +   D+G+ LLP D                  F+ GD+RA    GL S+HTL +REHNR++ +L ++NP +  E ++QE R+I+GAM+Q I Y ++LP +LG ++M +    L     Y++ ++P +A+VF   A+R+GH++IQ    RL  +      N    L K FF T         GI+ +L GL   PA+    ++ VV E+   LF      G DL A  + R RDHGLP Y  WR FCGL        +P+ + E +  +LK L         Y +P +IDI   G+AE       +GP   C+IG QF  L+DGDRF++ +    G F+ +Q +AL + SLSR++CDNTGI  +S  N  IF+S
Sbjct:  165 CPEKDKYRTITGQCNNRRSPTLGASNRAFVRWLPAEYEDGHSLP-----FGWTPGVKRNGFPVPLARAVSNAIVRFPTEQLTPDQERSLLFMQWGQLLDHDLDFTPEPAARVAFLTGINCETSCLQQPPCFPLKIPPNDPRIKN-QRDCIPFFRSCPACPRSNITIRNQINALTSFVDASMVYGSEDPLAMKLRNLTNQLGLLDVNNRFRDNGRALLPFDNMHDDPCLLTNRSANIPCFLAGDSRASEMPGLTSLHTLLLREHNRLATQLKRLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPEAMKKY---LPKYRCYNDSVDPRIANVFT-NAFRYGHTLIQPFTFRLDSRYRPMQPNPRVPLSKAFFATWRVVLEG--GIDPLLRGLMATPAKLNRQNQIVVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYKAWRRFCGLP-------EPSTVGE-LGTVLKNLDLARKLMAQYGTPANIDIWMGGVAEPLNRKGRVGPLLACLIGTQFRKLRDGDRFWWQNK---GVFSKQQQQALAKISLSRIICDNTGITVVSKKN--IFMS 718          
BLAST of EMLSAG00000004874 vs. GO
Match: - (symbol:TPO "Uncharacterized protein" species:9031 "Gallus gallus" [GO:0004601 "peroxidase activity" evidence=IEA] [GO:0005509 "calcium ion binding" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0006979 "response to oxidative stress" evidence=IEA] [GO:0020037 "heme binding" evidence=IEA] [GO:0035162 "embryonic hemopoiesis" evidence=IEA] InterPro:IPR000742 InterPro:IPR001881 InterPro:IPR002007 InterPro:IPR010255 InterPro:IPR018097 InterPro:IPR019791 Pfam:PF03098 Pfam:PF07645 PRINTS:PR00457 PROSITE:PS01187 PROSITE:PS50026 PROSITE:PS50292 SMART:SM00179 InterPro:IPR000152 GO:GO:0005739 GO:GO:0006979 GO:GO:0005509 GO:GO:0020037 InterPro:IPR013032 PROSITE:PS01186 PROSITE:PS00010 GO:GO:0004601 InterPro:IPR000436 Pfam:PF00084 SMART:SM00032 SUPFAM:SSF57535 PROSITE:PS50923 SUPFAM:SSF48113 GO:GO:0035162 Gene3D:1.10.640.10 GeneTree:ENSGT00550000074325 TreeFam:TF314316 OrthoDB:EOG7D2FD6 EMBL:AADN03003101 Ensembl:ENSGALT00000026405 PRO:PR:F1NN54 Uniprot:F1NN54)

HSP 1 Score: 302.368 bits (773), Expect = 1.343e-85
Identity = 204/581 (35.11%), Postives = 298/581 (51.29%), Query Frame = 0
Query:   95 PDCDPNM---KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTV---HTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHE------AKCCEGA--KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS-------------TPREQYNEITSFIDASNVYGSSD--EELL--LLKEENSYLMKSTLTDDGKELLP----------KDGKGS-------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSS--NYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPA--QSADRFVVKEVTNYLF---NNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEIS-ENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKI 619
            P C  N    KYR++ G CNN  +  +G+    L R+LPP YED  S P         +G +    LP  R+V+  +     +      + S ++  WG ++ HD+SF P S         K C+    + + C PI++  ND      +  CL FYRS   C +              PR+Q N +TSFIDAS VYGS+   E  L  L  EE    + S   D+G+E LP          +D   S       F+ GD+R+   T L ++HTL++REHNR++R L  +N  ++ ETV+QE R+I+GA+ Q I   +++P ++G  + N+    +     Y   +NPTV++VF  AA+RFGH+ IQ  V RL  +        N  L + FF+        GL  + ++ GL   PA  Q   + + +E+T+ LF   NNG     DL +  + RGRDHGLP Y DWREFC L  L    +  T I+ + +   + ELY  P++ID+   GL E  +P +  GP   C+IG+Q  AL+DGDRF++ +D     FT  Q   L++ SLSRV+CDNTGI  +
Sbjct:  140 PKCPNNCLANKYRLITGACNNREHTRWGASNTALARWLPPAYEDGLSQPRGWDPSVRYDGVL----LPLVREVTRKIINASNEAVTEDNLYSDIIMVWGQYIDHDISFTPQSISRTSFLTGKECQMTCERQNPCFPIKVTTNDALSKGMD--CLPFYRSSPACGTGDHSILFGNLSALNPRQQINGLTSFIDASTVYGSTSTVENKLRNLTSEEGLLRVNSKHNDNGQEYLPFTDRVPSPCAQDSNASEDERIECFMAGDSRSSEVTSLTAMHTLWLREHNRLARALKAINSHWSAETVYQEARKIVGALHQIITLRDYIPKIIGPDAFNQY---IGLYKGYDPTVNPTVSNVFATAAFRFGHATIQPIVRRLNAQYLDDPELPNLHLHEVFFSPWRLIKEGGL--DPLIRGLLAHPAKLQVQGQLMNEELTDKLFVLSNNG---SLDLASLNLQRGRDHGLPGYNDWREFCDLPRLETQTDLNTIITNQKVTEKIMELYHIPSNIDVWLGGLVEDFLPGARTGPLFACLIGKQMKALRDGDRFWWEND---NVFTDAQKHELKKHSLSRVICDNTGISDV 703          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592868597|gb|GAXK01088965.1| (TSA: Calanus finmarchicus comp317474_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 427.172 bits (1097), Expect = 6.988e-132
Identity = 238/575 (41.39%), Postives = 325/575 (56.52%), Query Frame = 0
Query:   88 EECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNP------TENSQFKAR-EGCISSGP------------------LPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNV--TCLNFYRSVRFCS--STPREQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMKSTLTDDGKELLPKDGK-----------GSFVGGDARALLTTGLASVHTLFVREHNRISRKL-AQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYP----SSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLF-NNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGI 616
            + C   +P CD    YR + G CNN  NP +GS    ++R+L  KY D  + P      T+N  F    +      P                  LP  R VS   H +VD+PS   + MV+Q G F+ HD++  P +H  +CCE  +   CLP+ +  +D FY+  +   TCL F RSV +C   + PREQ N IT F+D SNVYGS +E         S L++S +  DGK L+  D             G    GD RA+   GLA++HTLF+REHNR+++ +    + S ++E +FQ  RRI+ A  QNI+YSE+LP +LG+K+M +  + L       SSY+++ +P++ + F  AAYRFGHSMIQ  +  ++   +  +  Y L   +FN  NY    G G+E+IL GL   PAQ  D+FV ++VTN+LF   G  +G+DL A+ I RGRDHGLP Y  WR FC L+ +    +KP EIS   W  LK LY SP DID+ TAGLAETP+   + G T NCI  +QF +L DGDRFFFTH  +AGSFT  Q+K LR   L  V+C+NTGI
Sbjct:  412 DACNNAVPTCDATYMYRNVTGTCNNIENPFYGSANIGMRRYLAAKYVDDINMPVGGYPETQNIFFHIESQNRKKRSPRRQNGGGGNSGNGKERVMLPVPRVVSIKFHEEVDMPSADVTHMVTQMGQFLDHDITLTPENHVEECCEDPEQAECLPLHLPLDDPFYATLSTAQTCLEFTRSVAYCEDPTKPREQMNGITGFMDCSNVYGSDEE--------TSNLLRSNV--DGKLLVNADSAYGEKDMLPEIDGLLQAGDVRAIEMPGLATMHTLFLREHNRLAKAIKTSSSQSLSDEEIFQTARRIMIAEWQNIIYSEYLPVVLGDKAMKDYKIELPSNFGSFSSYNDKTDPSITNSFATAAYRFGHSMIQGLIQMMSTTTFETTDEYLLRDHYFNLNNYLLNGGEGMEQILVGLINQPAQDMDKFVTEDVTNFLFPEEGHNFGSDLVARNIQRGRDHGLPGYNSWRSFCNLKKIDSMKDKPKEISSKNWNALKNLYKSPEDIDLFTAGLAETPVNDGLTGATFNCIKAKQFKSLMDGDRFFFTHKNQAGSFTSGQLKQLRGRQLRDVICENTGI 2106          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592809132|gb|GAXK01145436.1| (TSA: Calanus finmarchicus comp776431_c1_seq18 transcribed RNA sequence)

HSP 1 Score: 411.764 bits (1057), Expect = 1.734e-127
Identity = 229/574 (39.90%), Postives = 338/574 (58.89%), Query Frame = 0
Query:   80 IKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPT-------------ENSQFKAREGCIS-SGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNF-NVTCLNFYRSVRFCSS-----TPREQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMK---STLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKY-SYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLF---------NNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDW--NNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDK 618
            + D +     C      C+ N  +R + G CNN  NP  G+   ++ RF+ P+Y D +  P              ++S+F + +GC   +  LPNAR+VSST H+D D+P+   S M+ Q+G F+ HD++  P   E  CCE  +   C PI I   D FYS+    TC  F R+  +C++     +PREQY+ +TSF+D S VY +++ +   L+      +K   + L +  +E+LP +  G  + GD RAL   GLA++HT+F+REHNRI+  L++      +E ++Q+ RRI+ A  QNIVY+E+LP +LG+ S+++ GL+   P+SY    +P++ + F  AAYRFGH++IQ  VN   +    S    Y L ++FFN  NY   NGLG+E+++ GL    AQ  DRFV ++VTN+LF         N  + +GADL ++ I RGRDHGLP Y  +R+ C L  L  +  N+ P+EIS   W +L ELY +P+DID+   GLAE P+  SV GPT NCI    F  + +GDRFFFTH  +AGSF+PKQ+K LR+ +L  V+C+NT + K
Sbjct:   91 LSDHQLSDASCDTRRITCEKNEMFRSITGVCNNLENPHLGAANSKISRFIAPEYYDCQDMPKGGYESNESPQRRRQSSKFTSDQGCPGRNQTLPNAREVSSTFHSDADIPNHYFSLMIMQFGQFLDHDMALSPEVEEHNCCEHPETKDCFPIYIPNEDPFYSDKKEATCQEFTRTDSYCTTGNALGSPREQYSIVTSFVDGSQVYSANELDARKLRSFKDGKLKVNDNYLREYRREILP-EFDGEMIAGDMRALDMPGLATMHTIFLREHNRIADLLSK-TLREDDEQIYQKARRIVIAEYQNIVYNEYLPLILGKNSISKYGLSTAGPTSYDPTEDPSLINSFATAAYRFGHTLIQGLVNMADVDDPDSIVRVYQLKQNFFNMDNYLRDNGLGMEQLVAGLMGQHAQRFDRFVTQDVTNFLFAAFGEDTGKNKKRTFGADLVSRNIQRGRDHGLPGYNKYRQLCSLRGLPPFKSNSHPSEISLESWKMLSELYETPDDIDLFVGGLAEFPLRGSVTGPTFNCIKSMMFKKVLNGDRFFFTHKNQAGSFSPKQLKQLRRRTLRDVICENTEVAK 1806          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592905048|gb|GAXK01053327.1| (TSA: Calanus finmarchicus comp354079_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 395.586 bits (1015), Expect = 3.753e-120
Identity = 227/566 (40.11%), Postives = 326/566 (57.60%), Query Frame = 0
Query:   88 EECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNP------TENSQFKA----REGCISSG---PLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNV--TCLNFYRSVRFCS--STPREQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSY---TNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYP--SSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYS-SNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLF--------NNG-KPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNK--PTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKI 619
            + C G    C+    YR + G CNN  +P  G+    ++RFL  +Y D    P       E   F++    R+G  +S     LPN R+VS+  H D+D+P    S MV Q+G F+ HD++  P      CCE  + + C PI +   D FYS  +V  TCL F RS  FC   S  REQY+ +TSF+D S +YG ++E    L+  N     +  TD  +E+LP +  G+ + GD RAL   GLAS+HTLF+REHNR++  +     +Y    +E ++Q+ RRI+ A +QNIVY E+LP +LG+ SM + GL +     +SY+ + +P++ + F  AAYRFGHS+IQ  VN   +   +     Y L ++FFN   Y   NGLG+++I+ GL    AQ+ DRFV ++VTN+LF        N G + +G DL A+ + RGRDHGLP Y ++R  CGL+ +     K  PTEIS+  W +L +LY SPNDID+   GL E P+   + GPT  CI   QF  LK+GDRFFFTH  +AGSF   Q+  L++ +L  V+C+NT + ++
Sbjct:  505 DACNGKSLYCNSRSPYRTITGVCNNLQSPYLGATNSIMKRFLSSEYNDCTDEPKGGFSQAEERLFQSSNYSRKGYTASKCSKNLPNVREVSNLFHPDLDIPQDYFSLMVMQFGQFLDHDMALTPEVEIEDCCEHPQTEDCFPIYVPRTDPFYSTRDVAPTCLEFTRSDAFCEARSKKREQYSIVTSFVDGSQIYGPNEELANKLRA-NVGGRLAINTDYSREMLP-EIDGALLAGDIRALDMPGLASMHTLFLREHNRVADLIRSKFYAYGYADDEEIYQKARRIVTAELQNIVYGEYLPVILGQTSMQKYGLTIPKAGYTSYNRKRDPSIVNSFTTAAYRFGHSLIQGLVNMADVNNPNRVLQMYQLRENFFNMDRYLSNNGLGMDQIIAGLVGQEAQTMDRFVTEDVTNFLFLTVGEDTGNIGTRDFGGDLVARNLQRGRDHGLPGYNNYRSLCGLQSIKSMRKKHRPTEISQTNWKILGQLYKSPNDIDLFAGGLGEIPVRDGLTGPTFTCIKSSQFKMLKEGDRFFFTHQNQAGSFKEDQLSQLKKRTLRDVICENTDVARM 2196          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592862030|gb|GAXK01095532.1| (TSA: Calanus finmarchicus comp200197_c0_seq3 transcribed RNA sequence)

HSP 1 Score: 391.734 bits (1005), Expect = 2.104e-119
Identity = 225/581 (38.73%), Postives = 324/581 (55.77%), Query Frame = 0
Query:   88 EECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNP------TENSQ--FKAREGCISSG-------------------PLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSN--FNVTCLNFYRSVRFCSSTP----------REQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKK-YSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLF-----NNG----KPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNK-PTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDK 618
            + C G    CD N KYR +NG CNN  +P  G+    L R +  +Y D +  P       E  Q     REG +                       LPN R+VSST H D+D+P    S MV Q+G F+ HD++  P   E  CC+    + C PI I+  D FYS      TC  F RS  FCS+            REQY+ +TSF+D S +Y  ++ +  L++      +K+ + D  +E+LP    GS + GD RAL   GLA++HTLF+REHNR++R +   +    +E ++Q+ RRI+ A +QNIVY E+LP +LG++++ +  L++  P+ Y ++ +P++ + F  AAYRFGHS+IQ  VN        S    Y L ++FFN  NY   +GLG++ I+ GL    AQ+ DRFV ++VTN+LF     N G    + +GADL ++ + RGRDHGLP Y  +R +CGL+ +  +  K P EIS   W +L ELY +P+DID+   GLAE      + GPT NCI   QF  L DGDRFF+TH  EAGSF+  Q+  LR+ +L  ++C+NT + +
Sbjct:  127 DACGGGKLQCDKNKKYRSINGVCNNLKSPFLGASNSILSRIIEAEYYDCKGIPKGGYKDEEKYQGGITVREGILKPANNTFEKGARWFFGCKGRHQQLPNVREVSSTFHPDMDLPQDHFSLMVMQFGQFLDHDMALTPEVEEDDCCKHPDSEDCFPIYIHNEDPFYSTRVSPQTCQEFTRSEAFCSNGKGLGKGRRRGKREQYSIVTSFVDGSQIYAPNEVDSALIRSHQGGELKTNI-DYSREMLPAI-NGSLMAGDIRALDMPGLATIHTLFMREHNRVARLIGYKHTD--DEEIYQQARRIVIAELQNIVYGEYLPVILGKEAVEKYELSVAEPTEYKKKQDPSIMNSFTTAAYRFGHSLIQGLVNMGDPNDPDSLFKTYQLRENFFNMENYLLEDGLGMDRIIAGLIGQEAQTMDRFVTEDVTNFLFLKVGENTGNIGKRDFGADLVSRNLQRGRDHGLPGYNKYRRYCGLKSIKSFKGKSPPEISTANWKVLAELYKTPDDIDLFVGGLAEFSFADGLTGPTFNCIKSIQFKRLMDGDRFFYTHQHEAGSFSSSQLNQLRKRTLRDIICENTELTR 1857          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592862031|gb|GAXK01095531.1| (TSA: Calanus finmarchicus comp200197_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 364.77 bits (935), Expect = 9.530e-108
Identity = 213/590 (36.10%), Postives = 321/590 (54.41%), Query Frame = 0
Query:   88 EECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNP------TENSQ--FKAREGCISSG-------------------PLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSN--FNVTCLNFYRSVRFCSSTP----------REQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNR-------LAIKKYS--YSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFV 628
            + C G    CD N KYR +NG CNN  +P  G+    L R +  +Y D +  P       E  Q     REG +                       LPN R+VSST H D+D+P    S MV Q+G F+ HD++  P   E  CC+    + C PI I+  D FYS      TC  F RS  FCS+            REQY+ +TSF+D S +Y  ++ +  L++      +K+ + D  +E+LP    GS + GD RAL   GLA++HTLF+REHNR++R +   +    +E ++Q+ RRI+ A +QNIVY E+LP +LG++++ +  L++  P+ Y ++ +P++ + F  AAYRFGHS++   V R       L  +K S      Y LFK  +            ++  + GLT   AQ+ D  V  EVTN+LF   G  +G DL +  + RGR+HG+PSY  +REFCG +P+  W+     ++         +Y +P+D+++ TAG++E P+P +++GPT +CIIGRQF  L+ GDRFF+ + G   SFT +Q+  +R+ +LSR++CDNT  D I  + +  FV
Sbjct:  127 DACGGGKLQCDKNKKYRSINGVCNNLKSPFLGASNSILSRIIEAEYYDCKGIPKGGYKDEEKYQGGITVREGILKPANNTFEKGARWFFGCKGRHQQLPNVREVSSTFHPDMDLPQDHFSLMVMQFGQFLDHDMALTPEVEEDDCCKHPDSEDCFPIYIHNEDPFYSTRVSPQTCQEFTRSEAFCSNGKGLGKGRRRGKREQYSIVTSFVDGSQIYAPNEVDSALIRSHQGGELKTNI-DYSREMLPAI-NGSLMAGDIRALDMPGLATIHTLFMREHNRVARLIGYKHTD--DEEIYQQARRIVIAELQNIVYGEYLPVILGKEAVEKYELSVAEPTEYKKKQDPSIMNSFTTAAYRFGHSLLPSTVERWTPNHKFLGTQKLSEMLQQPYDLFKAGW------------LDGYVLGLTNQVAQAMDDAVTGEVTNHLFEEPGDGFGLDLISLNLQRGREHGIPSYNKYREFCGFKPITSWHQLRGIMTNKTVAAYSRVYDTPDDLELFTAGISENPVPGALIGPTFSCIIGRQFHNLRKGDRFFYENGGWPSSFTLEQLHEIRKFTLSRLLCDNT--DTIDTVQIHAFV 1842          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592819638|gb|GAXK01134930.1| (TSA: Calanus finmarchicus comp370050_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 358.992 bits (920), Expect = 5.327e-105
Identity = 222/631 (35.18%), Postives = 330/631 (52.30%), Query Frame = 0
Query:   36 KLLDQANVKDVDYHKLLQKGRQVTPKLVKKGYSRDSAHQKVI---QLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHE-----AKCCEGAKDDR--------CLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMKSTLTDDGKELLPKDGKGS--------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKP-YGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFV 628
            K+L Q     +    LL K   +T + V  G  R       I     +K  +   EEC G       +  +R  +G CNN  +P +GS      RFLPP Y D           +     IS+GPLPN R +SS +H D    +T  + MV QWG F+ HDL+  P +        KCC+     +        C PI I  +D FYS +N TC+ F RS       C+  PR+Q N+ITS++DASN+YGS+ E+   L+      +K T     K LLP     +              F  GD R     GLA++HTL +REHNR++ +L  +NP ++++ VF ETRR +GA+MQ+I ++E+LP +LG + +    L L    Y S Y++ +NPT+A+ F ++A+RFGHS++++++NR   +      N  L K+  N +N    N   ++ IL GL        D F+  E+TN+LF   +  +G DL +  I RGRDHGL  Y  WRE CGL+   DW      + +     ++ +Y   +DID+ T G+AE P+   ++GPT  CIIG+QF  L+ GDRF++ +    G+FT +Q++ +R+TSLSRV+CD   +D +  L    F+
Sbjct:  681 KMLSQFAYATLQASSLLSKQFMLTRQQVLYGLERVELRTTSIFDACPLKSRDARQEECSGF------SAMFRTPDGTCNNFKHPSWGSAFMPFLRFLPPDYSDG---------IEEFRRSISNGPLPNPRLISSMIHRDESHDTTQFTMMVMQWGQFIDHDLTSTPTTRGFRASIPKCCDETGRQQTGDLLHPDCKPIDIPVDDRFYSRYNKTCMEFVRSSPAPRLDCALGPRDQINQITSYLDASNIYGSTAEDQHDLRLMEKGKLKYTDLHIRKPLLPPLSPEASAEECRIRTPNLHCFHAGDNRVNEQPGLATMHTLLLREHNRVALELGSINPHWSDDRVFLETRRFIGAVMQHITFNEWLPIILGSRVLEIFELKLLPRGYYSGYNDSVNPTIANAFASSAFRFGHSLVKKSINRCNKEFRQVPFNVELHKEMNNPSNL--HNFGSVDRILLGLVSQKLARRDEFMTDELTNHLFQTPRSHFGMDLASLNIQRGRDHGLAPYNIWREQCGLKRFSDWEELEDVMDKTTVSRIENVYEDVDDIDLFTGGMAEKPVVGGIVGPTFACIIGQQFLNLRKGDRFWYENGNHPGAFTKEQLQEIRKTSLSRVVCD--CMDDVKLLQPFAFL 2516          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592771697|gb|GAXK01182871.1| (TSA: Calanus finmarchicus comp289283_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 353.214 bits (905), Expect = 6.613e-104
Identity = 207/549 (37.70%), Postives = 300/549 (54.64%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCC-EGAKDDRCLPIRIYENDLFYS--NFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGS-SDXXXXXXXXXNSYLMKSTLTDD-----------GKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQ-MNPSYTN-ETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLF----KDFFNTANYE-DRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNG---KPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTH---DGEAGSFTPKQVKALRQTSLSRVMCDNTGID 617
            CD N +YR ++G CNN  N  +G+    L R LPP YED    P          G  +S  LPN R +S   H D D+P T  + MV Q+G F+ HD++  P      CC E   D +C  I I + D FYS  N   TC+N  RS   C  + R+Q+N IT+F+D S +YGS +D   +L   ++  L  + +T+               LL  + +  FV GD R      L S+H +F+REHNRI+  L + + P   N ET++QETRRI+GA MQNIVY E+LPT+LG K M + GL ++  S+Y   + P + + F AAA+RFGHSMI      ++ +K    S  + +    ++ F+      DR  L +E ++ GL   P Q+ D +   E+TN+LF      + +G DL +  I RGRDHGLPSY ++R+ CGL+ L  W+ +P+E+ E  WL LK+++   +DID+   G+AE  +    +G T  CIIG QF  LK GDR+F+TH     +A   +      + Q +L  ++CDNT +D
Sbjct:  564 CDKNARYRSISGACNNLRNREWGAAGIELVRMLPPDYEDGRQEP---------RGGHTSRVLPNPRWMSQRNHPDEDLPDTRYTHMVMQFGQFLDHDMTLTPKDESLNCCKENPNDPKCFTIPIPKRDRFYSWVNLTATCMNLVRSTPVCQRSVRQQFNAITAFVDGSGIYGSDNDHASILRTYQDGLLATNRVTNQLPTKEQLNLRPNTRLLRPETQEDFVAGDERVNEHPFLTSMHVVFMREHNRIAAGLKKYLAPHLRNDETIYQETRRIVGAEMQNIVYGEYLPTILGAKYMKKFGLLVEESSNYDPSVEPNIFNSFAAAAFRFGHSMINSMFMLVSQRKPRNQSGAATWFWRLREIFDGQKISGDR--LPLESMVEGLIKQPPQTCDAYFSTEITNHLFQKNHQRQNFGLDLLSINIQRGRDHGLPSYNNYRKKCGLKGLTSWSKRPSELDEPYWLKLKDVFEKVDDIDLMLGGVAERNVRGGAVGATFACIIGEQFKRLKYGDRYFYTHIADSNKAKGLSHTTKSYVLQRTLGDILCDNTAMD 2177          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592832441|gb|GAXK01125103.1| (TSA: Calanus finmarchicus comp24549_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 348.206 bits (892), Expect = 4.622e-100
Identity = 210/567 (37.04%), Postives = 311/567 (54.85%), Query Frame = 0
Query:   95 PDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEA------KCCEGAKD---DRCLPIRIYENDLFYSNFNVTCLNFYRS---VRF-CSSTPREQYNEITSFIDASNVYGS-SDXXXXXXXXXNSYL----------------MKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT-GIDKISFLNLII 626
            P C+   +YR + G CNN  +P +G+      RFLPP Y D  S P            IS  PLP+ R +SS +H D        + ++  WG F+ HD++    + +       KCC+G  D     CLPI I  +D F++     C+NF RS   +R+ C   PREQ+NEI++ +DA  VY +  +    L   +N +L                +K    D+G  + P +    F+ GD R    T LA VHTLFVREHNRI+ +L ++NP + +ETVFQETR I  A++Q+I Y+EFLP +LG++ M++  L L    Y   Y +  NP+ AS F +AA+RFGHS++   + R + K + Y  +  L +       Y+       +  L GL    AQ+ D  V +EVTN+LF   GK +G DL A  + RGR+HG+PSY  WRE+CGL P+ +W++    ++ +       LY SP DID+ TAG+ E P+P S++GPT  CIIG+QF   + GDRF++ + G   SFT +Q+  +R+  LSRV+CDN+  I+ +    +++
Sbjct:  490 PKCE-VQRYRSVEGICNNLDHPHWGAAMNGHHRFLPPDYADGISAP---------RASISGYPLPSPRSISSHLHKDEGFHDHAVTILLVAWGQFIDHDITLTAETKDPRTGKTPKCCDGGFDGTHPNCLPIEIPADDHFFTLHKRRCMNFVRSQAGLRYNCRLGPREQFNEISAVLDAGTVYSNVPERLESLRLYKNGFLKTLPVFSEFNMRDLLPLKLEEPDEGC-IRPSEDVYCFLAGDPRVNEQTVLAMVHTLFVREHNRIASELNKINPHWDDETVFQETRHINAALIQHITYNEFLPMVLGKEVMHQHDLVLLKDGYFDGYDQYTNPSAASGFTSAAFRFGHSLLPSTIERWS-KTHRYVGSQKLSEML--QQPYDLYKAGWADAYLMGLINQVAQALDDSVTQEVTNHLFQEPGKKFGLDLAALNMQRGREHGIPSYNRWREWCGLSPMKNWDDMLGVMANHSVKGYSSLYESPEDIDLWTAGVTERPLPGSMVGPTFACIIGKQFHNFRYGDRFWYENGGWPSSFTLEQLAEIRRVKLSRVLCDNSDDIENVQVYAMVL 2148          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592781681|gb|GAXK01172887.1| (TSA: Calanus finmarchicus comp132241_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 329.331 bits (843), Expect = 5.801e-96
Identity = 209/577 (36.22%), Postives = 304/577 (52.69%), Query Frame = 0
Query:   80 IKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-NSHEAKCCEGAKD--------DRCLPIRIYENDLFYSNFNVT-----CLNFYRSVRFCSSTP-REQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMKSTLTDDGKELLPKDGKGS---------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNG-KPY-GADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            + DI    +  + T+P CD   KYR M G CNN  NP +G       R L P Y+D   +P   S   +R        LP+ R +S  +H DV  P    S M+ QWG FV HDL+  P N   A      KD          CLPI + E D FY   N+T     CL F RS+    +   REQ N+ITSF DASNVYGS   E+  L+      + ST    GK LLP+  + +         F  GDAR      L ++HTLF+REHNRI+ +LAQ+NP +++E ++QE RRI  ++  +I ++EF+P +LG  ++N   LNL    Y   Y E  NPT+ + F  AA+RFGHS+++ N  R+  +      +  L   FFN     +   L  ++++ G++    ++ D+F+  EVTN+LF +   P+ G DL A  + R RDHG+P Y  +R  C L    +++    EI+  +   L+  Y+  +DID+ T GL+ETP+   ++GPT  CIIG QF  L+  DRF++        FT  Q+  +R+ SL++V CDN   D++S +   +F
Sbjct:  101 VMDIPRVFQCDEQTLP-CDHTTKYRTMTGWCNNLDNPSYGKSVRAFTRLLAPAYDDGLMSPRSRSVTGSR--------LPSPRLISVNIHNDVSAPHVRYSLMMMQWGQFVDHDLTHTPVNRGFADSILSCKDCDSKSRVHPECLPIPVPEGDPFYPKINITSGKEFCLAFTRSMPGQLTLGFREQMNQITSFADASNVYGSDVCEMRELRFNQGGKLNSTRQRRGKNLLPQTAENAECKSESGLCFEAGDARNSEQPVLTAIHTLFMREHNRIADRLAQLNPQWSDEKLYQEARRIGSSVQAHITWNEFVPRVLGWNAVNLYELNLLPEGYYRGYDETCNPTILNEFATAAFRFGHSLLKPNFKRMGGEFSEKGPDLKLSDMFFNPDKLYEPGML--DDLIRGVSTTSMETLDQFLTNEVTNHLFEDKHTPFSGLDLAALNLQRARDHGIPGYNHYRAICNLTRAANFDKLKREIAPPVIERLRRTYAHVDDIDLFTGGLSETPLHGGLVGPTFACIIGIQFRNLRKCDRFWYEGGNPLIRFTEAQLDEIRKVSLAKVTCDNC--DQVSHIQRAMF 1792          
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Match: gi|592781677|gb|GAXK01172891.1| (TSA: Calanus finmarchicus comp132241_c2_seq2 transcribed RNA sequence)

HSP 1 Score: 328.946 bits (842), Expect = 6.008e-96
Identity = 209/577 (36.22%), Postives = 304/577 (52.69%), Query Frame = 0
Query:   80 IKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-NSHEAKCCEGAKD--------DRCLPIRIYENDLFYSNFNVT-----CLNFYRSVRFCSSTP-REQYNEITSFIDASNVYGSSDXXXXXXXXXNSYLMKSTLTDDGKELLPKDGKGS---------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNG-KPY-GADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            + DI    +  + T+P CD   KYR M G CNN  NP +G       R L P Y+D   +P   S   +R        LP+ R +S  +H DV  P    S M+ QWG FV HDL+  P N   A      KD          CLPI + E D FY   N+T     CL F RS+    +   REQ N+ITSF DASNVYGS   E+  L+      + ST    GK LLP+  + +         F  GDAR      L ++HTLF+REHNRI+ +LAQ+NP +++E ++QE RRI  ++  +I ++EF+P +LG  ++N   LNL    Y   Y E  NPT+ + F  AA+RFGHS+++ N  R+  +      +  L   FFN     +   L  ++++ G++    ++ D+F+  EVTN+LF +   P+ G DL A  + R RDHG+P Y  +R  C L    +++    EI+  +   L+  Y+  +DID+ T GL+ETP+   ++GPT  CIIG QF  L+  DRF++        FT  Q+  +R+ SL++V CDN   D++S +   +F
Sbjct:  563 VMDIPRVFQCDEQTLP-CDHTTKYRTMTGWCNNLDNPSYGKSVRAFTRLLAPAYDDGLMSPRSRSVTGSR--------LPSPRLISVNIHNDVSAPHVRYSLMMMQWGQFVDHDLTHTPVNRGFADSILSCKDCDSKSRVHPECLPIPVPEGDPFYPKINITSGKEFCLAFTRSMPGQLTLGFREQMNQITSFADASNVYGSDVCEMRELRFNQGGKLNSTRQRRGKNLLPQTAENAECKSESGLCFEAGDARNSEQPVLTAIHTLFMREHNRIADRLAQLNPQWSDEKLYQEARRIGSSVQAHITWNEFVPRVLGWNAVNLYELNLLPEGYYRGYDETCNPTILNEFATAAFRFGHSLLKPNFKRMGGEFSEKGPDLKLSDMFFNPDKLYEPGML--DDLIRGVSTTSMETLDQFLTNEVTNHLFEDKHTPFSGLDLAALNLQRARDHGIPGYNHYRAICNLTRAANFDKLKREIAPPVIERLRRTYAHVDDIDLFTGGLSETPLHGGLVGPTFACIIGIQFRNLRKCDRFWYEGGNPLIRFTEAQLDEIRKVSLAKVTCDNC--DQVSHIQRAMF 2254          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000004874 (pep:novel supercontig:LSalAtl2s:LSalAtl2s256:608070:622038:-1 gene:EMLSAG00000004874 transcript:EMLSAT00000004874 description:"maker-LSalAtl2s256-snap-gene-6.24")

HSP 1 Score: 2485.29 bits (6440), Expect = 0.000e+0
Identity = 1193/1193 (100.00%), Postives = 1193/1193 (100.00%), Query Frame = 0
Query:    1 MFGVKEQMSLLCICLYIVKVYGEGCPFASSANDEKKLLDQANVKDVDYHKLLQKGRQVTPKLVKKGYSRDSAHQKVIQLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVSMFKGLYCSRSTHGGFRIVEGKDAGNFSDFVVGFFFIVPNKVCSASIVSSRFVVSAVHCLRENGNPIYVDSSCRTKAPKNVQPKIKSCRLTRNGDTRIRVWRRGAWIVRKSRDLTNPFSGYIHYIKYIYRPKGSYYGGEYNIRGGYDIVLLKLERGSTIKDYLKEPLRGFTFERLNIPSPDFQTEVFLFRSSGNNTYQPLTKCFATNPSKFGWCGTVLLTNVDKPDKVSDIYASKYNVRPENGWGFCSKSCFRGYKHQQTSDNNHSGSGKLRYNKRNVLNSEYCYKELYARLKQGFGKEKFLYEPHILCFARNMTFKTRYFEFDGKRIIHEAKEPSVALRQTFGRESNWYISHPGICYGDSGGPLIRTIRKGFRRIHILLGIASKGQGIHGHCGGSSTLAHFVRIKNFSGWLLSYIRDDPGVRVFPSEMTLEDLEKFKDSNIMNEKSFYSWFIRFGKVFRSKTSNLMPRFHNKLEQRTKRDDQNIFNVLVNRLSYNNLSSSEVIMQYIDAIDAMTTTGYQSFTSKYGHIVSTNNQKVKKKRFNNESIYVSRRVIKKLFGTLLVQH 1193
            MFGVKEQMSLLCICLYIVKVYGEGCPFASSANDEKKLLDQANVKDVDYHKLLQKGRQVTPKLVKKGYSRDSAHQKVIQLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVSMFKGLYCSRSTHGGFRIVEGKDAGNFSDFVVGFFFIVPNKVCSASIVSSRFVVSAVHCLRENGNPIYVDSSCRTKAPKNVQPKIKSCRLTRNGDTRIRVWRRGAWIVRKSRDLTNPFSGYIHYIKYIYRPKGSYYGGEYNIRGGYDIVLLKLERGSTIKDYLKEPLRGFTFERLNIPSPDFQTEVFLFRSSGNNTYQPLTKCFATNPSKFGWCGTVLLTNVDKPDKVSDIYASKYNVRPENGWGFCSKSCFRGYKHQQTSDNNHSGSGKLRYNKRNVLNSEYCYKELYARLKQGFGKEKFLYEPHILCFARNMTFKTRYFEFDGKRIIHEAKEPSVALRQTFGRESNWYISHPGICYGDSGGPLIRTIRKGFRRIHILLGIASKGQGIHGHCGGSSTLAHFVRIKNFSGWLLSYIRDDPGVRVFPSEMTLEDLEKFKDSNIMNEKSFYSWFIRFGKVFRSKTSNLMPRFHNKLEQRTKRDDQNIFNVLVNRLSYNNLSSSEVIMQYIDAIDAMTTTGYQSFTSKYGHIVSTNNQKVKKKRFNNESIYVSRRVIKKLFGTLLVQH
Sbjct:    1 MFGVKEQMSLLCICLYIVKVYGEGCPFASSANDEKKLLDQANVKDVDYHKLLQKGRQVTPKLVKKGYSRDSAHQKVIQLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVSMFKGLYCSRSTHGGFRIVEGKDAGNFSDFVVGFFFIVPNKVCSASIVSSRFVVSAVHCLRENGNPIYVDSSCRTKAPKNVQPKIKSCRLTRNGDTRIRVWRRGAWIVRKSRDLTNPFSGYIHYIKYIYRPKGSYYGGEYNIRGGYDIVLLKLERGSTIKDYLKEPLRGFTFERLNIPSPDFQTEVFLFRSSGNNTYQPLTKCFATNPSKFGWCGTVLLTNVDKPDKVSDIYASKYNVRPENGWGFCSKSCFRGYKHQQTSDNNHSGSGKLRYNKRNVLNSEYCYKELYARLKQGFGKEKFLYEPHILCFARNMTFKTRYFEFDGKRIIHEAKEPSVALRQTFGRESNWYISHPGICYGDSGGPLIRTIRKGFRRIHILLGIASKGQGIHGHCGGSSTLAHFVRIKNFSGWLLSYIRDDPGVRVFPSEMTLEDLEKFKDSNIMNEKSFYSWFIRFGKVFRSKTSNLMPRFHNKLEQRTKRDDQNIFNVLVNRLSYNNLSSSEVIMQYIDAIDAMTTTGYQSFTSKYGHIVSTNNQKVKKKRFNNESIYVSRRVIKKLFGTLLVQH 1193          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000013035 (pep:novel supercontig:LSalAtl2s:LSalAtl2s99:469219:492645:-1 gene:EMLSAG00000013035 transcript:EMLSAT00000013035 description:"maker-LSalAtl2s99-augustus-gene-5.19")

HSP 1 Score: 489.574 bits (1259), Expect = 6.855e-156
Identity = 243/519 (46.82%), Postives = 338/519 (65.13%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSH-EAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLF-NNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDK 618
            KYR + G+CNN  NP +G+      R +  +Y + ESNPT   Q   + GC+ SGPLPN R +S     D + P + A+ M++Q+G F+ HDL+  P +H +  CCE    + C PI +   D F+S F  TCL   RS +FC+S PR+Q+N +TSF+DASNVYGS +E    L+  NSYL+++T T  GK LLP    G F+ GD R+    GLA++H LF+REHNRI++ LA+ +   + E +FQE RRI+GA MQNIVY EFL  +LG +  +   LNLK  S Y   +NP+ ++ F  AA+RFGHSM++ ++ R +I   +    + L  +F N   Y  +NG G+EEI+ GL    AQS DRF++ +VT +LF      +G DL A+ I R RDHGLP YG +R+  GL+P+C+W  +P+ IS   W LLK  Y SPNDID+  AG+AETP+  SVLG T  C+IGRQF AL+DGDRFFFTH G++GSFT +Q+K++R+ +LS+++CDNT I +
Sbjct:  112 KYRTITGECNNLQNPKWGASFTPFARVIEARYGNDESNPTTVGQHYEKPGCLKSGPLPNPRLLSVNFFKDKNRPLSRATHMLAQFGQFLDHDLTLTPEAHVDVPCCEDPSQEECNPIEVSRKDPFFSKFKQTCLELTRSEKFCNSRPRQQFNAVTSFVDASNVYGSEEELAKELRVPNSYLLRTTRTKTGKSLLPLID-GEFLAGDERSSEMPGLATMHNLFLREHNRIAKLLAEHHGHKSKEEIFQEARRIVGAEMQNIVYGEFLHGILGYRRFHYD-LNLKQSSFYDPFMNPSTSNSFATAAFRFGHSMVEGSIQRRSISNNALIRTFQLKNNFNNLNEYTAKNGRGMEEIICGLFTQSAQSPDRFIIDDVTRFLFREKNSKFGQDLMARNIQRSRDHGLPPYGAFRQAXGLKPICNWKTRPSSISXQNWNLLKRWYKSPNDIDLFVAGVAETPLSGSVLGETFACLIGRQFRALRDGDRFFFTHYGQSGSFTFEQIKSIRKRTLSQIICDNTQIKR 628          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000005019 (pep:novel supercontig:LSalAtl2s:LSalAtl2s260:729964:778752:-1 gene:EMLSAG00000005019 transcript:EMLSAT00000005019 description:"maker-LSalAtl2s260-snap-gene-7.19")

HSP 1 Score: 452.981 bits (1164), Expect = 1.308e-141
Identity = 213/428 (49.77%), Postives = 298/428 (69.63%), Query Frame = 0
Query:  194 LSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLF-KD-FFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKI 619
            +S  P +H + CC     + C  I I  ND F+S  + TCL F RS  +C S+PREQ+N ITS++DASNVYGS    L  L+++N+YL+K+T +  GKELLPK+  G ++ GD RA +  GLA++HTLFVREHNRI+ ++ +  P+   ET+F+E RRI+GA  QN+VY ++L +L   K M+  GL +   S Y  +IN  +++ F  AAYRFGHSM+Q ++ R+ +   +  SN S F KD FFN  +YE ++GLG+EE++ GL + P+QS DR  + ++TN+LFN GK +G+DL A+ I RGRDHGLP+YG WR+ C L+PLCDWN KP  I ++ W +LK+LY+SPNDID+ TAGLAE P   SVLG T +CI+G+QF  LK+GDR+FFTH  +A SFT  Q+  +R  +L +++CDNT I K+
Sbjct:    1 MSLTPEAHVSNCCTDNSQEGCSAISIPSNDPFFSTVSQTCLEFTRSEHYCDSSPREQFNIITSYVDASNVYGSDSTRLRSLRDDNNYLLKTTKSATGKELLPKNAAGDYIAGDVRATVIPGLAAMHTLFVREHNRIANQILKEFPTMDKETIFEEARRIVGAENQNVVYGQYLSSLFSPKLMDRFGLRMTSKSRYDSKINAAISNGFATAAYRFGHSMVQGDIQRIGLT--AADSNTSFFPKDAFFNMQHYEAKDGLGLEEVILGLLHQPSQSYDRLAIDDITNHLFNGGKAFGSDLIARNIQRGRDHGLPTYGFWRQHCDLQPLCDWNKKPX-IKQSNWDILKKLYNSPNDIDLFTAGLAENPSEGSVLGETFSCILGKQFENLKNGDRYFFTHTNQASSFTESQINNIRTRTLGQIICDNTDIQKV 425          

HSP 2 Score: 275.789 bits (704), Expect = 4.088e-78
Identity = 140/344 (40.70%), Postives = 203/344 (59.01%), Query Frame = 0
Query:   56 RQVTPKLVKKGYSRDSAHQKVIQLIKDIEYELEECKGT-MPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREG-CISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVA 397
            ++   KL + G S     ++V  L+ +       C  T   +C  + KYR ++G CNN  N  +G+    L R L  +Y +A S P     F   +  C   G LPN+R VS+T H D DVPST+A+ MV+Q+G ++ HDLS  P +H   CC     D C  I I  ND FYS   +TCL F RS ++C S+PR+Q+N ITS++DASNVYGS    L +L++ N YL+K+T T  GKELLP +    ++ GD RA++   L ++HTLFVREHNRI++++ +  PS   ET+FQE RRILGA  QN+V+ ++L +L   K ++   L +   S+Y   +N  ++
Sbjct:  492 KKAMNKLERVGKSTQDFKEEVKNLLAEKFGAQAPCSSTATSNCTADSKYRTIDGTCNNKENTSWGATGAPLIRLLEARYGNAASTPKTKGLFTPSDANCAQPGNLPNSRHVSTTFHPDSDVPSTLATHMVTQFGQYLDHDLSLTPENHVFNCCGDNSKDECSAISIPSNDPFYSTVGITCLEFTRSQQYCDSSPRQQFNAITSYVDASNVYGSDSARLAILRDSNKYLLKTTKTATGKELLPTNDFYVYIAGDPRAVVIPELTTIHTLFVREHNRIAKEILETFPSMDKETIFQEARRILGAENQNVVFDQYLASLFSHKYLDRYRLRITSRSTYDPAVNADIS 835          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000001069 (pep:novel supercontig:LSalAtl2s:LSalAtl2s117:1071016:1073247:1 gene:EMLSAG00000001069 transcript:EMLSAT00000001069 description:"augustus_masked-LSalAtl2s117-processed-gene-10.0")

HSP 1 Score: 341.273 bits (874), Expect = 9.758e-102
Identity = 200/546 (36.63%), Postives = 301/546 (55.13%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEA------KCCE---GAKDDRCLPIRIYENDLFYSNFNVTCLNFYRS---VRF-CSSTPREQYNEITSFIDASNVYGSSDEEL-----------LLLKEENSYLMKSTL-----TDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT 614
            +YR +NG CNN  +P +G+      RFL P + D  S P  +          +  PLP+AR VSS +H D        + ++  WG F+ HD++    + +       KCCE    A    CLPI I  +D F+S     C+NF RS   +R+ C   PR+ +NE++S +DA  VY +SDE L            +L   N + MK  L     + D   + P +    F+ GDA     T LA +HTLF REHNRI+ +L ++NP + +ET+FQETR I+ A++ +I Y+EFLP +LG++ M +  L L    Y +SY    NP+ ++VFV+AA+RFGHS++   + R + K + Y  +  L +       Y+       +  L GL    AQ+ D  + +EVTN+LF   GK +G DL A  I R R+HG+P Y  WRE+ GL  +  W++    +S +       +Y SP+DIDI +AG+ E P+P S++GPT  CIIG+QF  L+ GDR+++ + G   SFT +Q++ +R+   SR++CDN+
Sbjct:  157 RYRSVNGMCNNVEHPHWGAAMNGHHRFLAPNFADGISAPRASK---------TGNPLPSARIVSSNMHRDEGFHDHAVTILLVAWGQFIDHDITLSAETKDPRTGKTPKCCEEGQTAVHPNCLPIEIPSHDTFFSKHKQRCMNFVRSQAGLRYNCRLGPRDTFNEVSSLLDAGTVYSNSDETLESLRLYKDGLLKMLPVFNEFEMKELLPLKLESPDEGCIRPSEDVYCFLAGDAXVNEQTVLAMIHTLFAREHNRIAGELKKVNPHWNDETIFQETRHIIAALISHINYNEFLPMVLGKEVMQQHDLILLKNGYSNSYDTFTNPSASTVFVSAAFRFGHSLLPSTIERWS-KTHRYIGSQRLSEML--QQPYDLYKAGWADNYLMGLVNQVAQALDDSLSQEVTNHLFQEPGKKFGLDLAALNIQRAREHGVPGYNGWREWXGLPKIHRWSDLRGLMSNSSVHGYASIYESPDDIDIWSAGITEKPLPGSMIGPTLACIIGKQFHNLRHGDRYWYENGGWPSSFTLEQLEEIRKIKFSRILCDNS 690          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000009839 (pep:novel supercontig:LSalAtl2s:LSalAtl2s63:1106053:1116580:-1 gene:EMLSAG00000009839 transcript:EMLSAT00000009839 description:"maker-LSalAtl2s63-snap-gene-10.65")

HSP 1 Score: 325.479 bits (833), Expect = 2.001e-92
Identity = 202/565 (35.75%), Postives = 312/565 (55.22%), Query Frame = 0
Query:   87 LEEC---KGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSH-------EAKCCEGAKD--DRCLPIRIYENDLFYSNFNVT-----CLNFYRSVRFCSST-PREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDG--KELLPKDGKGS---------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTAN-YEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PY-GADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGI 616
            LE C   + ++P CD   KYR MNG CNN  NP +G     L RFL  KY+DA S P    +F++  G      LP+ R VS  VH DV       + M+ Q+G F+ HD++  P +        + + C+ A+     C PI + +ND ++   N T     C+ F RS+       PREQ N+ T+FIDAS +YG+   + + L++     + +TL   G  K L+PKD             F GGDARA    GLA++HT+F+REHNR+  KL ++NP ++++ ++ E R IL A+ Q+I Y+EFLP ++G   MN   L ++   Y S Y    NP + + F  AA+RFGHS+I+  + R++        +  L   FFN    Y++     I+E++ GL   P ++ D+F+  E+TN+LF   K P+ G DL A  I RGRDHGL  Y ++R  C L+    + +   EI+ ++   LK++Y S +D+D+ T GL+E P+  +++GPT  CIIG QF  +K  DRF++ ++     F+  Q+  +R+ +L +++C+N  I
Sbjct:  835 LEVCPFDENSLP-CDHTHKYRTMNGWCNNLNNPQYGKSVTPLVRFLSAKYDDAISRP----RFRSATG----KSLPSPRMVSIVVHADVSHLHGRYTLMLMQFGQFLDHDITLTPVNKGFPDSILDCRGCDSARTVHPECWPISVPKNDPYFPALNTTSGRAHCIAFTRSLPGQQRLGPREQVNQNTAFIDASMIYGNDKCDSIDLRQNIDGRLNTTLPSHGRGKHLMPKDSSNKECKAASGFCFKGGDARASEQPGLAALHTIFLREHNRLVTKLKRVNPHWSDDELYYEGRHILSAVNQHITYNEFLPRIIGWNYMNLYNLRVQTQGYSSDYESTCNPGIFNEFATAAFRFGHSLIRPMLTRMSADWKEKKKHIRLRDGFFNPDMLYQE---TMIDEVIRGLVATPMENQDQFISGEITNHLFEEKKIPFSGLDLAALNIQRGRDHGLRPYNEYRVACNLKKARTFEDLGREINADVIKRLKQVYDSVDDVDLFTGGLSENPLQGALVGPTFACIIGIQFQKIKKCDRFWYENNDANNRFSEAQLTEIRKMTLGKIICENCDI 1387          

HSP 2 Score: 262.307 bits (669), Expect = 8.419e-72
Identity = 177/540 (32.78%), Postives = 265/540 (49.07%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSF-VPNSHEAKCCEGA--KDD--RCLPIRIYENDLFYSNFNVTCLNFYRSV----RFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKD-----------GKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIK-----KYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDN 613
            KYR  N +CNN  NP++G       R + P+YED    P E+S  + ++       LP+A  VSS +    + P    + + + WG FVAHD+S+ +P S   +CC+    K++   C PI          N    C  + RS       C   PREQ N  T+F+D S +YGS+ +     ++    L+K  + D    +LP D           G   F  GD R     GLA +HTL  +EHNR++R L  +NP +  ET++QE RRI+ A +Q+I Y+E LP +LGE  M    L  K   Y   Y E +  T  +    A   F  S+    +N    K     +  ++S Y         A +  ++   I EIL GL+  PAQ AD  + ++   YL         DL A  I RGRDHGLP+Y   RE CGL P+ ++      + + +  LL+  Y   +D+D+   GLAE P+   V+GPT  C++G+QF  LK GDRF++ ++    ++   Q+  LR+ +L+ ++C N
Sbjct:  166 KYRTPNAECNNVKNPMWGVTGAAYLRLVEPQYEDGVGXPRESSILEEKK-------LPDASTVSSKLVWTHNNPHEHITAIAATWGEFVAHDISYTLPLSGFEQCCDSMFRKENAMECFPI---------VNDQTVCQEYVRSAIGLKPGCVLGPREQMNFATAFLDGSGIYGSTPKSGEDRRKLEGGLLK--MGDPEGNVLPLDKNNPNCRPNLDGHECFKSGDERVNHNAGLAVLHTLLAKEHNRVARSLEGVNPHWDEETLYQEARRIVSAEIQHITYNEXLPAILGEVLMKTFDLEPKSNGYNMEYDEXLPVTTLNSVGNAILPFVLSLFPPKLNFFNSKGKQTGQVPFNSTY--------WAPFHAKDKKLISEILLGLSRTPAQKADLVMARDTKIYL-------NQDLVANIIHRGRDHGLPTYTQVRETCGLSPVRNFEELSNTVDKEVIGLLETTYEHVSDVDLFIGGLAERPLSGGVVGPTFGCLLGQQFQILKKGDRFWYENNIPPSAYGKDQLLELRKVTLASLICSN 672          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000000648 (pep:novel supercontig:LSalAtl2s:LSalAtl2s10:912782:918417:-1 gene:EMLSAG00000000648 transcript:EMLSAT00000000648 description:"maker-LSalAtl2s10-augustus-gene-9.24")

HSP 1 Score: 306.99 bits (785), Expect = 2.360e-86
Identity = 199/587 (33.90%), Postives = 302/587 (51.45%), Query Frame = 0
Query:   86 ELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPN-----SHEAKCCEGAKDD---RCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGS-------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGL---NLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTAN-YEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKP-YGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVSMFKGLYCSRSTHG 642
            EL   K   P C P  KYR  NG CNN  NP +G    R  R+LPP Y D  +              +S G         S VH     P  +  T +  WG F+ HD+S  P          KCC+   ++    C PI+I  ND FYS   + C  + RS       C+  PREQ N++TSFID S VYGSS EE   L+  +  L+K      G +LL KD + S             F  GD R     GL ++HTL+VR+HN+++  L  +NP + +E +FQETRRI+GA +Q+I ++E+LP +LG+++M+   L    + + S Y    NP  A+     A+RF  S+I      +     +    + L   F+N  + YED  G+ I+ ++ GLT+  A+  D  + +E+TN +F + +   G D+ A+TI +GRDHG+P Y +WR+FC L P+ ++      + +    +LK +Y+S  +ID+   GLAE P   +V+GPT  C+IGRQ    K GDR+++ +D    S + +Q+  +R+T+L+ ++C+N  I  + F+   +F+     L      HG
Sbjct:  147 ELCHIKVDFP-CQPG-KYRAYNGYCNNVQNPNWGVANRRYLRYLPPDYADGIT--------------VSQG--------FSEVH-----PHLMMITAI--WGQFIYHDVSHTPQMAGYLGQRLKCCDIEFENFHPECYPIKISSNDPFYSKAGLRCQEYARSGTASRTGCTLGPREQINQVTSFIDGSTVYGSSKEEAEELRSFSGGLLKVQHDKKGSDLLAKDTENSLDCKEDRKSGLKCFKSGDVRVNENLGLVTMHTLWVRQHNKVAGTLGTLNPHWNDEQIFQETRRIIGAQIQHITFNEYLPVVLGKEAMDRYNLLPQQMGFFSGYDINTNPGTANGVATTAFRFIMSLIPSTFKFIDPNGKTIKEEF-LSSTFYNPFSLYED--GM-IDNLIRGLTHSHAEKEDLVINEEMTNKMFMDSRTGLGLDILAQTIQQGRDHGIPGYTEWRKFCSLSPIRNFGELENIMGKKTVNILKSVYTSVEEIDLFIGGLAEVPSDGAVVGPTFACLIGRQMYYYKTGDRYWYENDIPPSSLSKEQLNQIRKTTLAHIICEN--IPSVQFIQPKVFIESDPFLNAFMPCHG 696          

HSP 2 Score: 286.96 bits (733), Expect = 8.600e-80
Identity = 197/578 (34.08%), Postives = 286/578 (49.48%), Query Frame = 0
Query:   80 IKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSH-------EAKCCEGAK--DDRCLPIRIYENDLFYSNFNVT-----CLNFYRSVRFCSSTP-REQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDG-KELLP-----KDGKGS----FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPY-GADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            + DI    +  + T+P CD   KYR + G CNN + P +G       R L P Y+D   +P        R   ++  PLP+ R VS  +H DV  P    S M+ QWG FV HD++  P +        E K C+ A      CLPI + + D FY + N+T     CL F RS+    +   REQ N+ITSF D SNVYGS   E+  ++E +   + ST    G K+LLP     K+ K      F  GDAR      L S+HTLF+REHNRI+ +L ++NP ++++ +F E RRI  ++ Q+I ++EFLP +LG  ++N   L L    Y  SY E+ NPT+ + F  AA+RFGHS+I+    R+   +YS         D F   +     G+ +++++ G++    ++ D+F+  EVTN+LF +   PY G DL +  I RGRDHG                                                 GLAET +   ++GPT  CIIG QF  L+  DRF++        FT  Q+  +R+ +LS+V+CD T  D I+ +   IF
Sbjct:  831 VMDIPKVFQCDEQTLP-CDHTTKYRTLTGWCNNLLFPEYGKSXRAFTRLLAPAYDDGLMSP--------RSRSVTGSPLPSPRLVSVNIHNDVSTPHVRYSLMMMQWGQFVDHDITHTPVNSGFADSILECKDCDAASRIHPECLPIPVPKGDPFYPSINITTGKPFCLAFTRSMPGQLTLGFREQMNQITSFADGSNVYGSDLCEMREIREMHGGRLNSTKQRHGQKDLLPLTTENKECKSESGYCFEAGDARNSEQPLLTSLHTLFMREHNRIADELIRLNPQWSDDKLFHEARRIASSIQQHITWNEFLPRVLGWNAVNLYELGLLPEGYYRSYDEKCNPTILNEFATAAFRFGHSLIKPKFKRMN-NQYSEKGRPLKLADMFFNPDKLHEPGM-MDDLIRGVSSTSMETLDQFITDEVTNHLFEDKNTPYSGLDLASLNIQRGRDHG-------------------------------------------------GLAETALHGGLVGPTFACIIGIQFRNLRKCDRFWYEGGNPLTRFTETQLAEIRKVTLSKVLCDTT--DDITTIQRAIF 1346          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000001116 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1186:32429:36877:-1 gene:EMLSAG00000001116 transcript:EMLSAT00000001116 description:"maker-LSalAtl2s1186-snap-gene-0.11")

HSP 1 Score: 286.189 bits (731), Expect = 1.260e-82
Identity = 186/554 (33.57%), Postives = 280/554 (50.54%), Query Frame = 0
Query:   95 PDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCE---GAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGS--------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGL---NLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFN-NGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNL 624
            P C+PN KYR   G  NN   PLFG+    +QR L   Y D    P  +S         +  PLP+AR VS+++       ++  + ++   G F+ HDL  VP     N     CC    G    +C PI I   D+ + +   TC+NF RS+      C+  P EQ N++T +ID SN+YGS+ EE   L+          L      LLP+D +          F+ GD+R      LA +HTL+VR+HN+++ +L+Q NP + +ET+FQE +RI+ A  Q+++++E+LP  LG   M   GL      +   Y  + +P + + F AA +R GH++I   +   ++     +  + L +  FN     +  G+  +E+  G+     +  D    +E+T++LF  NG   G DL A  I R RDHG+P Y  +RE CGL     + +  + IS      LK +Y S +DID+      E     + +G T  CII  QF  LK GDR+F+    +AGSFT  Q+  +R+ SLSR++CDNT I +I  L L
Sbjct:  153 PRCNPNEKYRNPRGLXNNXRQPLFGAVFTPVQRILRNAYFDGFEIPRRDS---------NGSPLPSARLVSTSITRKNKNTASQYTNILMSMGQFLDHDLVHVPVHRLDNGDTIDCCSTRFGNNSLQCFPISIPRGDISFGS--RTCINFVRSLSAPDLDCNPGPNEQLNQLTHWIDGSNIYGSTQEETNKLRS----FRGGKLRMKRSSLLPEDNENEECVDEFECFLAGDSRVNEQLTLAVMHTLWVRQHNKVADELSQFNPFWNDETLFQEAKRIVSAQWQHVIFNEWLPVXLGPTMMESFGLWTLRRGFSFDYRNDFDPRITNEFAAAGFRVGHTLIPSFLKAYSLISSRLTRRWQL-RSIFNDPGVLETPGV-FDEVALGMVIQNVEDFDNSFTEEITDHLFERNGD--GLDLIALNIQRARDHGIPGYVRYREICGLGRARTFEDLGSNISRRKIAQLKSIYKSVDDIDLFIGMTLEDKFRDAFIGRTFLCIISDQFARLKKGDRYFYDLSNQAGSFTSAQLDEIRKFSLSRLICDNTNIKEIQPLAL 687          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000003246 (pep:novel supercontig:LSalAtl2s:LSalAtl2s178:299489:302526:-1 gene:EMLSAG00000003246 transcript:EMLSAT00000003246 description:"maker-LSalAtl2s178-augustus-gene-3.11")

HSP 1 Score: 284.263 bits (726), Expect = 3.558e-81
Identity = 181/482 (37.55%), Postives = 271/482 (56.22%), Query Frame = 0
Query:  180 STMVSQWGMFVAHDLSFVP-----NSHEAKCCEGAKDD--------RCLPIRIYENDLFYSNFNVTCLNFYRS---VRF-CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLP--------------KDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNG-KPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT-GIDKI---SFL 622
            + MV QWG F+ HDL+  P     N    +CC G   +         C+PI I  +D FYS+F   C+ F RS    R  C+  PREQ N+ITSF+D SNVYGSS+++   L+   S  ++ T     K LLP                    F  GD RA    GL  +HT+++R HN I++KL+++N  + +E ++QETR+I+GA++Q+I Y+E+LP +LG K +    L L   +Y   Y++ +NPT+A+ F AAA+RFGHS+++ +++R   +  +      L K+F N  N    N   ++ IL GL    A   D F+ +E+TN LF      YG DL +  I RGRDHG+PSY  WRE CGL+    W+   + I+ +    L  +Y   +D+D+ T GLAE  +   ++GPT  CI+G+QF  L+ GDRF++ +    G+F+ +Q++ +R+ +LS V+CD    ID I   SFL
Sbjct:  188 TMMVMQWGQFLDHDLTSTPQTRGFNDSILQCCNGDGANLRDSDLHPDCMPIDIPHDDYFYSSFGARCMEFVRSSPSARLGCTLGPREQVNQITSFLDGSNVYGSSEDDEKSLRLYISGKLRYTDLHIRKALLPPLESTVANEECHITTKNLHCFHAGDQRANEQPGLTGMHTIWLRFHNHIAQKLSRLNTHWEDEKIYQETRKIVGALLQHITYNEWLPVILGPKVLEIFELKLLTKEYYKQYNKSVNPTIANAFAAAAFRFGHSLVKGSISRCNKEFKTVPFFVKLHKEFNNPMNL--HNFGSVDRILLGLLTEKAAKRDEFISEELTNRLFQIPLTHYGMDLASLNIQRGRDHGIPSYNVWREQCGLKRFNRWSEAFSVIAPSTIERLSGVYEDFDDVDLFTGGLAEHRVAGGLVGPTLACILGQQFLNLRQGDRFWYENGDHPGAFSKEQLQEIRRVTLSGVICDTLDDIDNIQPYSFL 667          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000002939 (pep:novel supercontig:LSalAtl2s:LSalAtl2s168:430928:460867:-1 gene:EMLSAG00000002939 transcript:EMLSAT00000002939 description:"maker-LSalAtl2s168-snap-gene-4.8")

HSP 1 Score: 268.47 bits (685), Expect = 1.659e-76
Identity = 170/496 (34.27%), Postives = 253/496 (51.01%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPT-ENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCEGAK-------DDRCLPIRIYENDLFYSNFNVTCLNFYRSV----RFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLP---------KDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGL----NLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQ--------RNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISE-NIWLLLKELYSSPNDIDIHTAGLAE 553
            C  +  YR ++G CNN  NP +G     L+R LP  Y+D  S P  ENS             LP+ARKVS  +  D D PS I + ++ QWG F+ HD++  P     +  E  CCE  K          C  I I E+D FYS F   C+ F RS       C+  PREQ N+IT+FID S +YGS   E + L+      ++ T     +ELLP          + +  F  GD R      L  +HT+++REHNRI+ +LA +NP + +E +FQE R+I+GA +Q+I Y+E+LP +LG+K +NE  L    N +Y  SY   +NP++ +VF  AA+RFGH+++Q           +R  I    + +N+  ++ +   A         I  ++ G+T   +Q  D    +E+T  LF   +  G DL A  I RGRDHG+ SY  +R  CGL  +  W +    +S   +   L+ +Y+  +D+D+   G+ E
Sbjct:  236 CSTSEIYRRIDGSCNNFNNPNWGKANIPLERLLPATYDDGISIPRGENSD------------LPSARKVSDVLIGDRDAPSPIYTLLLMQWGQFMDHDITHSPIVRGDDDEELMCCEDGKILDESRRHPECFHIEITEDDTFYSRFGRRCMEFVRSSPSLRSECNLGPREQVNQITAFIDGSQLYGSEKAENIRLRLGKQGRLRVTKYGH-QELLPLNPEECSDDDEQRYCFEAGDTRVNEQLHLTLMHTIWLREHNRIAGELAYLNPYWNDERIFQEARKIVGAQLQHITYNEWLPLILGDKFVNEEDLRPLENYEYSESYDPSVNPSITNVFSTAAFRFGHTLVQGFLHSHRGDGFDRKTI--VLHETNFEPYEMYLKNA---------INNLINGITTQRSQDFDASFTQEITRRLFQGNESVGMDLVALNIQRGRDHGIQSYVRYRRVCGLSEIRTWRDFSQVVSSPELVPRLQLIYNDVDDVDVFIGGVME 707          
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Match: EMLSAP00000006220 (pep:novel supercontig:LSalAtl2s:LSalAtl2s33:28635:33298:1 gene:EMLSAG00000006220 transcript:EMLSAT00000006220 description:"maker-LSalAtl2s33-augustus-gene-0.24")

HSP 1 Score: 271.166 bits (692), Expect = 4.567e-75
Identity = 193/568 (33.98%), Postives = 288/568 (50.70%), Query Frame = 0
Query:  103 YRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTV--HTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKC------CEGAKDDR--CLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTP----------REQYNEITSFIDASNVYGSSDE----------ELLLLKEENSYLMKSTLTDDGKELLP----------KDGK----GSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYP-SSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSY--SSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSAD--RFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEI-SENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDN-TGIDKI 619
            YR ++G CNN   PL G+     +R + P+YE+  + P    +   RE   +   +P+AR +SST+   + VD+   + S M  QWG F+ HD+     +   K       C G   +R  C PI +  ND   SN    C+ F RS   C S            REQ N++TS+IDAS VYGS  +              L+EE   L      +  K  LP          +D +    G F+ GD RA    GL S+HT++ R+HN I  KL ++NP++  + ++QE+R+I+GA MQ+I YS +LP ++G +     G+ L  P   Y   I+ ++++VF  AA+RFGH++I   + RL  + +S     + SL + FF+          G++ IL GL   PA+  D    +  E+T  LF        DL A  I RGRDHG+PSY  WREFCG + +  W++  T I +  +   LK LY    +ID+    L E  +P + +G T  CI+  QF  L+DGDRF++ +      FTP+Q+  ++ TSL  V+CDN   ID++
Sbjct:  578 YRTIDGTCNNYEYPLRGASLTTFKRLMLPEYENTFNLP----KGWDREKLYNGYKMPSARAISSTLVATSSVDIDQDL-SHMAMQWGQFLDHDIDHSMEAISQKAFEDGITCSGTCGNRPPCFPIEVPLNDPRISNHR--CMEFTRSSATCGSGMTSVFFEAVQYREQLNQLTSYIDASQVYGSEHDLAQNLRNLTNNFGRLREEQXPL------EYPKPFLPFNIDHPVDCRRDPRASNIGCFLAGDVRANEQLGLLSMHTIWFRQHNFIVTKLRELNPTWDGDRLYQESRKIIGAQMQHITYSHWLPLIIGNE-----GMELIGPYQGYDPSIDSSISNVFATAAFRFGHTLINPILLRLN-RNFSVIDEGHLSLHEAFFSPWRLVQEG--GVDPILRGLFISPAKKPDPSSIMNDELTEKLFEAAHNIALDLGALNIQRGRDHGMPSYLKWREFCGFDSIESWSDLATAIPNHGLRTKLKTLYGDVRNIDLWVGSLVEPILPGAKIGETFRCILINQFKRLRDGDRFWYEN---PSVFTPEQMSQIKVTSLGGVLCDNGDDIDRV 1121          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|341941244|sp|P49290.2|PERE_MOUSE (RecName: Full=Eosinophil peroxidase; Short=EPO; Contains: RecName: Full=Eosinophil peroxidase light chain; Contains: RecName: Full=Eosinophil peroxidase heavy chain; Flags: Precursor)

HSP 1 Score: 301.597 bits (771), Expect = 3.164e-87
Identity = 202/566 (35.69%), Postives = 292/566 (51.59%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIAST------MVSQWGMFVAHDLSFVPNSHEAKC------CEG--AKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSST---PREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGKGS--------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRL--AIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKE--------LYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKIS 620
            KYR + G+CNN  +P  G+    L R+LP +YED  S P   +  K R G +    LP  R VS+ +   V  PS   ++      M  QWG F+ HDL F P S           CE   A+   C PI+I  ND    N    C+ F+RS   C       R Q N +TSF+DAS VYGS     L L+   ++L          D+G+ LLP D                  F+ GD R+  T  L ++HTLFVREHNR++ +L ++NP ++ + ++ E R+I+GAM+Q I Y +FLP +LG   +  +   L     Y   ++P VA+VF   A+RFGH+M+Q  + RL    +  + +S+  L   FF  A++   +  GI+ IL GL   PA+    D  +V E+ + LF   +  G DL A  + R RDHGLP Y  WR FCGL       ++P  +++   +L  +        LY +P++IDI    +AE  +P + +GP   C+   QF   +DGDRF++    + G FT +Q KALR+ SLSR++CDNTGI  +S
Sbjct:  145 KYRTITGRCNNKKHPWLGASNQALARWLPAEYEDHRSLPFGWTPGKRRNGFL----LPLVRDVSNQI---VRFPSKKLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFSMGVDCEKTCAQLPPCFPIKIPRNDPRIKN-QRDCIPFFRSAPACPQNRNKVRNQINALTSFVDASMVYGSEVTLALRLRNRTNFLGLLATNQRFQDNGRALLPFDNLHEDPCLLTNRSARIPCFLAGDTRSSETPKLTALHTLFVREHNRLAAELRRLNPHWSGDKLYNEARKIVGAMVQIITYRDFLPLVLGRARIRRT---LGPYRGYCSNVDPRVANVFT-LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSVFF--ASWRIIHEGGIDPILRGLMATPAKLNRQDSMLVDELRDKLFQQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGL-------SQPRNLAQLSRVLKNQDLARKFLRLYKTPDNIDIWVGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQ---KWGVFTKRQRKALRRISLSRIVCDNTGITTVS 686          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|1352738|sp|P11678.2|PERE_HUMAN (RecName: Full=Eosinophil peroxidase; Short=EPO; Contains: RecName: Full=Eosinophil peroxidase light chain; Contains: RecName: Full=Eosinophil peroxidase heavy chain; Flags: Precursor)

HSP 1 Score: 299.671 bits (766), Expect = 1.357e-86
Identity = 201/566 (35.51%), Postives = 292/566 (51.59%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIAST------MVSQWGMFVAHDLSFVPNSHEAKC------CEG--AKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTP---REQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGKGS--------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRL--AIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKE--------LYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKIS 620
            KYR + G+CNN   PL G+    L R+LP +YED  S P   +  + R G +    LP  R VS+ +   V  P+   ++      M  QWG F+ HDL F P S           CE   A+   C PI+I  ND    N    C+ F+RS   C       R Q N +TSF+DAS VYGS     L L+   +YL    +     D+G+ LLP D                  F+ GD R+  T  LA++HTLF+REHNR++ +L ++NP +  + ++ E R+I+GAM+Q I Y +FLP +LG+     +   L +   Y   ++P VA+VF   A+RFGH+M+Q  + RL    +  + +S+  L   FF  A++      GI+ IL GL   PA+    D  +V E+ + LF   +  G DL A  + R RDHGLP Y  WR FCGL       ++P  +++   +L  +        LY +P++IDI    +AE  +P + +GP   C+   QF   +DGDRF++    + G FT +Q KAL + SLSR++CDNTGI  +S
Sbjct:  144 KYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFL----LPLVRAVSNQI---VRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKN-QRDCIPFFRSAPSCPQNKNRVRNQINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDFLPLVLGKARARRT---LGHYRGYCSNVDPRVANVFT-LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFF--ASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGL-------SQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQ---KRGVFTKRQRKALSRISLSRIICDNTGITTVS 685          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|81901688|sp|Q8R481.1|PERL_MESAU (RecName: Full=Lactoperoxidase; Short=LPO; AltName: Full=Lacrimal gland peroxidase; Flags: Precursor)

HSP 1 Score: 299.671 bits (766), Expect = 1.617e-86
Identity = 204/574 (35.54%), Postives = 298/574 (51.92%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVH---TDVDVPSTIASTMVSQWGMFVAHDLSFVP-------NSHEAKCCE-GAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTP-----REQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLP--------------KDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYP--SSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLA--IKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSA--DRFVVKEVTNYLFN-NGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLL--------LKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISF 621
            C+ +  YR + G CNN  NP  GS    L R+LP +YED  S P   +  K R G     PLP  R VS+ V     + ++     S +  QWG  V HDL F P       N  +A+C E   + D C PI   + D         CL F+R+   C ++P     REQ N +TSF+DAS VYGS       L+  +S L    +   ++D G+ LLP                G   F+ GD+RA     LA+ HTLF+REHNR++R+L+++NP +  E ++QE RRI+GA++Q I + ++LP LLG++      L    P    Y E ++P +++VF   A+RFGH  +   V+RL    + +       L K FFNT     ++G GI+ ++ GL    A+ A  D+ +  E+ N LF  N   +G DL A  I R RDHG P Y  WR FCGL       ++P  + E   +L        L +LY +P++IDI    +AE  +    +GP   C++G+QF  ++DGDRF++ +    G FT KQ  +L++ S SR++CDNTGI+K+  
Sbjct:  130 CNISNPYRTITGDCNNRKNPELGSANRALARWLPAEYEDGLSLPFGWTPGKTRNGF----PLPQPRDVSNQVLDYLNEEEILDQNRSLLFMQWGQIVDHDLDFAPETEMGSDNYSKAQCDELCIQGDNCFPIMFPKGDPKLKT-QGKCLPFFRAGFVCPTSPYQSLAREQINALTSFMDASMVYGSEPSLANRLRNLSSPLGLMAVNEEVSDHGRPLLPFVNVKPSPCEVINRTAGVPCFLAGDSRASEQILLATSHTLFLREHNRLARELSRLNPQWDGEKLYQEARRIMGALIQIITFRDYLPILLGDE------LQKWIPPYQGYKETVDPRISNVFT-FAFRFGHLEVPSTVSRLDENYQPWGSEPELPLHKLFFNTWRVV-KDG-GIDPLVRGLLAKKAKLAHQDKMMTGELRNMLFQPNHTVHGFDLAAINIQRCRDHGQPGYNSWRAFCGL-------SQPKTLEELSAVLRNEVLAKKLMDLYGTPDNIDIWLGAIAEPLVRRGRVGPLLTCLLGQQFQRIRDGDRFWWEN---PGVFTEKQRDSLQKMSFSRLVCDNTGINKVPL 679          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|341941245|sp|P11247.2|PERM_MOUSE (RecName: Full=Myeloperoxidase; Short=MPO; Contains: RecName: Full=Myeloperoxidase light chain; Contains: RecName: Full=Myeloperoxidase heavy chain; Flags: Precursor)

HSP 1 Score: 295.049 bits (754), Expect = 6.702e-85
Identity = 201/579 (34.72%), Postives = 293/579 (50.60%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSG-PLPNARKVSSTV---HTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSH-----------EAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS---TPREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGK--------------GSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSN--YSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKEL---------YSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLII 626
            C PN KYR + G CNN  +P  G+      R+LP +YED  S P     F    G   +G  +P AR+VS+ +     D        + M  QWG F+ HD++  P              E  C +      C P++I  ND    N    C+ F+RS   C+    T R Q N +TSF+DAS VYGS D     L+   + L    + +   D+G+ L+P D                  F+ GD R+     L S+HTLFVREHNR++ +L ++NP +  E ++QE R+I+GAM+Q I Y ++LP +LG  +M +    L    SY++ ++P +A+VF   A+R+GH++IQ  + RL  +      N    L K FF  A++      GI+ IL GL   PA+    ++ VV E+   LF      G DL A  + R RDHGLP Y  WR FCGL        +P+ + E +  +LK L         Y +PN+IDI   G++E   P+  +G    C+IG QF  L+DGDRF++ +    G F+ +Q +AL   SL R++CDNTGI  +S  N+ +
Sbjct:  141 CPPNDKYRTITGHCNNRRSPTLGASNRAFVRWLPAEYEDGVSMP-----FGWTPGVNRNGFKVPLARQVSNAIVRFPNDQLTKDQERALMFMQWGQFLDHDITLTPEPATRFSFFTGLNCETSCLQQPP---CFPLKIPPNDPRIKN-QKDCIPFFRSCPACTRNNITIRNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAINTRFQDNGRALMPFDSLHDDPCLLTNRSARIPCFLAGDMRSSEMPELTSMHTLFVREHNRLATQLKRLNPRWNGEKLYQEARKIVGAMVQIITYRDYLPLVLGPAAMKKY---LPQYRSYNDSVDPRIANVFT-NAFRYGHTLIQPFMFRLNNQYRPTGPNPRVPLSKVFF--ASWRVVLEGGIDPILRGLMATPAKLNRQNQIVVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLP-------QPSTVGE-LGTVLKNLELARKLMAQYGTPNNIDIWMGGVSEPLEPNGRVGQLLACLIGTQFRKLRDGDRFWWEN---PGVFSKQQRQALASISLPRIICDNTGITTVSKNNIFM 693          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|129825|sp|P05164.1|PERM_HUMAN (RecName: Full=Myeloperoxidase; Short=MPO; Contains: RecName: Full=Myeloperoxidase; Contains: RecName: Full=89 kDa myeloperoxidase; Contains: RecName: Full=84 kDa myeloperoxidase; Contains: RecName: Full=Myeloperoxidase light chain; Contains: RecName: Full=Myeloperoxidase heavy chain; Flags: Precursor)

HSP 1 Score: 291.197 bits (744), Expect = 3.565e-83
Identity = 200/568 (35.21%), Postives = 287/568 (50.53%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTV---HTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKC------CEGA--KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS---TPREQYNEITSFIDASNVYGSSDEELLLLKEENSYL----MKSTLTDDGKELLPKDGK--------------GSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSN--YSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQ--SADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLL--LKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLII 626
            C    KYR + G CNN  +P  G+      R+LP +YED  S P   +    R G     P+  AR VS+ +    TD   P    S M  QWG  + HDL F P             CE +  +   C P++I  ND    N    C+ F+RS   C     T R Q N +TSF+DAS VYGS +     L+  ++ L    +     D+G+ LLP D                  F+ GD R+     L S+HTL +REHNR++ +L  +NP +  E ++QE R+I+GAM+Q I Y ++LP +LG  +M +    L    SY++ ++P +A+VF   A+R+GH++IQ  + RL  +      N    L + FF  A++      GI+ IL GL   PA+    ++  V E+   LF      G DL A  + R RDHGLP Y  WR FCGL P  +   +   +  N+ L   L E Y +PN+IDI   G++E       +GP   CIIG QF  L+DGDRF++ ++   G F+ +Q +AL Q SL R++CDNTGI  +S  N+ +
Sbjct:  167 CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGF----PVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPNDPRIKN-QADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKY---LPTYRSYNDSVDPRIANVFT-NAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFF--ASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGL-PQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENE---GVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFM 719          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|229462993|sp|Q9VEG6.3|PERC_DROME (RecName: Full=Chorion peroxidase; AltName: Full=Peroxinectin-related protein; Short=Dpxt; Flags: Precursor)

HSP 1 Score: 292.352 bits (747), Expect = 4.711e-83
Identity = 194/587 (33.05%), Postives = 292/587 (49.74%), Query Frame = 0
Query:  103 YRMMNGQCNNP--VNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLS-----FVPNSHEAKCC--EG-------AKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLP-----------KDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNE---SGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYS--YSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDG--EAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVSMFKGLYCSRSTHGGFRIVEGKD 651
            YR M+G CNNP     L+G+    ++R LPP YED    P  +S            PL  ARK+S T+ +DVD P    + MV Q+G  +AHD+S      + +    +CC  EG            C+PI +  +D F+S F V CLNF R        C  +  +Q  ++T F+DAS VYGSSDE    L+      ++  + D G++LLP           + GK  F  GD R      L ++  L  REHNR++  L ++NPS ++ET+FQE RRI+ A MQ+I Y+EFLP ++G + M       L+  Y   Y+  +NP + + F  AAYR GHS +     +  I++         ++    FN +    R     +++L  L   P Q  D  + + ++ +LF    P+G DL A  I RGRD GL SY D+ E  G   L  +   P EI++     L  +Y +P+DID+   GL E  +   V+G T   II  QF   K GDR+++ +D     G+F P Q++ +R+ +L+R++CDN+    +  + L  FV         R+ H G +++   D
Sbjct:  237 YRSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGIWTPRAHSS--------DGTPLLGARKISRTLLSDVDRPHPKYNLMVMQFGQVLAHDISQTSSIRLEDGSLVQCCSPEGKVALSPQQSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKVTHFVDASPVYGSSDEASRSLRAFRGGRLR-MMNDFGRDLLPLTNDKKACPSEEAGKSCFHSGDGRTNQIISLITLQILLAREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGPQQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSVD---GKFQIRQEHGRIDEVVNIPDVMFNPSRMRKREFY--DDMLRTLYSQPMQQVDSSISQGLSRFLFRGDNPFGLDLAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQFPIEIAQK----LSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAEIIADQFARFKQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLLCDNSDRLTLQAVPLAAFV---------RADHPGNQMIGCDD 796          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|129831|sp|P09933.1|PERT_PIG (RecName: Full=Thyroid peroxidase; Short=TPO; Flags: Precursor)

HSP 1 Score: 293.508 bits (750), Expect = 1.595e-82
Identity = 195/607 (32.13%), Postives = 298/607 (49.09%), Query Frame = 0
Query:   78 QLIKDI-EYELEECKGTMPDCDPNM------------KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTE-NSQFKAREGCISSG-PLPNARKVS-STVHTDVDVPSTIA--STMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDR--------CLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS-------------TPREQYNEITSFIDASNVYGSSDEELLLLK----EENSYLMKSTLTDDGKELL-----------------PKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPA--QSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISEN-IWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISF 621
            QL  D+   EL      +  C P+M            KYR++ G CNN  +P +G+    L R+LPP YED  + P   N  F      + +G PLP  R+V+   +H   +  +     S ++  WG ++ HD++F P S       G  D +        C PI++  N         TCL FYRS   C S              PR+Q N +TSF+DAS VYGSS  +   L+     E    + +   D G+  L                 P      F+ GD+RA    GL ++HTL++REHNR++     +N  ++ +TV+QE R+++GA+ Q +   +++P +LG ++    G ++     Y   ++PTV++VF  AA+RFGH+ I   V RL  +   +  ++   +  F       R G G++ +L GL   PA  Q  D+ + +E+T  LF        DL +  + RGRDHGLP Y +WREFCGL  L  W +     +   +   +  LY  P++ID+   GLAE+ +P +  GP   CIIG+Q  AL+DGDRF++ +    G FT  Q + L + S+SRV+CDN+G+  +  
Sbjct:  113 QLPTDVLSEELLSTIANLSGCLPHMLPPSCPHTCLANKYRLITGACNNRDHPRWGASNTALARWLPPAYEDGVTEPRGWNPHF------LYNGLPLPPVREVTRQVIHVSNEAVTEDGQYSDLLMAWGQYIDHDIAFTPQSTSKAAFAGGADCQLTCENRSPCFPIQLPTN--ASGAAGATCLPFYRSSAACGSGRQGALVGNLSWAAPRQQMNGLTSFLDASTVYGSSPAQEQRLRNWTSAEGLLRVNTRHRDAGRAFLPFAPPPAPPACAPEPGTPAARAPCFLAGDSRASEVPGLTALHTLWLREHNRLAAAFKALNAHWSADTVYQEARKVVGALHQIVTLRDYVPKILGAEAF---GQHVGPYQGYDPAVDPTVSNVFSTAAFRFGHATIHPLVRRLDARFQEHPGSHLPLRAAFFQPWRLLREG-GVDPVLRGLLARPAKLQVQDQLMNEELTERLFVLSNSGTLDLASINLQRGRDHGLPGYNEWREFCGLSRLETWADLSAATANGRVADRILGLYQHPDNIDVWLGGLAESFLPGARTGPLFACIIGKQMRALRDGDRFWWEN---PGVFTEAQRRELSRHSMSRVICDNSGLSHVPL 704          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|172048149|sp|A8WQH2.1|PXDN_CAEBR (RecName: Full=Peroxidasin homolog; Flags: Precursor)

HSP 1 Score: 298.13 bits (762), Expect = 2.617e-82
Identity = 196/563 (34.81%), Postives = 285/563 (50.62%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVS-STVHTDVDVPSTIASTMVSQWGMFVAHDL----------SFVPNSHEAKCCEGAKDDRCLPIRIYEND--LFYSNFNVTCLNFYRSVRFCSS----------TPREQYNEITSFIDASNVYGSSDEELLLLKE---ENSYLMKSTLTDDGKELLP--KDGKGS-------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQS--ADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLL-LKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTG-IDKI 619
            KYR  +GQCNN   P+ G     L+R L P YE+  + P    + K   G     P+PN R+VS   V T+   P    S+MV QWG FV HDL          S+   +   + C+    D C  I +  +D  +   +    C+ F RS   C S          T REQ N +TSF+DASNVYGS++ +   L++    N  L     +  GKE LP  KD                 F+ GD RA     LA+ HT+FVREHNRI++KL +MN ++  E ++ ETR+I+GAMMQ+I +  +LP + G +   +  +  KY   Y   I+ +V + F  AA+RFGH++I   + RL     S    +      F T       G GI+ +L GL   P +     + +  E+   LF  G     DL    I R RDHGLPSY ++R+FC L     W +    I +++ +  L+ LY  P +ID+   G+ E  + + + GPT  CIIG QF  ++DGDRF++  D   G FTP+Q+K +++ +L+R++CDN   ID+I
Sbjct:  632 KYRSFDGQCNNKNKPMNGVSLMPLRRLLKPVYENGFNTPVGWEKGKLYNGY----PMPNVREVSRQLVATETITPHRKLSSMVMQWGQFVDHDLTHTVTALSRHSYATGAFCNRTCDNL--DPCFNIPLSPSDPRVISESAKYPCIEFERSAAVCGSGETSLVFNRVTYREQMNALTSFLDASNVYGSNEVQAQELRDTYNNNGQLRYDITSAAGKEYLPFEKDSNMDCRRNFSEENPIRCFLAGDLRANEQLALAATHTIFVREHNRIAKKLKKMNGNWDGEVIYHETRKIIGAMMQHITFKHWLPVVFGGQEQMDKFVG-KY-QGYDPAIDSSVTNAFATAAFRFGHTIINPTLFRLGNDFMSIKQGHIALHKAFFTPELVLTEG-GIDPLLRGLFASPLKHPMPTQLLNMELIEKLFMKGHEVSLDLAVMNIQRSRDHGLPSYTEYRQFCNLPVPARWEDMKGYIKDDMIIQKLRGLYGVPQNIDLWVGGIVEEKLENGLFGPTFACIIGEQFRKMRDGDRFWYEKD---GVFTPEQMKEIKKVTLARLLCDNGDEIDRI 1182          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|122119348|sp|Q1ENI8.1|PXDN_CAEEL (RecName: Full=Peroxidasin homolog; Flags: Precursor)

HSP 1 Score: 294.278 bits (752), Expect = 3.945e-81
Identity = 192/564 (34.04%), Postives = 286/564 (50.71%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVS-STVHTDVDVPSTIASTMVSQWGMFVAHDL----------SFVPNSHEAKCCEGAKDDRCLPIRIYEND--LFYSNFNVTCLNFYRSVRFCSS----------TPREQYNEITSFIDASNVYGSSDEELLLLKE---ENSYLMKSTLTDDGKELLP--KDGKGS-------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLL-GEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQS--ADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLL-LKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDN-TGIDKI 619
            +YR  +GQCNN   P+ G     L+R L P YE+  + P    + +   G     PLPN R+VS   V T+   P +  S+MV QWG FV HDL          S+   +   + CE    D C  I +  ND  +   +    C+ F RS   C S          T REQ N +TSF+DASNVYGS++ +   L++    N  L     ++ GKE LP  KD                 F+ GD RA     LA+ HT+F+REHNRI++KL  MN ++  E ++ ETR+I+GAMMQ+I Y  ++P +  G+  MN+    +     Y  +++ +V + F  AA+RFGH++I  ++ RL          +      F T       G G++ +L GL   P +     + +  E+   LF  G     DL    I R RDHGLPSY ++R+FC L     W +    I +++ +  L+ LY  P +ID+   G+ E  + + + GPT  CIIG QF  ++DGDRF++  D   G FTP+Q++ +++ +L+R+ CDN   ID+I
Sbjct:  633 RYRSFDGQCNNKNKPMTGVSLMPLRRLLKPVYENGFNTPVGWEKGRLYNGY----PLPNVREVSRQLVATENITPHSKLSSMVMQWGQFVDHDLTHTVTALSRHSYATGAFCNRTCENL--DPCFNIPLSPNDPRVKSGSAKYPCIEFERSAAVCGSGETSLVFNRVTYREQMNALTSFLDASNVYGSNEVQAQELRDTYNNNGMLRFDITSEAGKEYLPFEKDSNMDCRRNFSEENPIRCFLAGDLRANEQLALAATHTIFIREHNRIAKKLKSMNGNWDGEIIYHETRKIVGAMMQHITYKHWMPIIFGGQAQMNKF---VGTYQGYDPDVDASVTNAFATAAFRFGHTIINPSLFRLGNDFMPIKEGHIALHKAFFTPELVLTQG-GVDPLLRGLFASPLKHPMPTQLLNMELIEKLFMKGHEVSLDLAVMNIQRSRDHGLPSYTEYRKFCNLPVPVQWEDMKGYIKDDMIIQKLRGLYGVPQNIDLWVGGIVEEKLENGLFGPTFACIIGEQFRKIRDGDRFWYEKD---GVFTPEQLREIKKITLARLFCDNGDNIDRI 1183          
BLAST of EMLSAG00000004874 vs. SwissProt
Match: gi|172044151|sp|A4IGL7.1|PXDN_XENTR (RecName: Full=Peroxidasin; Flags: Precursor)

HSP 1 Score: 294.278 bits (752), Expect = 9.411e-81
Identity = 201/555 (36.22%), Postives = 294/555 (52.97%), Query Frame = 0
Query:  100 NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSG-PLPNARKVSST-VHTDVDVPSTIASTMVSQWGMFVAHDL-SFVPNSHEAKCCEG-------AKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSST----------PREQYNEITSFIDASNVYGSSDEELLLLKEENSY---LMKSTLTDDGKELLP----------KDGKGS----FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNY-SLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQS--ADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEI-SENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDN 613
            + KYR  +G CNN  +P++G+     +R L   YE+  + P      +   G I +G PLP  R VS+T + T    P    + M+ QWG F+ HDL S V    +A+  +G         D  C PI +  ND    N N  C++  RS   C S           PREQ N++TS+IDASNVYGSSD E   +++  S+   L +  +   GK LLP          +D   S    F+ GD RA    GL S+HTL+ REHNRI+ +L ++NP +  +T++ ETR+I+GA MQ+I YS +LP + G+  M   G   +Y  SY   +N  + + F  AA+RFGH++I   + RL  K       +  L + FF+   +   N  GI+ +L GL    A+     + +  E+T  LF+       DL A  + RGRDHG+P Y D+R FC L  +  +++   EI + ++   LK LY SP +ID+  A + E  IP S LGPT  C++  QF  ++DGDRF++ +    G FT  Q+  ++QTSL+RV+CDN
Sbjct:  728 HQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLP------RGISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAPCFPIMVPPNDPRVRN-NARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGMKMLG---EY-KSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSP--FRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYEN---PGVFTAAQLTQIKQTSLARVLCDN 1266          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: EEB12501.1 (Chorion peroxidase precursor, putative [Pediculus humanus corporis])

HSP 1 Score: 366.696 bits (940), Expect = 4.289e-109
Identity = 208/545 (38.17%), Postives = 306/545 (56.15%), Query Frame = 0
Query:  100 NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHE-----AKCCEGAKDDR---CLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKD-GKGSFV-----------GGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGI 616
            N  YR M+G CNN  +P +GS+   L+RFL P YED           +A    I  GPLP+AR VS+ VH D +V S   + ++ QWG F+ HD++    S        +CC+   D +   CLPI +  +D F+S F + CL F RS       C+  PREQ N++TS+ID S +YG+S+ E   L+   + ++K T       LLP D  KG F             GD+R     GL ++H +F+R HNR++R LA +NP + +E +FQETR+I+GA++Q+I Y EFLP +LG+  M+  G++L    Y  +Y E ++ T A+ F  AA+RFGHSM+Q    +    +     N SL  +  +T +   R G  ++ ++ G+    AQ  D     E+TN+LF     P G DL A  I RGRDHGLPSY  WR  CGL  + +WN+    +S+     L+ +Y   ND+D++T GLAE  +   ++G T  CIIG+ F  L+ GDRF++ + G   SFT  Q+KA+R+ +L+R++CDN  +
Sbjct:  313 NHLYRTMDGTCNNLKHPWWGSRFQPLKRFLAPHYEDG---------LEAIRRSIKGGPLPSARLVSTEVHWDKNVESKSVTHLLMQWGQFLDHDMTSSSQSRGFGGSVPRCCDAPPDLQHPDCLPIEVLPDDRFFSRFGIRCLEFLRSAPSSRVGCALGPREQINQVTSYIDGSMIYGNSERESSKLRLFRNGMLKYTRMPQRLPLLPIDRDKGEFCRKSSPDFFCLHSGDSRMNEQPGLLAIHIVFLRLHNRLTRNLAHLNPEWNDERLFQETRKIVGAIIQHITYREFLPIVLGQDVMSIFGIDLLKTGYYQNYSESVSSTAANSFATAAFRFGHSMVQGKFLKWDDIRKEEIINVSLHDELLDTGSLH-RFG-AVDNLMLGMCRQGAQKRDEHFTVELTNHLFQTPNFPAGLDLAAINIQRGRDHGLPSYNSWRNPCGLRKMKNWNDLLNVMSQESRDALRRIYRDVNDVDLYTGGLAEFSVRGGLVGSTFACIIGQHFRNLRKGDRFWYENGGFESSFTVAQLKAIRRVTLARILCDNLDL 846          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: EFX77941.1 (hypothetical protein DAPPUDRAFT_320790 [Daphnia pulex])

HSP 1 Score: 354.369 bits (908), Expect = 8.611e-106
Identity = 209/553 (37.79%), Postives = 305/553 (55.15%), Query Frame = 0
Query:   97 CDP-NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCEGA------KDDR---CLPIRIYENDLFYSNFNVTCLNFYRSV----RFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKG-------------SFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDN 613
            C P +  YR  +G CNN  +P +G+     QRFLP +Y D           +A    +  G LP AR VS+ VH   ++ ++  +TMV QWG F+ HDL+        N    +CC+        K++R   C+PI +  +D FY  +NVTCLNF RS       C   PREQ N+ITS++DASNVYGS+D+ L  L+  +  ++K       K LLP   K               F GGD+R     GL+S+HT ++REHNR+ RKLA++NP + +E +F E R+I+GA MQ+I Y+EFLP +LGE+ +    L LK   +   Y+  INP  A+ F  AA+RFGHS+I +N+NR             L K+  +       N   ++ IL G+   PA   D ++V E+TN+LF   K P+G DL A  I R RDHG+P Y  WRE CGL P+ +W    + + ++    L+  Y +  D D+    +AE P+   ++GP   CII +QF+ L+ GDRF++ +     +FT  Q++ LR++SL+R++CDN
Sbjct:  129 CPPFSALYRTGDGTCNNAEHPEWGASFRPFQRFLPAEYGDG---------VEAFRRSVQGGALPTARTVSALVHRHRNITTSQFTTMVMQWGQFLDHDLTSSSQTRGFNGSIPECCQKDGQGQVDKENRHPDCMPIEVSSDDAFYGKYNVTCLNFVRSSPSPSEGCLLGPREQINQITSYLDASNVYGSTDKYLSSLRLYSRGMLKCRDMMFRKALLPVLEKPLNDECRSHSPNMHCFKGGDSRTNEQPGLSSMHTAWMREHNRLVRKLAELNPHWNDERLFHEARKIVGAQMQHISYNEFLPIVLGERVIEVFDLRLKRRGFFYGYNNSINPMAANSFGTAAFRFGHSLIPKNLNRCNRFHQLLPYRTPLRKELMDPTPIH--NIGAVDRILLGMCSQPAMRRDEYIVDELTNHLFQTSKKPFGMDLMALNIQRARDHGIPPYVVWREACGLTPIHNWGQLLSIMDDDTVGRLRIAYKNLEDNDLFPGAMAEKPVIGGMVGPVFACIIAQQFSNLRLGDRFWYENGDVPNAFTESQLRELRRSSLARIICDN 670          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: gb|EEC10299.1| (peroxinectin, putative [Ixodes scapularis])

HSP 1 Score: 353.984 bits (907), Expect = 1.526e-105
Identity = 203/565 (35.93%), Postives = 306/565 (54.16%), Query Frame = 0
Query:   94 MPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCE-------GAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGS------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTAN-YEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLI 625
            +P C P+ KYR  +G+CNN  N  +G      +RF+PP Y D  + P  +         +   PLPN R +S     D D P+   + M+ Q+  FV HDL+        N     CC+         +   C+PI +  ND FYS FN+ C+ F RSV      C+  PREQ N++T+++D+SN+YGS++EE   L+      + ST      ELLP+   G+            F  GD R      L ++HTL++REHNR++ +L ++NP + +E ++QE RRI+ A  Q+I ++EFLP LLG K M +  L L    Y  SY   +N  + +VF  AAYR+GH+++Q N+  L  +  S      L   FFN    Y   N   ++    GL   PAQ+ DRFV +++TN+L+   G+ +G DL A  I RGRDHG+PSY DWRE CG+  + D+      ++        ++Y  P+DID+  AG+ E  +P   LGPT  C++  QF  +K+GDRF++ + G   SF   Q++ +R+ SL+RV+CDN+ ++ +  L +I
Sbjct:  232 VPRC-PSTKYRSPDGRCNNLQNREWGKSLTAFERFMPPNYADGLTLPRVS---------LDGNPLPNPRTISVAADPDGDFPNERNTLMLMQFAQFVDHDLTLTGVTRFRNGSAITCCDEEFLTNPTKRHFACMPIDLDANDHFYSEFNLRCIEFVRSVPAPRPQCTFGPREQLNQLTAYMDSSNIYGSTEEEAKSLRSFRDGRLASTFFSR-DELLPRQTDGTQECNEQGTDFVCFRAGDERVNEQVSLTAMHTLWLREHNRVAGELHRLNPGWKDEILYQEARRIVAAEFQHICFNEFLPLLLGRKVMEQFDLLLTPYGYSHSYDPNLNAGIGNVFATAAYRYGHTLVQGNI-ELINEDGSVHKRIPLAAQFFNPNEIYHPGN---LDRFFRGLITQPAQTYDRFVTQQLTNHLYEPIGQGFGMDLVALNIQRGRDHGIPSYNDWREHCGMSRITDFAQLADIMTPESAKAFAQVYKYPDDIDLFPAGVNEKSVPGGTLGPTFACLVAEQFRRMKNGDRFWYENGGLESSFNEVQIEEIRKASLARVICDNSNLNYVQPLVMI 781          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: EFX84548.1 (hypothetical protein DAPPUDRAFT_314899 [Daphnia pulex])

HSP 1 Score: 336.265 bits (861), Expect = 1.441e-101
Identity = 208/552 (37.68%), Postives = 303/552 (54.89%), Query Frame = 0
Query:   94 MPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCC--EGA------KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKD----------GKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT 614
            +P C P +KYR  +G CNN   P +GS    L+R  PP+Y+D         + K R+       LP+ R V S + TD + P    + M+ QWG F+ HD+  VP     N    +CC  EG       +   C PI I  ND FY    V CLNF RS+      C     EQ N++T FIDAS++YG S +    L+E    L+K ++ + G+  LP++          G   FV GD R     GL ++H LF+R+HN ++  LA +NP + +E ++ E RRI+GA+MQ+I Y+EFLPTLLG  +M+  GL  +   Y  SY E +NP++ + F AAA+R GHS+IQ  +N                  ++ +     + GL ++ +L GL     Q+ D +V ++VTN+LF + K  +G DL +  I RGRDHGLP Y  +R+ CGL  + ++    T +  ++   L  +Y S +DID++  GL E+ +P S+LGP  +CII  QF  LK+GDRFFF H G   SF+P Q++ +RQ SL+ V+CDN 
Sbjct:   22 LPACVP-IKYRSFDGTCNNLRQPSWGSALSPLERLAPPEYDDGIW------EAKIRK---FGQELPSVRVVRSVLVTDENHPKVDMTHMLMQWGQFLDHDMIHVPVFRTANRSNIECCTREGGTIPPEMRHPHCFPIDIPINDPFYGPRGVRCLNFVRSMIAPRLDCRVGYAEQMNQLTHFIDASHIYGPSPDIASSLREFVGGLLKISVIE-GRPYLPQNPQARGCIRTNGFACFVSGDTRVNQIMGLTALHILFLRQHNFLASALAALNPQWNDEILYLEARRIVGALMQHITYNEFLPTLLGRLTMDTYGLTPQTSGYSPSYDENVNPSITNEFGAAAFRMGHSLIQGAMNG---------------GRWYGSGGLLRQAGL-MDAVLRGLVDQWPQNMDEWVSEDVTNHLFQSAKRDFGFDLVSLNIWRGRDHGLPGYNTYRQVCGLPRVTNFQELLTIMDRSVVDRLASVYRSVDDIDLYIGGLVESHLPGSMLGPVFSCIIADQFARLKEGDRFFFEHGGHPSSFSPAQLQEIRQMSLAAVICDNA 546          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: gb|EEC15885.1| (peroxinectin, putative [Ixodes scapularis])

HSP 1 Score: 336.265 bits (861), Expect = 2.885e-101
Identity = 209/583 (35.85%), Postives = 312/583 (53.52%), Query Frame = 0
Query:   66 GYSRDSAHQKVIQLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNS-------------HEAKCC--EGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVR--FCSSTPREQYNEITSFIDASNVYGSSDEELLLLKE-ENSYLMKSTLTDDGKELLP-------------KDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLN-LKYP-SSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFN-NGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT 614
            G +R       +QL+K+  + L         C P   +R M+G CNN  +  +G     ++R LPP+Y D  S P  +          + G LPN R VS+TVH D D PS   S M+ QWG F+ HD +  P S                 CC  E     RC    I   D F+  +   C+NF RS R   CS  PR+Q + +TSF+D S VYGSS E+ L L+  +    +K  +   G  +LP             + G   F  GD R     GL ++HTL++R+HN ++ KLA +NP + +E +FQE RRI+   MQ I Y EFLP ++G+    E GL  L Y  ++Y+++I+P++ + F  AAYRFGH+++  N + + I      S   L  +FF    +E R+G+ +E I+ GL    +Q+ D F+  +VTN+L+    + +G DL +  I RGRDHG+  Y D+ + C    +  + +  + +   +   L+ LY+  NDID+ T G++E  +P  V+GPT  CI+G QF  LK GDR++F H G+AGSFTP Q+  LR+T+LS+++CDN+
Sbjct:   11 GLARTDLSGSRLQLVKEQCHRLSNGI-----CRPG-PFREMDGSCNNLDHSDWGVAFSCMRRLLPPRYADGVSAPRISE---------TGGELPNPRLVSTTVHVDFDRPSRETSHMLMQWGQFLDHDFALAPISSIPGEIIDLGNPNDVIDCCSPETRSSPRCFSFDIPPTDHFFGKYGEHCMNFPRSARCPLCSLGPRQQIDSLTSFVDGSQVYGSSLEDSLKLRTLQGDGRLKFDVGRRGDMILPASFHPHEDQCSRPEHGDLCFRAGDERVNEQPGLTAMHTLWLRQHNFVAGKLAGLNPHWDDERIFQEARRIVIGQMQMITYDEFLPLVVGKSFHREFGLEVLPYGYTTYNKQIDPSILNEFAGAAYRFGHTIL--NGDFMQIDSRGRISRVKLQDNFFKP--FEFRDGM-MERIVRGLAKQTSQTFDNFITNDVTNHLYRLTNESFGLDLISLNIQRGRDHGIRGYTDYLKGCFGLRVTKFEDLDSAMPRPVRERLQRLYTHVNDIDLFTGGVSEYSLPGGVVGPTFGCILGIQFWRLKYGDRYYFEHGGQAGSFTPAQLTELRRTTLSKIICDNS 573          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: gb|KFM65699.1| (Chorion peroxidase, partial [Stegodyphus mimosarum])

HSP 1 Score: 337.035 bits (863), Expect = 2.154e-100
Identity = 204/562 (36.30%), Postives = 305/562 (54.27%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCC---EGAKDD--RCLPIRIYENDLFYSNFNVTCLNFYRSV--RFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKE-ENSYLMKSTLTDDGKELLP-------------KDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYP--SSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVS 629
            C  N +YR  +G CNN  +P +G      +R + P Y D  +     ++ +AR G     PLP  R +S  +H  +D P+   + M   WG F+ HD+S  P     ++   +CC   EG  ++  +C PI I  +D FYS+F V CLN  RS     CS  PR+Q N+++++IDAS++Y  S  E   L+  + +  M+     +  EL P             ++    F  GD RA     L S+H LF+REHNRI+R+L ++N S+ +E ++QETRRI+GA+MQ I Y E+LP ++G + M    L+L+    + Y E I  T+ + F  AA+RFGHSMI      ++    S +    +F+  F     +      +E I+ GL   P+Q  DR++V++VTN+L+ N     G DL +  I RGRDHG+P Y    EFCG   +  W          +  L + LY S  DID+ + GLAE P   +V+GPT  CIIG QF  LK GDRF+F H G+ GSFTP Q++ +++ +L +++C N+ ID+I   N ++F S
Sbjct:  153 CRRNDRYRTYDGSCNNLRHPSWGMAASCFERLVDPDYSDGTA-----AKRQARSG----RPLPAPRTLSLELHAHLDNPTDYVTHMFMAWGQFLDHDISLSPLSRGPDNELLECCPVNEGDNENLPQCDPIIIPADDPFYSSFGVDCLNNVRSAMCSTCSLGPRQQINQLSAYIDASHIYALSQNESRALRNLDGTGTMRFVTVSEAGELPPPSSIPNEDQCSFQEENLDCFETGDQRANQHPALTSLHILFLREHNRIARRLREINRSWDDERLYQETRRIIGAIMQKITYGEYLPLVVGPERMEWFDLSLRRSGFTEYDETIQATLVNEFSTAAFRFGHSMINSFFPEISSGSNSGNRLRRIFQYPFGLYRGQ------LEGIVNGLAQSPSQKFDRYMVRDVTNHLYQNRNSTNGLDLASLNINRGRDHGIPGYTTLVEFCGGPQITSWRQLDRLFQRGVRPLFERLYESVEDIDLFSGGLAERPNQGAVIGPTFTCIIGIQFYHLKYGDRFYFEHGGQTGSFTPAQLREIKKVTLGKLICQNSRIDEIQ-PNAMLFPS 698          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: EFX81795.1 (hypothetical protein DAPPUDRAFT_196036 [Daphnia pulex])

HSP 1 Score: 336.65 bits (862), Expect = 6.144e-100
Identity = 203/559 (36.31%), Postives = 289/559 (51.70%), Query Frame = 0
Query:  103 YRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTV--HTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCEGA-------KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGS---------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSS------YHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSY--SSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDN----TGIDKISFL 622
            +R ++G CNN   P +G     LQR +PPKY D  + P      +  EG +    LP+AR VS ++   +     S I + M+ QWG F+ HD++  P     NS    CC          +   C PI I  ND FY+ FN  C+ F RS+      C+  PREQ N++T+FID S VYGSS +    L+E N   +    +  G  LLP   +           F  GD R      LA +HT++VREHNRI+  L Q+NP + +E VFQE+RRI+GA +Q I Y+EFLP  LG+  M+   L    P S      Y + INPTV + F  AA+R GHS+IQ       I+ ++   S   SL      +  +E     G++ ++ GL   PAQ  DR    E+ N LF   + +G DL A  + RGRDHGLP Y D+RE CG      W +    I + +   +  +Y+S +D+D+   G++E  +  ++LGPT  C+IG QF  L+ GDR F+        FT +Q+ +LR  +L+R++CDN     GI   +FL
Sbjct:  171 FRTIDGSCNNEQRPEWGQINVALQRIIPPKYGDGVNTP------RLAEGDVE---LPSARLVSQSLTESSHRSSQSEIWTLMLMQWGQFLDHDITHSPIVRGQNSSGVTCCRSGQFLDVSERHPDCFPIAIPPNDPFYAQFNQRCMEFVRSLPAPRPGCTFGPREQLNQVTAFIDGSTVYGSSQDLSNQLREFNGGRLAVQRSIQGHTLLPVKAEECSDFLRQRFCFRAGDGRVNEQPQLAVIHTVWVREHNRIADALQQLNPFWNDERVFQESRRIVGAEIQQITYNEFLPIFLGDAYMSRFQLKPLPPGSGMATNLYDQNINPTVTNEFATAAFRVGHSLIQG-----IIEGFTAFGSQTQSLLLHQHQSKPFELYEDTGVDTLVRGLLMQPAQKMDRAFTDEIKNRLFQGKQSFGMDLIAMNLQRGRDHGLPPYNDYRELCGRPRANQWQDLLDVIDQRVVQEISRIYNSIDDVDLFIGGVSERTVDGALLGPTFLCLIGDQFARLRRGDRLFYEE--ATAKFTQQQLASLRSVTLARILCDNGDDIKGIQSSAFL 713          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: gb|EFA05698.1| (Chorion peroxidase-like Protein [Tribolium castaneum])

HSP 1 Score: 340.502 bits (872), Expect = 2.202e-98
Identity = 214/613 (34.91%), Postives = 318/613 (51.88%), Query Frame = 0
Query:   61 KLVKKGYSRDSAHQKVIQLIKDIEYELEECKGTMPDCDP-NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDL-------SFVPNSHEAKCCEGA---------KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGS----SDEELLLLKEENSYLMKSTLTDDGKE-LLPKDGKGS------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLG-IEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVSM 630
            K + + Y  + + Q        +  ++   +GT P C   + +YR  +G CNN   P  GS    +QRFL P YED    P  +         I    LP+AR++S+ +H D +      S M  QWG  + HDL       SF  N    +CC                CLPI +  +D F S+F + C+ F RS       C    REQ N++TS++DAS +YGS    SD   +  K +  Y         G+E L P D  G             F GGD R     GL ++HT+FVR HNR++  L Q+N  +++E V+QETRRI+ A+MQ++ Y EFLP +LG + ++   L L+   Y S Y + +NP VA+ F +AA+RFGHSM+Q +  R   K     +N +L ++     N E+   LG ++ +L G    P+Q  D F+  E+TN+LF + G P+G DL A  + RGRDHGLP Y  WRE CGL P+  W +    ++ +     + LY   NDID+ + GLAE P+   ++GPT  CII +QF  L+ GDRF++ + G   SFTP Q++ +R  +L+ V+C    + +I  +   +F+++
Sbjct:  132 KRLAETYPENVSRQAAGSFDTRLREDVCPLRGT-PRCPAASRRYRTADGTCNNFNKPWRGSSLLPMQRFLQPVYEDGIQEPRRS---------IFGHKLPSAREISTRIHRDKNFEVPTVSLMFMQWGQLIDHDLVSTVKSRSF--NGTVPRCCRRGGQALLPPELTHPSCLPIEVSPDDWFLSSFGLRCIEFIRSAPSTRIDCDLGWREQINQVTSYLDASPIYGSDIETSDSMRVFRKGKLHYGRPQ-----GREPLQPPDPPGGELCRSGAVTTDCFQGGDGRFSEQPGLTALHTVFVRYHNRLATVLGQVNRHWSDEKVYQETRRIVVAIMQHVTYREFLPIVLGPEVIDLFELKLERKGYYSGYDDRVNPEVANAFGSAAFRFGHSMVQNSFVRFDTKHRPLFNNVTLHEE---QENVENIWSLGSLDRLLLGFCNQPSQRRDEFICDELTNHLFQSRGFPFGMDLAAINVQRGRDHGLPPYTSWREPCGLSPIKSWKDLEKIMNPDTVHRFESLYEDINDIDLFSGGLAEKPVRGGIIGPTFACIIAQQFLNLRKGDRFWYENGGFESSFTPAQLQQIRHVTLAHVLCQT--LTEIETIQPFVFLTV 722          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: EEB10263.1 (conserved hypothetical protein [Pediculus humanus corporis])

HSP 1 Score: 337.035 bits (863), Expect = 2.454e-98
Identity = 202/561 (36.01%), Postives = 300/561 (53.48%), Query Frame = 0
Query:   96 DCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEA-----KCCEGA-------KDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGS---SDEELLLLKEENSYLM----KSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMI---QRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            +C P  KYR  +G CNN +   +G     LQR + PKYED  + P   S+        +   LP+AR +S+   TD + P    + MV QWG F+ HDL+  P +         CC+         K   C  I + +ND  ++ F   C+ F RS+      C+  PREQ N+IT F D SN+YGS   S  EL   +     +     +  L D+ +E   + G+  F   D+R      LA +HT+++REHNR++ +L +++P + +E +FQETRRI+ A MQ+I Y+EFLP LLG K M +  L  K    P+ Y+E INP + +VF  AA+RFGHS+I   QR +NR      S   N  L ++ F+   +       +++ + GLT  PAQ  DR    E+T++LF     +G DL A  I RGRDHGL  Y +WR  C L     W    T +  N   +L++LY + ND+D+    +AE P   ++LGPT  C++G QF  L+ GDRFF+    +  SFT +Q+  +R+++L+R++CDN+  D I  +  + F
Sbjct:  353 NCRP-QKYRSADGSCNNLLQDGWGKSGTALQRIISPKYEDGVNAPRSKSE--------TGQDLPSARLISTVFATDTNNPHENLTQMVMQWGQFLDHDLTHTPITRGQGGSGISCCQNGQNIADNLKHPDCFAISLSKNDHIFAPFGERCMEFVRSLPAPRPECNFGPREQMNQITGFQDGSNIYGSNLGSQRELREFRGGRLRIQNIKGREYLPDNEEECANEIGETCF-KSDSRVNEQVNLALMHTIWMREHNRVAAELQKLHPDWNDEALFQETRRIVVAEMQHITYNEFLPILLGRKYMEKFELTPKEEGQPTLYNENINPGITNVFATAAFRFGHSLIDGIQRGLNRFG----SVQENLVLHQNHFSP--FILYKSEAMDDFIRGLTSTPAQKFDRHFTSEITDHLFQGDLDFGLDLVALNIQRGRDHGLAPYNEWRSVCSLPTFNTWEELATVMEPNSVNVLRKLYPTVNDLDLFIGAVAEKPDAGALLGPTFVCLVGDQFARLRRGDRFFYEEGQQPSSFTLEQLNQIRKSNLARILCDNS--DDIVLMQPLAF 895          
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Match: EFX80390.1 (hypothetical protein DAPPUDRAFT_318553 [Daphnia pulex])

HSP 1 Score: 327.791 bits (839), Expect = 5.056e-97
Identity = 197/622 (31.67%), Postives = 318/622 (51.13%), Query Frame = 0
Query:   33 DEKKLLDQANVKDVDYHKLLQKGRQVTPKLVKKGYSRDSAHQKVIQLIKDIEYELEECKGTMPDC----DPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCC---------EGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGS------------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYH------EEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT 614
            D ++L  +A +  ++  + LQ+   +TP     G +  S  Q +         +   C+ + P C       +KYR ++G CNN     +G  R   QR LPP Y D    P            +    LP+AR +S  + +  D P    S     +G F+ HDL+  P     ++   +CC         E ++  +CLPI I  +D FY NFN  C+NF R+       C+    EQ NE+T ++D S +YGS  E +  L++ +   ++ST  + G+ ++P D K +            ++ GD R      L  +HTL++REHN+I+ +L+++NP +++E +FQE RRI+ A  Q I+Y+EFLP +LG++ M+   L++   S Y+        I+P++ + F  AAYR GHS++Q  V   +              +  +  +   ++   ++E L GL   P Q+ D     E+TN LF   KP+G DL A  I RGRDHG+P Y  +RE CG++    +     +I +N+   LK +Y S +D+D+   G+ ETP+  S++GPT  CIIG QF  LK  DRFF+    +  SF  +Q++ +R+ SL+R++CD++
Sbjct:   99 DAQQLAREALLV-IEATRQLQRKFNLTPVETGLGLTFHSTRQTI---------QFPACR-SKPPCMQHFGSGVKYRTIDGSCNNLEKTSWGMARSTFQRILPPAYSDGVFAP---------RIAMDGTALPSARFISLVIVSHHDAPRADLSLFWMVFGQFIDHDLTLSPTFVLSDNSGIECCSADGGSILPESSRHPQCLPIEIPADDPFYRNFNQRCMNFVRTTPGLRPDCNFGYAEQLNELTHWLDGSQIYGSDAETMTKLRDFHQGRLRSTRFN-GRSIVPLDPKSNVTRTEDCKTSSCYIAGDIRVTEQPQLTVIHTLWLREHNQIAAELSRLNPGWSDENIFQEARRIVIAEYQFIIYNEFLPIILGKRYMDTFNLSISQSSLYYGNGDYDATIDPSIQNEFATAAYRMGHSLVQGLVKLFSQSGQVNEERSFTLSNMLDAVSPIGKDSAWMDEALRGLLEQPMQNFDSSFTPEITNKLFRGEKPFGMDLVALNIQRGRDHGIPGYNSYREICGMKRADHFRGFSPQIPDNMITQLKHIYRSVDDVDLFVGGILETPVYDSLVGPTFLCIIGDQFARLKKADRFFYDAGNQLHSFNQRQIEEIRKASLARIICDHS 699          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|1061479604|gb|ODM97104.1| (Chorion peroxidase [Orchesella cincta])

HSP 1 Score: 372.089 bits (954), Expect = 3.133e-110
Identity = 204/541 (37.71%), Postives = 301/541 (55.64%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFN--VTCLNFYRSVRFCSST---PREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDG-----KELLPKDGK-----GSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCD-WNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGID 617
            CD N +YR ++G CNN  NP +G+      R +P  YED  + P      +     ++   LPNAR VS +VH D   P    + M+ Q G F+ HD++  P + +  C   A++  C  I I  +D F+S      TC+ F RS  +C       REQ+N IT+F+DAS+VY S +    LL+      ++    +       +E+    G+     G+F GG+ R      L  +HTL  REHNR++ ++A   P + +ET+FQE RR+L A  QN+VY E+LP +LGE +M   GL L   +  S Y+   NPTV   F  AAYRFGH++I   +  +  K +   S+Y L   FFN        G G + IL GL    AQ+ D F+ +EVTN+L     + +G DL A+ + RGRDHGLPSY  +R+ CGL+ + + W N+P+ I +++W +L  LY +P DID+ T GLAE P+  +V G T NC+   QF  ++ GDRFFFTH G    F+P+Q++ +R+ +L  ++CDN+ I+
Sbjct:  171 CDTNARYRTIDGTCNNLRNPYWGASYTVFDRLVPAVYEDGWNEP------RGAGKSLAGARLPNARIVSLSVHPDHISPDNRMTNMIPQVGQFLDHDMTLTPETDKHCCTTDARNMDCWSINIPSDDYFFSKLRNPSTCMAFTRSTAYCFPNLQGVREQFNVITAFVDASHVYASENGRTNLLRSHQGGRLRVNSQNPNFLPTVEEIQRTSGEKFEFMGTFYGGEERVNEMPALTVMHTLLFREHNRLADEIAARRPYWDDETIFQEARRLLIAQWQNVVYGEYLPVILGENTMVRYGLKLDDAQLYSEYNPSTNPTVFHAFADAAYRFGHTLINGLIRMM--KGFQDVSSYRLRDAFFNHEQISMNGGQGYDFILNGLMQQNAQTYDPFITEEVTNFLLRERHQDHGGDLIARNLQRGRDHGLPSYNVYRQVCGLQGISNSWANRPSNIPQDVWQVLGSLYETPADIDLFTGGLAEMPLTGAVTGHTFNCLKALQFARVRQGDRFFFTHRGNPAPFSPEQLREIRKRTLGDIICDNSNIE 703          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|1061476447|gb|ODM94302.1| (Peroxidasin [Orchesella cincta])

HSP 1 Score: 366.696 bits (940), Expect = 6.764e-109
Identity = 200/538 (37.17%), Postives = 296/538 (55.02%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNV--TCLNFYRSVRFC---SSTPREQYNEITSFIDASNVYGSSDEEL----------LLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSS-YHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFN-NGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGID 617
            C+P   +R ++G CNN  +P +G+      R LP  Y D  + P          G +SS  LPN R +S+T+H DV  P    + MV Q+G FV HD++  P   +  C +   D  C PI+I  ND F+S  +   TC++F RS  FC    +  REQ+N +T+F+DAS VYGS  E            L +   N +L+ +    + +        G ++ GD R      L ++HTL VREHNRI+ ++ Q+ P ++++ VF+  RRIL A  QN+VY E+LP +LG+ +M    LNL    + Y+  +NPT+   F  AAYRFGH++I   +     K  +   +Y L  +FF +   +  NG G   IL GL    AQ+ D  V + +TN++       +G+DL A+ + RGR+HG+  Y  +R+ C L PL  WNN+P EI    W LL+ LY SP DID+ T G++E P+     G T NC+   QF   K GDR+FFTH  +AGSF+  Q++ +R+ +LS +MC+N+ +D
Sbjct:  127 CNPVTPFRSIDGSCNNIQHPYWGASFTTFDRMLPADYADGFNEP---------RGGLSSVTLPNPRLISTTIHYDVISPDLSITNMVPQFGQFVDHDMTLAPEGDKHCCTKDLGDKDCWPIKIPSNDPFFSKVSSPQTCMDFTRSTPFCFPAGTGIREQFNILTAFLDASQVYGSDAERAEQLRAFNGGRLAVNTNNVWLLPTVAQVEERTNKKIPFMGKYLAGDERVNEMPALTTMHTLLVREHNRIAGEVQQVRPQWSDDEVFENARRILIAEWQNVVYGEYLPVILGDATMIAFDLNLGEDHTLYNPMLNPTIFHAFATAAYRFGHTLINGIIQ--LYKGLAKVGSYPLKDNFFESEQLDQNNGDGYNLILGGLMVQNAQTYDPHVTEALTNFVLKPRAAEFGSDLIARNVQRGREHGIQPYTAYRQICQLSPLTTWNNRPAEIIPQTWSLLRGLYKSPRDIDLFTGGMSEVPVHGGYSGATFNCLKAMQFYRSKYGDRYFFTHGNQAGSFSRAQIQHIRKRTLSDIMCENSDLD 653          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|936713994|ref|XP_014234958.1| (PREDICTED: peroxidase-like [Trichogramma pretiosum])

HSP 1 Score: 373.629 bits (958), Expect = 8.523e-109
Identity = 216/599 (36.06%), Postives = 327/599 (54.59%), Query Frame = 0
Query:   61 KLVKKGYSRDSAHQKVIQLIKDI----------EYELEEC--KGTMPDCDP-NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHE-----AKCCE--GA----KDDR---CLPIRIYENDLFYSNFNVTCLNFYRS----VRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDG--------KGS-----FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKP-YGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMC 611
            +L K GY+   A +++     ++            +L +C  +G +P C P +++YR  +G CNN     +GS    +QRFLP  YED           ++    ++   LP+AR++S  +H + D P +  S M+ QWG FV HD++    S        +CC   GA    +D     CLPI +  +D     F + CL F RS       C   PREQ +++TSFIDAS VY SS ++   L+   + LM+       + LLPK          +GS     F  GDAR      L  +H +F+R HNR++ +L+ +NP +++E +FQETRRI+GA++Q+I Y EFLP +LG   M    + L+   Y   Y   +NP +A+ F AAAYRFGHS++QR   R   +      N ++ ++F + +N E      ++ I+ GL   PAQ  DRF+ +E+T +LF +G   +G DL A  I RGRDHG+PSY  WRE C L P+ DWN+     S       + LY+S  D+D+ +AGLAE P+   ++GPT  CII +QF AL+ GDRF++ +D     F+P+Q+K +R++SL++++C
Sbjct:   88 QLAKLGYASIEAAKRIRSKFPNVVRLKQASGAASSQLPDCPRRGIVPQCPPASLRYRTTDGSCNNLRELWWGSAMSTMQRFLPAAYEDG---------IESVRRSVTGAELPSARRLSDQLHEERDEPLSSVSHMLMQWGQFVDHDITATGQSRGFRGSVPQCCRQGGAAFQPRDSMHPDCLPIAVEADDSHLGRFGIRCLEFVRSGPAPREDCGFGPREQLSQVTSFIDASTVYSSSAKQSDALRLFRNGLMQYGKQAAERPLLPKRRDLESDLCRRGSLSTSCFQAGDARLSEQPALIGLHVVFLRLHNRLATRLSSLNPHWSDERLFQETRRIVGALVQHITYREFLPIVLGPDVMGIFDIELRRKGYYDGYDPSVNPNIANSFAAAAYRFGHSLVQRTFARFDSQHQPLLDNVTIHEEFAHPSNLEAAGA--VDRIILGLVNQPAQRRDRFISRELTRHLFQSGASGFGLDLAAINIQRGRDHGIPSYASWREACSLGPIRDWNDVAKVSSVEAAAKFQRLYASALDLDLFSAGLAERPVAGGLVGPTFACIIAQQFRALRKGDRFWYENDQPQSGFSPEQLKQIRRSSLAQLLC 675          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|942313989|gb|JAN38927.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 365.155 bits (936), Expect = 1.359e-108
Identity = 229/645 (35.50%), Postives = 345/645 (53.49%), Query Frame = 0
Query:   15 LYIVKVYGEGCPFASSANDEKKLLDQANVKDVDYHKLLQKGRQVTPKLVKKGYSRDSAHQKVIQLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCC--EGA------KDDRCLPIRIYENDLFYSNFNVTCLNFYRSV---RF-CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKD-----------GKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            L I  + G   P + S   ++   D+A +  V+  + LQ   +++P+    G          +Q I      LE+    +P C P +KYR  +G CNN   P +GS    L+R  PP+Y+D   +P        RE       LPN R V S + TD + P    + M+ QWG FV HD+  VP     N     CC  EG       +   C PI I  ND FY    V CLNF RS+   R  C     EQ N++T FIDAS++YG S      L++    LMK ++ + G+  LP++           G   FV GD+RA    GL ++H LF+R+HN ++  LA +NP + +E ++ E RRI+GA++Q+I Y+EFLP+LLG  +M+  GL  +   Y  SY E +NP++ + F AAA+R GHS+IQ  +N +A      +    L + +F+  +   + G  ++ +L GL     Q+ D +V ++VTN+LF + +  +G DL +  + RGRDHGLP Y  +R+ CGL P+  +    T +   +   L  +Y S +DID++  GL E+ +P S+LGP  +CII  QF  LK+GDRFF+ H G   SFTP Q++ +R+ SL+ ++CDN   D+I  +  ++F
Sbjct:   24 LPIFLILGSQIPSSYSGGAKRSNADRALLV-VNAARRLQDRLRLSPEQAGLG----------LQAIDTRLGLLEDTCPLLPACLP-IKYRSFDGTCNNLRQPSWGSALSALERLAPPEYDDGIWDPKIRKM--GRE-------LPNVRVVRSIIVTDENHPRVDMTHMLMQWGQFVDHDMIHVPVFRTANQSNIDCCSREGGIIPPEMRHPHCFPIDIPANDPFYGPRGVRCLNFVRSMIAPRLDCRMGYAEQMNQLTHFIDASHIYGPSPAIAASLRQFVGGLMKISVIE-GRPYLPQNPQARGCVGRTAGFACFVAGDSRANQIMGLTALHILFLRQHNFLAAALAAINPRWNDEVLYLEARRIVGALVQHITYNEFLPSLLGRLTMDTYGLTPQTTGYSPSYDENVNPSITNEFAAAAFRMGHSLIQGAMNLVAEDG---TVRVELMRHWFDNPHLLRQAG-QMDAVLRGLIDQWPQNMDEWVSEDVTNHLFQSARRDFGFDLVSLNLWRGRDHGLPGYNTYRQVCGLPPVTSFQELLTIMDRAVVDRLAAVYRSVDDIDLYAGGLVESHLPGSMLGPVFSCIIADQFARLKEGDRFFYEHGGHPNSFTPAQLQEIRRMSLAAIICDNA--DQIGSIQPLVF 640          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|1126170981|ref|XP_019617513.1| (PREDICTED: thyroid peroxidase-like [Branchiostoma belcheri])

HSP 1 Score: 363.999 bits (933), Expect = 3.593e-108
Identity = 209/530 (39.43%), Postives = 309/530 (58.30%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSV----RFCS-STPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL----KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN--GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISE-NIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKI 619
            ++R  +G  NN  +  +G+ +  L+R L P+YED  S P    +   R+G     PLPNAR VS  VH D+  PS  AS M+ Q+G F++H+++  P++ + KC   + D  C  I + + D  +     +CLNF RS       CS  T REQ++++T+F+DASNVYG S++E+  L+ +         +++   L P+DG+  F  GD R     GL S+HT+F+REHNR++RKL+++NP + ++ VF E R+I+GA +Q IVYSE+LP +LG  +M E GL L    ++ S Y   +NPT+++VF   AYRFGHS+ Q   +R        +    L   +F+T+   D    G + IL GLT  PAQ  DRF+V  +T +L  +  G   G DL A  I RGRDHG P Y DWRE CGL     ++    EI +      L+ LYS  +DID+   GLAE  +   V+GPT  C+IG QF  L+ GDRF+F +   +G FT  Q+  +++TSL+R++CDNT  +++
Sbjct:  129 EFRSADGCGNNKDHTQWGTPKECLKRLLDPQYEDGLSAP----RTTGRDG----SPLPNARLVSLIVHEDLRKPSREASHMLMQFGQFMSHEVTQTPDAKDVKCSCDSDDSECFNIPVPKVDPDFGK--RSCLNFTRSAACVREGCSLGTAREQFHQVTAFVDASNVYGQSEDEMEKLRAK---------SEEEAGLAPEDGQRCFQAGDNRVDQNPGLTSLHTVFLREHNRVARKLSEVNPDWDDDRVFFEARKIIGAELQKIVYSEYLPLVLGPDAMTEYGLTLTAEGEFFSGYDSTLNPTISNVFATTAYRFGHSLTQNEYDRYQPGFQQTNCPIKLAYSYFDTSYVSDDAKGGPDSILRGLTAQPAQDFDRFMVSGLTKFLLADPPGSDQGFDLAAIDIQRGRDHGQPGYNDWREKCGLRRAPGFDYLGWEIPDLTTRQKLESLYSHVDDIDLFVGGLAEESVRGGVVGPTFACLIGLQFQDLRKGDRFWFEN---SGQFTEDQLAEIKKTSLARILCDNTDTEQM 636          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|942332997|gb|JAN48431.1| (Chorion peroxidase precursor, partial [Daphnia magna])

HSP 1 Score: 360.147 bits (923), Expect = 3.702e-107
Identity = 215/573 (37.52%), Postives = 317/573 (55.32%), Query Frame = 0
Query:   87 LEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCC--EGA------KDDRCLPIRIYENDLFYSNFNVTCLNFYRSV---RF-CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKD-----------GKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            LE+    +P C P +KYR  +G CNN   P +GS    L+R  PP+Y+D   +P        RE       LPN R V S + TD + P    + M+ QWG FV HD+  VP     N     CC  EG       +   C PI I  ND FY    V CLNF RS+   R  C     EQ N++T FIDAS++YG S      L++    LMK ++ + G+  LP++           G   FV GD+RA    GL ++H LF+R+HN ++  LA +NP + +E ++ E RRI+GA++Q+I Y+EFLP+LLG  +M+  GL  +   Y  SY E +NP++ + F AAA+R GHS+IQ  +N +A      +    L + +F+  +   + G  ++ +L GL     Q+ D +V ++VTN+LF + +  +G DL +  + RGRDHGLP Y   R+ CGL P+  +    T +   +   L  +Y S +DID++  GL E+ +P S+LGP  +CII  QF  LK+GDRFF+ H G   SFTP Q++ +R+ SL+ ++CDN   D+I  +  ++F
Sbjct:   52 LEDTCPLLPACLP-IKYRSFDGTCNNLRQPSWGSALSALERLAPPEYDDGIWDPKIRKM--GRE-------LPNVRVVRSIIVTDENHPRVDMTHMLMQWGQFVDHDMIHVPVFRTANQSNIDCCSREGGIIPPEMRHPHCFPIDIPANDPFYGPRGVRCLNFVRSMIAPRLDCRMGYAEQMNQLTHFIDASHIYGPSPAIAASLRQFVGGLMKISVIE-GRPYLPQNPQARGCVGRTAGFACFVAGDSRANQIMGLTALHILFLRQHNFLATALAAINPRWNDEVLYLEARRIVGALVQHITYNEFLPSLLGRLTMDTYGLTPQTTGYSPSYDENVNPSITNEFAAAAFRMGHSLIQGAMNLVA---EDGTVRVELMRHWFDNPHLLRQAG-QMDAVLRGLIDQWPQNMDEWVSEDVTNHLFQSARRDFGFDLVSLNLWRGRDHGLPGYNTSRQVCGLPPVTSFQELLTIMDRAVVDRLAAVYRSVDDIDLYAGGLVESHLPGSMLGPVFSCIIADQFARLKEGDRFFYEHGGHPNSFTPAQLQEIRRMSLAAIICDNA--DQIGSIQPLVF 607          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|942308717|gb|JAN36291.1| (Chorion peroxidase precursor [Daphnia magna])

HSP 1 Score: 360.147 bits (923), Expect = 9.726e-107
Identity = 227/645 (35.19%), Postives = 344/645 (53.33%), Query Frame = 0
Query:   15 LYIVKVYGEGCPFASSANDEKKLLDQANVKDVDYHKLLQKGRQVTPKLVKKGYSRDSAHQKVIQLIKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCC--EGA------KDDRCLPIRIYENDLFYSNFNVTCLNFYRSV---RF-CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKD-----------GKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            L I  + G   P + S   ++   D+A +  V+  + LQ   +++P+    G          +Q I      LE+    +P C P +KYR  +G CNN   P +GS    L+R  PP+Y+D   +P        RE       LPN R V S + TD + P    + M+ QWG FV HD+  VP     N     CC  EG       +   C PI I  ND FY    V CLNF RS+   R  C     EQ N++T FIDAS++YG S      L++    LMK ++ + G+  LP++           G   FV GD+RA    GL ++H LF+R+HN ++  LA +NP + +E ++ E RRI+GA++Q+I Y+EFLP+LLG  +M+  GL  +   Y  SY E +NP++ + F AAA+R GHS+IQ  +N +A      +    L + +F+  +   + G  ++ +L GL     Q+ D +V ++VTN+LF + +  +G DL +  + RGRDHGLP Y  +R+ CGL P+  +    T +   +   L  ++   +DID++  GL E+ +P S+LGP  +CII  QF  LK+GDRFF+ H G   SFTP Q++ +R+ SL+ ++CDN   D+I  +  ++F
Sbjct:   24 LPIFLILGSQIPSSYSGGAKRSNADRALLV-VNAARRLQDRLRLSPEQAGLG----------LQAIDTRLGLLEDTCPLLPACLP-IKYRSFDGTCNNLRQPSWGSALSALERLAPPEYDDGIWDPKIRKM--GRE-------LPNVRVVRSIIVTDENHPRVDMTHMLMQWGQFVDHDMIHVPVFRTANQSNIDCCSREGGIIPPEMRHPHCFPIDIPANDPFYGPRGVRCLNFVRSMIAPRLDCRMGYAEQMNQLTHFIDASHIYGPSPAIAASLRQFVGGLMKISVIE-GRPYLPQNPQARGCVGRTAGFACFVAGDSRANQIMGLTALHILFLRQHNFLATALAAINPRWNDEVLYLEARRIVGALVQHIPYNEFLPSLLGRLTMDTYGLTPQTTGYSPSYDENVNPSITNEFAAAAFRMGHSLIQGAMNLVAEDG---TVRVELMRHWFDNPHLLRQAG-QMDAVLRGLIDQWPQNMDEWVSEDVTNHLFQSARRDFGFDLVSLNLWRGRDHGLPGYNTYRQVCGLPPVTSFQELLTIMDRAVVDRLAAVFRLVDDIDLYAGGLVESHLPGSMLGPVFSCIIADQFARLKEGDRFFYEHGGHPNSFTPAQLQEIRRMSLAAIICDNA--DQIGSIQPLVF 640          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|1000745679|ref|XP_015595582.1| (PREDICTED: uncharacterized protein LOC107267903 isoform X3 [Cephus cinctus])

HSP 1 Score: 379.022 bits (972), Expect = 1.009e-106
Identity = 214/572 (37.41%), Postives = 315/572 (55.07%), Query Frame = 0
Query:   91 KGTMPDCDP-NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCEGAKDD---------RCLPIRIYENDLFYSNFNVTCLNFYRS----VRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDG-------KGS-----FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT-GIDKISFLNLII 626
            +GT P+C P +++YR  +G CNN  N  +GS    +QR LP  Y+D           ++    I+   LP+ARK+S  +H D DVPS   + M+ QWG F+ HD++        N    +CC G  DD          CLPIR+   D FY  FN+ CL F RS       C   PREQ +++TS+IDAS VY S+      L+   + L+K       K LLP+         +GS     F+ GD RA+    L ++H +F+R+HNRI+ +LA +NP +++E ++QETRRI+ A+MQ I Y EFLP +LG   M    L++    Y   Y   INP V + F  AAYRFGHS++Q +  R   +     +N S+  +F N  N +      ++ +L GL   P+Q+ D F+ +E+TN+LF     P+G DL +  I RGRDHG+P Y +WRE CGL P+ +W +    +  ++     ++Y S  DID+  AGL+E  +P  ++GPT  CII +QF+ L+ GDRF+F +     SFTP Q++ LR+ +LS+++C     ID I     +I
Sbjct:  319 RGT-PECPPASLRYRTADGSCNNLQNLWWGSAMSTMQRLLPAFYDDG---------IQSVRRSITGKSLPSARKISDLIHEDRDVPSPSITHMLMQWGQFIDHDITATAQTRGFNGTVPQCCVGRGDDFQPPEFMHPECLPIRVSPRDGFYGRFNIRCLEFVRSGPAPREDCGFGPREQLSQVTSYIDASTVYSSNARVSDSLRLFRNGLLKYGKLQSRKPLLPRQNLLNDLCQRGSLATDCFMAGDGRAVEQPALTTLHVVFLRQHNRIATELAALNPHWSDEKLYQETRRIIIALMQQITYREFLPVVLGRAVMENFDLDIHNKGYFDGYDPSINPNVINSFATAAYRFGHSLVQPSFVRFDSRHRPIPNNVSIHDEFSNPINLQ--TAGSVDRLLLGLVNQPSQTRDEFITEELTNHLFQTPNFPFGMDLASLNIQRGRDHGIPPYVNWREPCGLSPIRNWEDLKRVMPTSLVRKFSQVYVSVEDIDLFPAGLSEFSVPGGLVGPTFACIIAQQFSNLRKGDRFWFENPDAENSFTPAQLQQLRRVTLSQILCKTMDSIDTIQPFAFLI 878          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|1061473741|gb|ODM92097.1| (Chorion peroxidase [Orchesella cincta])

HSP 1 Score: 361.688 bits (927), Expect = 1.009e-106
Identity = 201/552 (36.41%), Postives = 303/552 (54.89%), Query Frame = 0
Query:   89 ECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPS---TIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTP----REQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDG-----KELLPKD-GKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSS------YHEEINPTVASVFVAAAYRFGHSM----IQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGL-GIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGI 616
            EC+     CD   KYR   G CNN  NP +GS      R +PP Y++A  +P        R G IS+  LP +R+++  +H D    S    +A+ MV Q+G F+ HD++  P  + A CC  A+ + C PI +   D +Y +  + CL+F RS   C        REQ N  TS+IDA  VYG +++   +L+      +       G     KE++P D   G  + GD RA    GL  +H+LF+REHNRI+  LA +   + +E ++QETRRI+ A +Q + Y+EFLP++LG+ +MN   L L   ++      Y   ++ T+ S F  AAYRFGH++    IQ  ++   +  Y+ S NY +        + ++  G+ G + IL GL    AQ+ D  + K++++ LF +    G DL A+ + RGRDHG PSY  +R FC +  L  W+NKP +I +  W  L+++Y+ P DID++T GL++  +   + GPT  CI   QF  L  GDRFFFTH  +AGSFTP+Q+ ALR  +L  ++C N+ +
Sbjct:  109 ECEQEELGCDSASKYRSFRGTCNNVANPYWGSVNMPNLRLIPPAYDNAIDDP--------RGGIIST--LPPSREITLKIHRDSGNDSKYENVATHMVPQFGQFLDHDITLTPVDNLA-CCGAAQPEGCWPISVESTDPYYGSSPIRCLDFVRSTSVCFPQAGIEHREQMNIHTSYIDAGMVYGPTEQIAAVLRTYRKGRLAENAQYPGFLPYRKEVVPGDESDGVIIAGDVRANEMPGLTVMHSLFLREHNRIAASLANLT-DWDDEKIYQETRRIIAAEIQQVTYTEFLPSILGQDAMNNYSLALPPVTNNNGYTKYDATVDATIISSFATAAYRFGHTLVNGLIQLMLDDQIVGSYNVSDNYLVSNQIIENEHADEGQGVTGYDLILNGLIRQQAQAFDTVIHKDMSDKLFKSATFIGTDLAARNVQRGRDHGTPSYNAFRRFCNIPALTTWDNKPDDIGQEAWERLRDVYADPEDIDLYTGGLSQITVEGGLSGPTLVCIQAIQFQRLMQGDRFFFTHSDQAGSFTPEQLAALRSRTLGDIICQNSAL 648          
BLAST of EMLSAG00000004874 vs. nr
Match: gi|242008911|ref|XP_002425239.1| (Chorion peroxidase precursor, putative [Pediculus humanus corporis] >gi|212508973|gb|EEB12501.1| Chorion peroxidase precursor, putative [Pediculus humanus corporis])

HSP 1 Score: 366.696 bits (940), Expect = 2.098e-106
Identity = 208/545 (38.17%), Postives = 306/545 (56.15%), Query Frame = 0
Query:  100 NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHE-----AKCCEGAKDDR---CLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKD-GKGSFV-----------GGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGK-PYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGI 616
            N  YR M+G CNN  +P +GS+   L+RFL P YED           +A    I  GPLP+AR VS+ VH D +V S   + ++ QWG F+ HD++    S        +CC+   D +   CLPI +  +D F+S F + CL F RS       C+  PREQ N++TS+ID S +YG+S+ E   L+   + ++K T       LLP D  KG F             GD+R     GL ++H +F+R HNR++R LA +NP + +E +FQETR+I+GA++Q+I Y EFLP +LG+  M+  G++L    Y  +Y E ++ T A+ F  AA+RFGHSM+Q    +    +     N SL  +  +T +   R G  ++ ++ G+    AQ  D     E+TN+LF     P G DL A  I RGRDHGLPSY  WR  CGL  + +WN+    +S+     L+ +Y   ND+D++T GLAE  +   ++G T  CIIG+ F  L+ GDRF++ + G   SFT  Q+KA+R+ +L+R++CDN  +
Sbjct:  313 NHLYRTMDGTCNNLKHPWWGSRFQPLKRFLAPHYEDG---------LEAIRRSIKGGPLPSARLVSTEVHWDKNVESKSVTHLLMQWGQFLDHDMTSSSQSRGFGGSVPRCCDAPPDLQHPDCLPIEVLPDDRFFSRFGIRCLEFLRSAPSSRVGCALGPREQINQVTSYIDGSMIYGNSERESSKLRLFRNGMLKYTRMPQRLPLLPIDRDKGEFCRKSSPDFFCLHSGDSRMNEQPGLLAIHIVFLRLHNRLTRNLAHLNPEWNDERLFQETRKIVGAIIQHITYREFLPIVLGQDVMSIFGIDLLKTGYYQNYSESVSSTAANSFATAAFRFGHSMVQGKFLKWDDIRKEEIINVSLHDELLDTGSLH-RFG-AVDNLMLGMCRQGAQKRDEHFTVELTNHLFQTPNFPAGLDLAAINIQRGRDHGLPSYNSWRNPCGLRKMKNWNDLLNVMSQESRDALRRIYRDVNDVDLYTGGLAEFSVRGGLVGSTFACIIGQHFRNLRKGDRFWYENGGFESSFTVAQLKAIRRVTLARILCDNLDL 846          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold160_size295910-snap-gene-1.35 (protein:Tk01231 transcript:maker-scaffold160_size295910-snap-gene-1.35-mRNA-1 annotation:"peroxinectin ")

HSP 1 Score: 444.121 bits (1141), Expect = 1.099e-141
Identity = 230/537 (42.83%), Postives = 324/537 (60.34%), Query Frame = 0
Query:   93 TMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTE-------NSQFKAREGCISSGP--LPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSS--TPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGL-NLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLF-NNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGI 616
            T   C+PN  +R +NGQCNN  NPL+G+     +R +P +Y+D  S P         N +F     C+S+ P  LPNAR VS+  H D +VPS + + MV+Q G F+ HD++  P +    CC+  ++  C PI I +ND FYS  + TC++F RS  FCS+  + R+Q N+ITSFID S VYGS +     L+  N        T  G+ ++     G F  GD RA    GLA++HTL +REHNRI+  L ++NP   +E ++Q  R ++ A  Q+++Y E+LP L G+  M++ GL +    S Y+   NP++++ F  AAYRFGHSMIQ  +N +     S   ++ L  +F     Y   NG G++ IL GL   PAQ  DRFVV +VTN+LF  NG+ +G+DL A+ I RGRDHGLP Y D+R++CG+  +C WN +P EIS+N W  L++LY +P DIDI  AGLAETP    V G    CI   QF  LK GDR+FFTH  +AGSF   Q++ ++Q +L+ ++CDNT I
Sbjct:  126 TRVSCNPNQWFRNINGQCNNLNNPLWGAAGTAFKRLVPSRYKDGRSEPIGGGTSPGGNPRFYNIGSCLSNQPTQLPNARVVSTQFHPDFNVPSNVYTHMVTQMGQFLDHDVTLTPETALEHCCDTPQNSGCFPISIPQNDYFYSTVSRTCMDFSRSTSFCSNQNSQRQQVNDITSFIDCSQVYGSDNALANQLRFGNFRGRLFFSTTGGRHVMLPQINGEFTAGDIRATEMPGLATMHTLLLREHNRIADDLHRINPQLNDENLYQRARAMVIAEFQHVIYGEYLPVLFGQNVMSQFGLWSSNGYSRYNANFNPSISNAFATAAYRFGHSMIQGLINLVHESTRSVQESFQLKDNFNKLDKYFGNNGAGMQRILNGLITQPAQDMDRFVVDDVTNHLFPENGQNFGSDLIARNIQRGRDHGLPGYNDYRQWCGMPTVCSWNQRPAEISQNNWNQLRQLYQTPWDIDIFVAGLAETPFQGGVTGRIFQCIKAFQFQELKYGDRYFFTHSQQAGSFNFNQLRNIQQRTLADIICDNTEI 662          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold809_size94238-processed-gene-0.8 (protein:Tk02707 transcript:snap_masked-scaffold809_size94238-processed-gene-0.8-mRNA-1 annotation:"peroxinectin ")

HSP 1 Score: 377.481 bits (968), Expect = 2.749e-117
Identity = 215/548 (39.23%), Postives = 314/548 (57.30%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEAKCCE-GAKDDRCLPIRIYENDLFYS--NFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKE-ENSYLMKSTLTDD-----------GKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPS--YTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSN--YSLFK--DFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNG---KPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAG--SFTPKQVKALRQTSLSRVMCDNTGIDK 618
            C+P+ +YR M+GQCNN  NP +GS   +L+RF+P  Y+D    P          G      LP+ R VS   H D DVP +  + MV Q+G F+ HD++  P      CC+ G +   C  I I   D F+S  N + TCLN  RS   C S  REQYNE+TSFIDASN+YGS +    LL+  ++  L ++  TD              +LL  + +G F+ GD R      LA++H +F+REHNR+++ L +  PS   T+E V+QETRR++GA MQNIVY EFLPT+LG   M    L +K  + Y   ++ T+ + F AAA+RFGHSMI      ++ ++ S  S   Y L++  + F+  +      L +E +L GL     Q++D F   E+T++LF      + +G DL A  I RGRDHG+P Y  +R+ CGL P+ +WN KP+E+ ++ W  L+E+Y+S NDID+  A +AE      V+GPT  C+IG QF+ LK GDR+F+TH  ++G     P   KA+ Q ++  +MCD + +++
Sbjct:   49 CEPSARYRTMSGQCNNLANPEWGSTGEKLRRFVPNAYKDGRDIP---------RGGRHPSSLPSPRWVSQKNHPDSDVPDSRFTHMVMQFGQFLDHDITLAPKDEGTDCCKSGVQGPECFTIPIPSPDRFFSWVNNSATCLNVIRSTPICDSQIREQYNELTSFIDASNIYGSDEGHGKLLRTFKDGRLQRNKNTDQLPTRQQLGVAPNTQLLRPEKQGDFMAGDMRVNEHPFLATLHVVFLREHNRMAKLLKEYLPSEFQTDEIVYQETRRLIGAQMQNIVYGEFLPTVLGVDFMTRYDLIVKEETEYDINVDATIFNSFSAAAFRFGHSMINGMFKLVSQRQPSTRSKDVYWLWRLREVFDGQSIRGAR-LPLENMLEGLITQEPQTSDAFFTTEITDHLFQKNDLRENFGHDLLALNIQRGRDHGIPGYNGYRKQCGLRPIKNWNEKPSELDQDYWEKLREVYTSVNDIDLFVAAIAEKNAQGGVVGPTFACLIGEQFSRLKRGDRYFYTHTKQSGGQGLGPVARKAILQRTMGDIMCDVSQLEQ 586          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold319_size207808-snap-gene-1.16 (protein:Tk00372 transcript:maker-scaffold319_size207808-snap-gene-1.16-mRNA-1 annotation:"peroxinectin ")

HSP 1 Score: 377.096 bits (967), Expect = 3.430e-112
Identity = 214/530 (40.38%), Postives = 303/530 (57.17%), Query Frame = 0
Query:   96 DCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTEN--SQFKAREGCISSGP-----------LPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSF-VPNSHEAKCCEGAKDDRCLPIRIYENDLFYSNFN---VTCLNFYRSVRFCS--STPREQYNEITSFIDASNVYGSSDEELLLLKEENS-YLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTH---DGEAGSFTPKQVKALR 602
            +C  + +YR ++G+CNN  N  +GS    + R +P  Y D    P     SQ   +     S P           LPN R++S+  H D ++ S   + MV Q+G ++ HD++F V +SH   CC     + C PI +   D F+ +       C+NF RS + C   + P +Q N +T+F+DAS+ YGS + E L L+  +S  L  S     GKE LP D +G F  GD R     GLASVHT+F+REHNRI+R+L  + P   +E +FQ +RRIL A  QNIVY E+LP +LG + +  + L++   S Y+ +I+PT ++ F  AA+RFGH+ IQ  ++ ++    + S +Y +   FF+  +Y  RNG G+EE+L+GL    +  ADRFV K+VTN+LF      G DL A+ I RGRDHGLP Y  +RE CGLE  C W+  P  IS + W  L ++Y  PNDID+  AGLAE  +   ++GPT  CI+  QF  LK GDRFFF+H   +G   SFT KQ   +R
Sbjct:  117 ECHEHSRYRSVSGRCNNLANREWGSINQAMVRLIPNAYADGIGVPRGGLVSQRDLQNQIHGSNPENCGHPDLQKPLPNVRRISTEFHPDSNLDSGSNTLMVMQFGQYLDHDITFTVESSHAEDCCSNPAQEDCFPIWVPAGDPFFGSGRGNRKECINFARSTQHCPKPNQPLDQMNTLTAFVDASHTYGSFEAESLRLRTFSSGKLRTSKRFAGGKEFLPVDSEGHFYSGDIRGTEMPGLASVHTMFLREHNRIARELKTLKPQLGDEELFQSSRRILIAQWQNIVYGEYLPVVLGPEVIKSNALDMSR-SKYNPKIDPTTSNAFATAAFRFGHTQIQGLIHMMS-SLGNISQSYRVRDQFFSMDHYLARNGEGMEELLHGLIAQRSAQADRFVSKDVTNFLFP-----GIDLVARNIQRGRDHGLPGYNAYREMCGLERACSWSQVPAWISTSDWNALSQIYEHPNDIDLFVAGLAENHLRGGIVGPTFGCILANQFKRLKFGDRFFFSHSHKNGVTNSFTRKQFNTIR 639          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold370_size193435-snap-gene-0.40 (protein:Tk07792 transcript:maker-scaffold370_size193435-snap-gene-0.40-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_320790")

HSP 1 Score: 355.525 bits (911), Expect = 6.680e-105
Identity = 214/583 (36.71%), Postives = 324/583 (55.57%), Query Frame = 0
Query:   88 EECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKA--REGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCC--------EGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSV----RFCSSTPREQYNEITSFIDASNVYGSSDEE---LLLLKE-----ENSYLMKSTLTDDGKELLPKDGKGS------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKP-YGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEA---GSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFVSM 630
            + C+G       ++ YR  +G CNN + P +GS      RFLPP Y D      E    K   R   I    LP+AR VS+ +H  +D  +   + MV QWG F+ HDL+F P      +   +CC        E    + C PI +   D F+S FNVTC+ F RS+    R CS  PR+Q N++TSFIDASNVYGS+ EE   L LL+       + ++ K  L    +E+  ++ + S      F  GD R     GL S+HT+++REHNR++R+L + NP + +E ++ ETR+I+GAM Q+I ++E+LP +LG + ++   L LK   +   Y+  +NPTVA+ F  AA+RFGHS+++ N++R   +         L K+  N AN    N   ++ I  GL        D F+  E+TN+LF N +  YG DL +  I RGRDHGLP Y  WRE CGLE   ++++    +     +  + +Y S +DID+   GLAE P+   ++GPT  CI+G+QF  L+ GDRF++ +  +A   G+F+ +Q++ +R+TSL+R +CDN  +D I  +    F+++
Sbjct:  163 DRCRGL------DLLYRSADGSCNNLLKPEWGSSFSPSLRFLPPVYSDTVGLRGEFRLPKRVRRNNRI----LPSARAVSTAIHKKLDTDTLTFTMMVMQWGQFLDHDLTFTPMRRGFQNSLIRCCTDDGKPLPENLMHEECRPIEVPTTDPFFSQFNVTCMEFVRSLAAPKRDCSLGPRDQMNQVTSFIDASNVYGSTQEEQDRLRLLRNGKLRYTDLHIRKPLLPPLDQEIAQEECRISTPNLHCFEAGDERVNEQPGLTSMHTMWLREHNRLARELQKENPHWEDERIYHETRKIVGAMHQHITFNEWLPIVLGPRVLSIFELTLKPTGFFDGYNNTVNPTVANAFGGAAFRFGHSLVKGNLSRHNKEFREVPFYVKLRKELNNPANLH--NFGSVDRITLGLCSKALSRRDEFITDELTNHLFQNPRTKYGMDLASLNIQRGRDHGLPPYNKWREQCGLEKFKEFSDMAKFMRPETVIGFQSVYDSVDDIDLFPGGLAELPVVGGLVGPTFACILGQQFLNLRKGDRFWYENGEDANPGGAFSAQQLQEIRKTSLARTICDN--LDDIEMIQPYAFLTV 731          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold801_size95070-processed-gene-0.1 (protein:Tk01646 transcript:snap_masked-scaffold801_size95070-processed-gene-0.1-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_224067")

HSP 1 Score: 339.347 bits (869), Expect = 4.742e-102
Identity = 204/594 (34.34%), Postives = 315/594 (53.03%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSF---VPNSHEAK---CCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRS---VRF-CSSTPREQYNEITSFIDASNVYGSSDE-----------ELLLLKEENSYLMKSTLTDDGKE-----LLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDN-TGIDKISFLNLIIFVSMFKG-LYCSRSTHGGFRIVEGKDAGNFSDFVVGFF 663
            +YR + G CNN   P +G+  +   RFLPP + D  S P  +         +S  PLP+AR VS+  H   +      + ++  WG ++ HD++    V + H  K   CC+G+ +  CLPI I +ND FY   +  C+NF RS   +RF C   PRE +N + SF+DA   Y +S             EL +L     + MK  L  + +E     + P +    F+ GD R    T LA VHT+F REHNR++++L+++NP +++ET+FQET+ I+GA+ Q I ++EFLP +LG + M +  L L    Y   Y E INP+VA+ F +AA+RFGHS++   + R + K + Y ++  L         Y+       +  L GLT   A + D  +  E+ N+LF   G+ +G DL A  I R RDHG+PSY  +RE+C L  +  +++    +         + Y+SP DID+ +AG++E P+P S++GPT  CIIG+QF   + GDRF++ + G   SFT +Q+  +R+  LSR++CDN   +D +    +++        + C      G      KDA   +    GFF
Sbjct:  152 RYRTIEGLCNNLNMPHWGAAMHGHHRFLPPDFADGISAPRIS---------VSGYPLPSARLVSTNTHAGDEKHDHAVTLLLVAWGQYIDHDITLSAEVKDPHTQKSPQCCKGSTNVHCLPIEIPDNDAFYRQHSQKCMNFVRSHAGLRFNCRLGPRESFNLVASFLDAGTTYSNSPHKLQELRSFEGGELKMLPLFEKFRMKHLLPLNLEEPDEGCIRPSEDVYCFLSGDPRVNEQTVLAMVHTIFAREHNRVAKELSKVNPHWSDETLFQETKLIIGALQQQITFNEFLPMVLGREVMEKHDLMLVKDGYLDGYDENINPSVATGFTSAAFRFGHSLLPSKIERWS-KSHRYVASQELSGMLLQP--YDLYKEGWADAYLMGLTNQVAHALDDSITPEIQNHLFQEPGRKWGLDLAALNIQRARDHGIPSYNKYREWCNLPSIRTFDDLLGYMPNKTVAAYAKTYASPEDIDLWSAGISERPVPGSMIGPTFACIIGKQFHNFRFGDRFWYENGGWPSSFTLEQLNEIRKVKLSRMLCDNGDDVDSVQVYAMVLPDHEINPRVPCKSGILKGIDFSAWKDASYHAQPQPGFF 733          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold292_size219010-snap-gene-1.41 (protein:Tk00329 transcript:maker-scaffold292_size219010-snap-gene-1.41-mRNA-1 annotation:"conserved hypothetical protein")

HSP 1 Score: 335.88 bits (860), Expect = 4.380e-96
Identity = 207/567 (36.51%), Postives = 306/567 (53.97%), Query Frame = 0
Query:   97 CDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPT--ENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPN-----SHEAKCCEGAKDD---RCLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLP----------KDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNE---SGLNLKYPSSYHEEINPTVASVFVAAAYRFGHSMI-------QRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNNGKP-YGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIFV 628
            C P  KYR  NG CNN  NP +G    R  R++   Y D  S P   E+ QF           LP+ R VS  VHTD     +    +   WG F+ HD++  P          KCC+   D     C PI+I  ND FY  F VTC  + RS       C+  PREQ N++TSF+D S +YGSS EE   L+  +   +K  L  +  ELLP           DG+  F  GD R     G+ ++HTL+VR+HNR++  +A++NP + +E +FQETRRI+GA +Q+I ++E+LPT+LG+++M++   S L + + S Y    NP  A+    AA RF  S++       +++  ++ ++K S S     +K F   + YE +    ++ IL G+T   +QS D  V  E+TN +F N     G DL ++ I +GRDHGLP Y  WR+FCGL  +  +      ++ +   +LK+ YSS  DID+ T GLAE P   +V+GPT  C+IGRQ    K GDR+++ +D    SFT  Q+  +R+ +L+R++CDNT    + F+   +F+
Sbjct:  178 CQPG-KYRAYNGYCNNVQNPNWGVSNRRYLRYIQSDYADGISIPRQREDGQF-----------LPSPRSVSVAVHTDTFNEHSHLMVIAPIWGEFIYHDVAHTPQMAGYLGQRLKCCDVEFDHFHPECYPIKISTNDPFYGKFAVTCQEYARSATASRTGCTLGPREQINQVTSFVDGSTIYGSSKEEAESLRTFSLGQLKVQLNANRDELLPPDQNSLDCRDSDGRKCFKSGDVRVNEHPGMVAMHTLWVRQHNRVAASMAELNPHWNDEQIFQETRRIVGAQIQHITFNEYLPTILGKETMDKYSLSPLKMGFFSGYDINTNPGTANSVTTAALRFTTSLLPAVFQYYEQSGTKVKLEKLSES----FYKPF---SLYEPQM---VDNILRGITKSHSQSEDIHVNSEMTNKMFMNASTGMGLDLVSQIIQQGRDHGLPGYVKWRKFCGLPEVTKFGQLSDIMTVDTIQILKKTYSSIEDIDLFTGGLAEVPSKGAVVGPTFACLIGRQMFYYKTGDRYWYENDIPPSSFTKDQLNEVRKITLARIICDNT--KTVDFIQPNVFL 720          

HSP 2 Score: 190.66 bits (483), Expect = 3.460e-49
Identity = 122/344 (35.47%), Postives = 182/344 (52.91%), Query Frame = 0
Query:   80 IKDIEYELEECKGTMPDCDPNMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSH-------EAKCCEGAK--DDRCLPIRIYENDLFYSNFNVT-----CLNFYRSVRFCSSTP-REQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLT-DDGKELLPKDGKGS---------FVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPT 395
            + DI    +  + T+P CD   KYR + G CNN   P +G       R L P Y+D   +P        R   +S  PLP+ R VS  +H DV  P    S M+ QWG FV HD++  P +        E K C+        CLPI + + D ++   N+T     CL F RS+    +   REQ N+ITSF+D+SNVYGS   E+  L+E     + +T     G++LLP   + +         F  GDAR      L ++HTLF+R+HN+++ +L+++NP +++ET++QE RRI  A++Q+I ++EFLP +LG  ++    LNL+   Y   Y E+ NPT
Sbjct:  869 VMDIPKVFQCDEQTLP-CDHTTKYRTLTGWCNNLNFPEYGKSIRAFTRLLAPAYDDGLMSP--------RSRSVSGRPLPSPRLVSVNIHNDVSAPHVRYSLMMMQWGQFVDHDITHTPVNRGFGDSILECKDCDAKTRIHPECLPIPVPDGDPYFPKVNITSGKPFCLAFTRSMPGQLTLGFREQMNQITSFLDSSNVYGSDLCEMRELREFKGGRLNTTRQFHGGRDLLPLTVENAECKAKSGFCFEAGDARNSEQPVLTAIHTLFMRQHNQLADELSRLNPQWSDETLYQEGRRIASAILQHITWNEFLPRVLGWNAIKLYELNLQSEGYFHGYDEKCNPT 1203          

HSP 3 Score: 103.219 bits (256), Expect = 2.983e-22
Identity = 55/133 (41.35%), Postives = 78/133 (58.65%), Query Frame = 0
Query:  483 PY-GADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT 614
            PY G DL +  I RGRDHG+P Y  +R  C L    D+++   EI+  +   LK  Y   +DID+ T GLAETP+   ++GPT  CIIG QF  L+  DRF++        FT  Q+  +R+ +LS+V+CD +
Sbjct: 1208 PYSGLDLASLNIQRGRDHGIPGYNLYRGICNLTRADDFSDLRREIALPVVERLKRTYDHVDDIDLFTGGLAETPLHGGLVGPTFACIIGIQFRNLRKCDRFWYETGNPLIRFTDSQLAQIRKITLSKVICDTS 1340          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold181_size278858-processed-gene-1.25 (protein:Tk08516 transcript:snap_masked-scaffold181_size278858-processed-gene-1.25-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_301956")

HSP 1 Score: 319.316 bits (817), Expect = 6.038e-95
Identity = 189/559 (33.81%), Postives = 294/559 (52.59%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEA------KCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF-------CSSTPREQYNEITSFIDASNVYGSSDEELLLLK--EENSYLMKSTLTDDGKELL--------------PKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT-GIDKISFLNLII 626
            +YR + G CNN  NP +G+  +   R LPP + D  S P  +         ++   LP+AR VS++ H D        + ++  WG ++ HD++      +       KCC+G +   CLPI I E D FYS +   C+NF   VRF       C   PRE +N +TS +DA   Y +S  +L  L+  E     M     + G E L              P +    F+ GD R    T LA +HT+F REHNRI  +L+++NP + +ET+FQE R I+ A+ Q   Y+EFLP +LG + M    L L    Y + Y  ++NP+V + F  A +RFGHS++   + R + K + +  +  L        +   + G G +  L G+    AQ+ D  +  EV N+LF   G  +G DL A  + RGR+HGLP+Y  +R+FCGL  +  +++    +        + +Y+SP DID+ +AG+AE P+  S+LGPT  CI+G+QF + + GDRF++ + G   SFT +Q++ +R+  LSR++CDN+  ID +    +++
Sbjct:  145 RYRSVEGLCNNIDNPHWGASMHGHNRLLPPNFADGISAPRVS---------VTGNALPSARLVSTSAHVDETRHDRAVTMLLVAWGQYIDHDITLSAEVKDPVTQKVPKCCDGVRHKLCLPIEIPEGDPFYSKYKQKCMNF---VRFSAGLRHNCRLGPRESFNLVTSTLDAGTTYSNSAHKLRELRTFEGGKLKMLPFFGNFGMEPLLPLNLENPNEGCIRPSEDIYCFLSGDPRVNEQTILAMLHTIFAREHNRIVIELSKVNPHWNDETLFQEARHIVAALQQQFSYNEFLPMILGSEEMKRYELELLSTGYFNGYDPKVNPSVTTAFTTAVFRFGHSLLPSKIERWS-KTHRFVDDQKLSSMLLQPYDLY-KQGWG-DSYLLGMINQVAQAMDDSITTEVQNHLFQAPGTKFGMDLLALNLQRGREHGLPAYTAFRDFCGLPRIVTFDDLRGSMPNETVNAYQRVYASPADIDLFSAGVAEWPVQGSMLGPTFACIMGKQFRSFRFGDRFWYENGGLPSSFTLEQLQEIRKIRLSRLICDNSDDIDSVQVYAMVL 688          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold181_size278858-processed-gene-1.12 (protein:Tk08509 transcript:snap_masked-scaffold181_size278858-processed-gene-1.12-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_301956")

HSP 1 Score: 319.316 bits (817), Expect = 6.038e-95
Identity = 189/559 (33.81%), Postives = 294/559 (52.59%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEA------KCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRF-------CSSTPREQYNEITSFIDASNVYGSSDEELLLLK--EENSYLMKSTLTDDGKELL--------------PKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT-GIDKISFLNLII 626
            +YR + G CNN  NP +G+  +   R LPP + D  S P  +         ++   LP+AR VS++ H D        + ++  WG ++ HD++      +       KCC+G +   CLPI I E D FYS +   C+NF   VRF       C   PRE +N +TS +DA   Y +S  +L  L+  E     M     + G E L              P +    F+ GD R    T LA +HT+F REHNRI  +L+++NP + +ET+FQE R I+ A+ Q   Y+EFLP +LG + M    L L    Y + Y  ++NP+V + F  A +RFGHS++   + R + K + +  +  L        +   + G G +  L G+    AQ+ D  +  EV N+LF   G  +G DL A  + RGR+HGLP+Y  +R+FCGL  +  +++    +        + +Y+SP DID+ +AG+AE P+  S+LGPT  CI+G+QF + + GDRF++ + G   SFT +Q++ +R+  LSR++CDN+  ID +    +++
Sbjct:  145 RYRSVEGLCNNIDNPHWGASMHGHNRLLPPNFADGISAPRVS---------VTGNALPSARLVSTSAHVDETRHDRAVTMLLVAWGQYIDHDITLSAEVKDPVTQKVPKCCDGVRHKLCLPIEIPEGDPFYSKYKQKCMNF---VRFSAGLRHNCRLGPRESFNLVTSTLDAGTTYSNSAHKLRELRTFEGGKLKMLPFFGNFGMEPLLPLNLENPNEGCIRPSEDIYCFLSGDPRVNEQTILAMLHTIFAREHNRIVIELSKVNPHWNDETLFQEARHIVAALQQQFSYNEFLPMILGSEEMKRYELELLSTGYFNGYDPKVNPSVTTAFTTAVFRFGHSLLPSKIERWS-KTHRFVDDQKLSSMLLQPYDLY-KQGWG-DSYLLGMINQVAQAMDDSITTEVQNHLFQAPGTKFGMDLLALNLQRGREHGLPAYTAFRDFCGLPRIVTFDDLRGSMPNETVNAYQRVYASPADIDLFSAGVAEWPVQGSMLGPTFACIMGKQFRSFRFGDRFWYENGGLPSSFTLEQLQEIRKIRLSRLICDNSDDIDSVQVYAMVL 688          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold491_size156641-processed-gene-0.8 (protein:Tk05480 transcript:snap_masked-scaffold491_size156641-processed-gene-0.8-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_301956")

HSP 1 Score: 311.612 bits (797), Expect = 1.866e-94
Identity = 182/536 (33.96%), Postives = 275/536 (51.31%), Query Frame = 0
Query:  102 KYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGPLPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVPNSHEA------KCCEGAKDDRCLPIRIYENDLFYSNFNVTCLNFYRSVRFCSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDGKGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNL---KYPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEISENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNT-GIDKISFLNLII 626
            +YR + G CNN  +P +GS      RFL P + D  S P  +         ++  PLP+AR VS+  H D        + ++  WG  + HD++    + +       KCCEG+    CLPI I  ND FYS  N  C+NF  S                                                D+G  + P +    F+ GD R    T LA +HT+ VREHN I+ +++Q+NP + +ET+FQETR I+ A+MQ+I Y+EFLP +LG+  M +  L L    Y  +Y   +NP+ ++ F  AA+RFGH+++   + R + K + Y  +  L +       Y+   G   +  L GL    AQ+ D  V +EVTN+LF   GK +G DL A  I RGR+HG+P Y  WREFCGL  +  ++     ++         +Y SP+DID+ +AG++E P+P S+LGPT  CIIG+QF  L+ GDR+++ + G   SFT +Q+  +R+  LSR++CD +  ID +    +++
Sbjct:    9 RYRSVTGLCNNLDHPHWGSAMNAHHRFLAPDFADGISAPRIS---------VTGRPLPSARAVSTAGHRDTGFHDHAVTILLVAWGQLMDHDITLTGETKDPRTGKTPKCCEGSTHPNCLPIEIPSNDKFYSKHNQRCMNFLES-----------------------------------------------PDEGC-IRPSEDVYCFLAGDGRVNEQTVLAIIHTMLVREHNEIATEMSQVNPHWNDETIFQETRHIMAAIMQHITYNEFLPMVLGKDVMGQLELVLLKDGYSDTYDPYVNPSASNAFSTAAFRFGHTLLPSTIERWS-KSHRYVGSQRLSEML--QQPYDLYKGGWADTYLLGLINQVAQAYDDSVTQEVTNHLFQEPGKKFGMDLAALNIQRGREHGIPGYNKWREFCGLPKVRSFDELLGLMTNFTVAGYSRVYDSPDDIDLWSAGISEKPLPGSMLGPTFACIIGKQFQTLRHGDRYWYENGGWPSSFTLEQLNEIRKMKLSRMLCDTSDDIDNLQVYAMVL 484          
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold274_size229011-snap-gene-1.21 (protein:Tk02572 transcript:maker-scaffold274_size229011-snap-gene-1.21-mRNA-1 annotation:"chorion peroxidase-like")

HSP 1 Score: 318.161 bits (814), Expect = 9.961e-94
Identity = 197/562 (35.05%), Postives = 293/562 (52.14%), Query Frame = 0
Query:  100 NMKYRMMNGQCNNPVNPLFGSQRYRLQRFLPPKYEDAESNPTENSQFKAREGCISSGP----LPNARKVSSTVHTDVDVPSTIASTMVSQWGMFVAHDLSFVP-----NSHEAKCCEGAKDDR-------CLPIRIYENDLFYSNFNVTCLNFYRSVRF----CSSTPREQYNEITSFIDASNVYGSSDEELLLLKEENSYLMKSTLTDDGKELLPKDG---------KGSFVGGDARALLTTGLASVHTLFVREHNRISRKLAQMNPSYTNETVFQETRRILGAMMQNIVYSEFLPTLLGEKSMNESGLNLK---YPSSYHEEINPTVASVFVAAAYRFGHSMIQRNVNRLAIKKYSYSSNYSLFKDFFNTANYEDRNGLGIEEILYGLTYFPAQSADRFVVKEVTNYLFNN-GKPYGADLEAKTILRGRDHGLPSYGDWREFCGLEPLCDWNNKPTEI-SENIWLLLKELYSSPNDIDIHTAGLAETPIPHSVLGPTNNCIIGRQFTALKDGDRFFFTHDGEAGSFTPKQVKALRQTSLSRVMCDNTGIDKISFLNLIIF 627
            N+++R ++G CNN  + ++G     LQR L P+YED  S P          G +S+ P    LP+ R VS  +  D D PS   + ++ QWG FV HD++  P     +     CC      R       C+PI I   D FY      C+ F RS+      C   PREQ N+IT+F+DASNVYGS   E  LL+      ++ T    G ELLP D          +  F  GDAR      L  +HTL++REHNRI  +L+ +N  + +E ++QE R+I+GA +Q+I ++E+LP +LG + M+++ L+     +   Y   I P++ + F  AA+RFGHS++Q  +    +      +   L +         ++N   I+  L GLT  P+Q  D     E+T++LF      +G DL A  + RGRDHG+P Y ++R+ CGL  L  W      + S  I   L+ LYSS  +ID+   G+ E     S++GPT  CIIG QF  LK GDRF+F    +  SF+  Q+ ALR++SL+R++CDN   D +  +  ++F
Sbjct:  233 NLEFRSVDGSCNNRQHSIWGQANIALQRLLHPQYEDGISRP---------RGQMSNDPTVSSLPSPRDVSEALVADHDKPSQEFTLLLMQWGQFVDHDMTHTPLVEGEDDSAILCCSNGNVVRGDLAHPECMPISISSTDSFYGRLGQQCMEFVRSMPARNAECHLGPREQVNQITAFLDASNVYGSETSEARLLRLGRRGRLRVT-QYGGSELLPLDPDECADHSKRQYCFAAGDARCNEQPQLTVMHTLWLREHNRIVSQLSLLNSQWDDERLYQEARKIVGAQLQHITFNEWLPLILGTRYMDDNNLSPSKSGFTQDYDPSIEPSITNAFATAAFRFGHSLVQGQIEWFGLFGNRLKA-LQLHRHQLEPFEIYEQNS--IDSFLRGLTTQPSQELDGSFSAELTDHLFQERNTSHGMDLVALNLQRGRDHGIPGYMEYRKLCGLPRLTTWREIVNVVASPEIVPRLQRLYSSIEEIDLFLGGMLERGTSGSLVGPTFQCIIGDQFKRLKFGDRFWFEEGNQPNSFSLDQLNALRESSLARIICDNG--DNMQQVQPLVF 779          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000004874 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-5.676e-8835.99symbol:Epx "eosinophil peroxidase" species:10116 "... [more]
-6.149e-8835.15symbol:CG10211 species:7227 "Drosophila melanogast... [more]
-4.313e-8733.98symbol:CELE_T06D8.10 "Protein T06D8.10" species:62... [more]
-1.549e-8634.18symbol:F1P3V5 "Uncharacterized protein" species:90... [more]
-2.152e-8635.69symbol:Epx "eosinophil peroxidase" species:10090 "... [more]
-3.637e-8635.74symbol:MPO "Uncharacterized protein" species:9913 ... [more]
-8.304e-8635.58symbol:MPO "Uncharacterized protein" species:9823 ... [more]
-8.815e-8635.51symbol:EPX "Eosinophil peroxidase" species:9606 "H... [more]
-1.073e-8535.58symbol:MPO "Uncharacterized protein" species:9823 ... [more]
-1.343e-8535.11symbol:TPO "Uncharacterized protein" species:9031 ... [more]

Pages

back to top
BLAST of EMLSAG00000004874 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592868597|gb|GAXK01088965.1|6.988e-13241.39TSA: Calanus finmarchicus comp317474_c0_seq1 trans... [more]
gi|592809132|gb|GAXK01145436.1|1.734e-12739.90TSA: Calanus finmarchicus comp776431_c1_seq18 tran... [more]
gi|592905048|gb|GAXK01053327.1|3.753e-12040.11TSA: Calanus finmarchicus comp354079_c1_seq1 trans... [more]
gi|592862030|gb|GAXK01095532.1|2.104e-11938.73TSA: Calanus finmarchicus comp200197_c0_seq3 trans... [more]
gi|592862031|gb|GAXK01095531.1|9.530e-10836.10TSA: Calanus finmarchicus comp200197_c0_seq2 trans... [more]
gi|592819638|gb|GAXK01134930.1|5.327e-10535.18TSA: Calanus finmarchicus comp370050_c1_seq1 trans... [more]
gi|592771697|gb|GAXK01182871.1|6.613e-10437.70TSA: Calanus finmarchicus comp289283_c1_seq1 trans... [more]
gi|592832441|gb|GAXK01125103.1|4.622e-10037.04TSA: Calanus finmarchicus comp24549_c0_seq1 transc... [more]
gi|592781681|gb|GAXK01172887.1|5.801e-9636.22TSA: Calanus finmarchicus comp132241_c1_seq2 trans... [more]
gi|592781677|gb|GAXK01172891.1|6.008e-9636.22TSA: Calanus finmarchicus comp132241_c2_seq2 trans... [more]

Pages

back to top
BLAST of EMLSAG00000004874 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 22
Match NameE-valueIdentityDescription
EMLSAP000000048740.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s256:60807... [more]
EMLSAP000000130356.855e-15646.82pep:novel supercontig:LSalAtl2s:LSalAtl2s99:469219... [more]
EMLSAP000000050191.308e-14149.77pep:novel supercontig:LSalAtl2s:LSalAtl2s260:72996... [more]
EMLSAP000000010699.758e-10236.63pep:novel supercontig:LSalAtl2s:LSalAtl2s117:10710... [more]
EMLSAP000000098392.001e-9235.75pep:novel supercontig:LSalAtl2s:LSalAtl2s63:110605... [more]
EMLSAP000000006482.360e-8633.90pep:novel supercontig:LSalAtl2s:LSalAtl2s10:912782... [more]
EMLSAP000000011161.260e-8233.57pep:novel supercontig:LSalAtl2s:LSalAtl2s1186:3242... [more]
EMLSAP000000032463.558e-8137.55pep:novel supercontig:LSalAtl2s:LSalAtl2s178:29948... [more]
EMLSAP000000029391.659e-7634.27pep:novel supercontig:LSalAtl2s:LSalAtl2s168:43092... [more]
EMLSAP000000062204.567e-7533.98pep:novel supercontig:LSalAtl2s:LSalAtl2s33:28635:... [more]

Pages

back to top
BLAST of EMLSAG00000004874 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|341941244|sp|P49290.2|PERE_MOUSE3.164e-8735.69RecName: Full=Eosinophil peroxidase; Short=EPO; Co... [more]
gi|1352738|sp|P11678.2|PERE_HUMAN1.357e-8635.51RecName: Full=Eosinophil peroxidase; Short=EPO; Co... [more]
gi|81901688|sp|Q8R481.1|PERL_MESAU1.617e-8635.54RecName: Full=Lactoperoxidase; Short=LPO; AltName:... [more]
gi|341941245|sp|P11247.2|PERM_MOUSE6.702e-8534.72RecName: Full=Myeloperoxidase; Short=MPO; Contains... [more]
gi|129825|sp|P05164.1|PERM_HUMAN3.565e-8335.21RecName: Full=Myeloperoxidase; Short=MPO; Contains... [more]
gi|229462993|sp|Q9VEG6.3|PERC_DROME4.711e-8333.05RecName: Full=Chorion peroxidase; AltName: Full=Pe... [more]
gi|129831|sp|P09933.1|PERT_PIG1.595e-8232.13RecName: Full=Thyroid peroxidase; Short=TPO; Flags... [more]
gi|172048149|sp|A8WQH2.1|PXDN_CAEBR2.617e-8234.81RecName: Full=Peroxidasin homolog; Flags: Precurso... [more]
gi|122119348|sp|Q1ENI8.1|PXDN_CAEEL3.945e-8134.04RecName: Full=Peroxidasin homolog; Flags: Precurso... [more]
gi|172044151|sp|A4IGL7.1|PXDN_XENTR9.411e-8136.22RecName: Full=Peroxidasin; Flags: Precursor[more]

Pages

back to top
BLAST of EMLSAG00000004874 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
EEB12501.14.289e-10938.17Chorion peroxidase precursor, putative [Pediculus ... [more]
EFX77941.18.611e-10637.79hypothetical protein DAPPUDRAFT_320790 [Daphnia pu... [more]
gb|EEC10299.1|1.526e-10535.93peroxinectin, putative [Ixodes scapularis][more]
EFX84548.11.441e-10137.68hypothetical protein DAPPUDRAFT_314899 [Daphnia pu... [more]
gb|EEC15885.1|2.885e-10135.85peroxinectin, putative [Ixodes scapularis][more]
gb|KFM65699.1|2.154e-10036.30Chorion peroxidase, partial [Stegodyphus mimosarum... [more]
EFX81795.16.144e-10036.31hypothetical protein DAPPUDRAFT_196036 [Daphnia pu... [more]
gb|EFA05698.1|2.202e-9834.91Chorion peroxidase-like Protein [Tribolium castane... [more]
EEB10263.12.454e-9836.01conserved hypothetical protein [Pediculus humanus ... [more]
EFX80390.15.056e-9731.67hypothetical protein DAPPUDRAFT_318553 [Daphnia pu... [more]

Pages

back to top
BLAST of EMLSAG00000004874 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|1061479604|gb|ODM97104.1|3.133e-11037.71Chorion peroxidase [Orchesella cincta][more]
gi|1061476447|gb|ODM94302.1|6.764e-10937.17Peroxidasin [Orchesella cincta][more]
gi|936713994|ref|XP_014234958.1|8.523e-10936.06PREDICTED: peroxidase-like [Trichogramma pretiosum... [more]
gi|942313989|gb|JAN38927.1|1.359e-10835.50Chorion peroxidase precursor [Daphnia magna][more]
gi|1126170981|ref|XP_019617513.1|3.593e-10839.43PREDICTED: thyroid peroxidase-like [Branchiostoma ... [more]
gi|942332997|gb|JAN48431.1|3.702e-10737.52Chorion peroxidase precursor, partial [Daphnia mag... [more]
gi|942308717|gb|JAN36291.1|9.726e-10735.19Chorion peroxidase precursor [Daphnia magna][more]
gi|1000745679|ref|XP_015595582.1|1.009e-10637.41PREDICTED: uncharacterized protein LOC107267903 is... [more]
gi|1061473741|gb|ODM92097.1|1.009e-10636.41Chorion peroxidase [Orchesella cincta][more]
gi|242008911|ref|XP_002425239.1|2.098e-10638.17Chorion peroxidase precursor, putative [Pediculus ... [more]

Pages

back to top
BLAST of EMLSAG00000004874 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 22
Match NameE-valueIdentityDescription
maker-scaffold160_size295910-snap-gene-1.351.099e-14142.83protein:Tk01231 transcript:maker-scaffold160_size2... [more]
snap_masked-scaffold809_size94238-processed-gene-0.82.749e-11739.23protein:Tk02707 transcript:snap_masked-scaffold809... [more]
maker-scaffold319_size207808-snap-gene-1.163.430e-11240.38protein:Tk00372 transcript:maker-scaffold319_size2... [more]
maker-scaffold370_size193435-snap-gene-0.406.680e-10536.71protein:Tk07792 transcript:maker-scaffold370_size1... [more]
snap_masked-scaffold801_size95070-processed-gene-0.14.742e-10234.34protein:Tk01646 transcript:snap_masked-scaffold801... [more]
maker-scaffold292_size219010-snap-gene-1.414.380e-9636.51protein:Tk00329 transcript:maker-scaffold292_size2... [more]
snap_masked-scaffold181_size278858-processed-gene-1.256.038e-9533.81protein:Tk08516 transcript:snap_masked-scaffold181... [more]
snap_masked-scaffold181_size278858-processed-gene-1.126.038e-9533.81protein:Tk08509 transcript:snap_masked-scaffold181... [more]
snap_masked-scaffold491_size156641-processed-gene-0.81.866e-9433.96protein:Tk05480 transcript:snap_masked-scaffold491... [more]
maker-scaffold274_size229011-snap-gene-1.219.961e-9435.05protein:Tk02572 transcript:maker-scaffold274_size2... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s256supercontigLSalAtl2s256:608070..622038 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s256-snap-gene-6.24
Biotypeprotein_coding
EvidenceIEA
NoteEosinophil peroxidase
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000004874 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000004874EMLSAT00000004874-700721Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s256:608070..622038-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000004874-687640 ID=EMLSAG00000004874-687640|Name=EMLSAG00000004874|organism=Lepeophtheirus salmonis|type=gene|length=13969bp|location=Sequence derived from alignment at LSalAtl2s256:608070..622038- (Lepeophtheirus salmonis)
ATGTTTGGAGTTAAGGAACAAATGTCTTTACTATGCATATGTCTCTATAT TGTTAAAGTCTACGGAGAAGGCTGTCCATTTGCATCTTCGGCTAATGATG AAAAAAAACTTTTAGATCAGGCAAATGTCAAGGATGTAGACTATCATAAA TTGCTTCAGAAAGGAAGACAAGTAACGCCAAAGTAAGTTACAAATATTAA TAGATGGTCAAAATATAACCAGTTGTCATAGGAAATAAATGTATAGAAAG GTTACGACGTTACCTCGGAGACACAAAATATTAGGTTGGGGAATAAGCTC GTTGCGTTTTGATCGAAAAAAATATTTAAAGAAAAAATAGTTATAACAAT TAATTAATTGATGATGTATTCGACATTATTATTCACGACCTTTTCCTCAC CTATCAACCAATTTTTCGATGCCGTTCCGCCAAAAATCGTCTGGTCTGGA ATTGAAGAAGTTGTTGAGCTATTTTTCAAAGTCCTCTCCATTCTCGAATG AAACAGTTATCAAACGGTTCGACAGAGTGCGGAAAAGATGGCAATCCGTA GGTGCAAGGTCCAGAGAATACGGTTGATGCTGAAGAACCTCCCACTCGAG TTTTACAAGTGAAACTTTGACGAATTTTGCAATATGGGCCTGGTGTTGTC GTGAATGAGTATGGTATGGCCTTGTCGATTAGGTCTTTTCAGTCGCATAG CCTCTTTGACACGGGGTAGCTAGGCTATGTAGAGCTTTTTGGTGACCTTG GCATTTCTTTCAAGCATTTGCCAATATACTTTGGCCTTCCCATACCAACG TTCAGTATGTCTTCCACTTTGGCATGAGACGTCGATGTCAAAATCGAAAT TTTTAATTTTGCGAACCATTTATGTACTGTAAACTCAGCTACGATACCTT CGTGCTACAAATGTTTCGTACTGTTCGGCAGTTTTTTGCCCTCGAGGAAA GTGTTGATTTTTGTCTCCTGGATACTTCATTTCTAAGACTCAAAAGTAGT TAATATTTGAATGAATTTAAAAAAATATTAATATAAGAGAAAGAGCCTTA TCAAATTTATATTATAAATTTTTTCAAAGAGCAAAAAAATTAGTGCAAAA CAAACGTAACATAAAAACGCAACGAGCATATTCCACAACCTAATGTATTA CCGTATTCAGTTGTCGATGTATCTACTTCTTTTTGTCGAATCAGTGTTCT AATTTAATTATAATTTGCTCTTGTTATCCAGAGAACACTATTCAACAGTT ATTAAATAATAGTTCTATAGAATTGGTAAACTACCAACTGATTTTTGAAC TTTTTTCGATTTATTTTGTTGTGAAGGTGTAAAAGTAACGACGTACTTAA ATTACTCGTTGACACTTTCCACGTTCGTTTGTTCACTTTTTAAGCAAAAC GAGAACCATCTGATCATATTTTGGCTAAATGCAGTTGTGTACGACAAAAA TATCTTGGCGAGAGGTAACAGAGATGACGTGTTTTTACCATTCGGCTTAT GCATTTTTTTCCCCCTTTGCAGAATTAACTTTGTAAATTCATGGAGGTTG CATAGTTAATTATAGAGTAAAAAAGTATCCTCTTTGCCAACTAAACTTAG AAAAGCATAAATCACGTGCTTGTCGTTTCGCCATTTGATTTAAGGGTTAA AATGTGTCATTGAGGAACATGAAATAAGACCAAATAAGTTTTATCAGTTG AGACACTCAGGCTTTCAAAATGAACGGTACTTATTTTCCGCTAAATATCC AAGCCTACTACACACTTCTTGCCTTCGAATAACTAAAAAGTTAACAACAA GTTATTAATTATGTTTTTTTTTTTAGTTCTCTCAAAATGTCTCGAAGAAA TATATTTGTTGACAAAACGGTAAACAGATTGGTGAAAAAAGGTTATTCAA GAGACTCTGCACATCAAAAGGTAATCCAACTAATAAAAGATATTGAGTAT GAGCTTGAGGAATGCAAAGGAACAATGCCAGATTGTGACCCAAACATGAA GTATCGGATGATGAATGGACAATGTAATAACCCTGTTAATCCTTTGTTTG GGTCTCAGAGATACAGGCTGCAACGTTTTTTGCCACCTAAATACGAGGAT GCGGAATCAAACCCAACTGAAAACAGTCAATTTAAAGCTAGAGGTTGGAT TTAAAAATAATACATAACATTAATTTCGTATTACTCATACAGTTATTTTG TCTCCTTCTTAGAGGGATGTATTTCTAGTGGTCCTCTACCAAATGCAAGA AAAGTCAGTTCAACAGTGCATACTGATGTGGATGTTCCTTCGACGATTGC GTCTACTATGGTAAGCCAATGGGGAATGTTTGTTGCCCATGATTTGTCCT TTGTTCCCAATTCCCACGAGGCTAAATGCTGTGAAGGAGCAAAGGATGAC AGATGCCTTCCGATTAGAATATATGAAAATGACCTTTTCTATTCAAATTT CAATGTGACATGTTTGAATTTTTATCGATCTGTCAGATTTTGCAGTTCAA CTCCAAGGGAACAGTATAATGAAATTACTTCCTTTATTGATGCTTCCAAT GTCTATGGCTCAAGCGACGAGGAATTATTGCTACTCAAGGAAGAAAATTC TTACTTAATGAAGAGTACGCTGACTGATGATGGAAAAGAACTCCTTCCCA AAGATGGTAAAGGTAGTTTTGTGGGAGGAGACGCTAGAGCTCTTCTAACC ACTGGTTTGGCTTCAGTTCATACCTTATTCGTTCGGGAACATAATCGAAT ATCAAGGAAACTTGCTCAGATGAATCCTTCATACACAAACGAAACTGTTT TTCAAGAAACTCGGCGAATATTGGGAGCAATGATGCAAAATATTGTTTAT AGTGAATTTCTTCCGACGTTATTAGGGGAAAAAAGCATGAATGAGTCTGG CTTAAACTTAAAATACCCCTCGAGTTATCATGAAGAAATTAATCCAACTG TCGCCTCTGTTTTCGTTGCTGCTGCATACAGATTTGGCCATTCCATGATT CAAAGGAATGTGAATCGATTGGCTATAAAAAAATATAGCTATAGCAGTAA TTATTCCTTATTTAAGGACTTTTTTAATACGGCAAATTACGAGGATAGGA ATGGGCTAGGAATAGAAGAAATTTTATATGGGTTGACCTATTTCCCAGCA CAATCTGCAGACCGTTTTGTTGTAAAAGAAGTAACTAATTATTTGTTCAA TAATGGAAAGCCGTATGGAGCAGATCTTGAAGCAAAAACGATTTTGAGGG GTCGAGATCATGGATTACCCTCTTATGGAGATTGGCGAGAATTCTGTGGC TTAGAACCACTTTGTGACTGGAACAATAAACCAACAGAAATTTCAGAAAA TATCTGGCTTCTTCTCAAAGAGTTATATTCAAGTCCTAATGACATCGATA TTCACACAGCAGGACTTGCAGAAACTCCAATTCCACACTCTGTCTTGGGG CCCACCAATAATTGCATAATTGGACGTCAATTTACCGCTCTAAAAGATGG AGATCGGTTCTTTTTCACACACGATGGTGAAGCTGGTTCCTTTACCCCAA AACAAGTCAAGGCACTTCGTCAAACATCCCTCTCACGTGTCATGTGTGAT AACACAGGGATTGATAAGATAAGTGTAAATGTTTTCAGGACCGATTCCCA ATTTGTACCTTGTTCAAGTCTCCCTGAGTTGAATCTTAATTTATTCTAAA TCATGTCAATTCTTAAAATCATTTGGTCAAACATGATTAGGACTATTATT TAAGTAAATAAAGCATTTTTGGTTCATGCCTAGAAAATATTTTAATATGT ATATGGTTGTAAATAATTTATTTTAATGTTATCATTTCAAGGTGTATAAT TTTTATTCTACTTACCTATTTGTGAATAGCTTTCAATAAAATTCCGTTCC GGNAATGTTTATATAATGCATGATCATGAATTGATATAAGTGTTGAGTAG TTACGGGTGAGTTAGTCTCAAGAAAAACGGAGACTAACACTGAGGATTTC ATGGGGAGTTATTTTCTATTTTATAAAACTATAATTATAAATTATAACAC CATGGAATAAAATTAAAGCCTTGGATATCCCACTCCCTTAAACCCAAATT TATAATTGTTATATAAACCGTAAAAAATAAAAATGACCATTATAACCTTC AATCACAATAAGTTTAGCCTTATATATATATTTTTATTTTTTTGAATCAC GTTTTAGATTTATAATATCGATTTAGAATCATATTTTTACGGTAAATAAC AAATATAGATGAATATTGAAGGTAATAGCAATTGATAAAAAACCTTCAGA CATTCAGAAGAGAAAATATTTATTAAGTTATCTTGAATACAGATCGTCAC TTGGTTTTAGCTTTAGTCCTGTGGTAAGAGTTAAATTTGTAACCAAAAGA AAGGAACGAAAAAATAAACAGCTAAAATAACCCCTTGCAATGTGTTGTTT TTTTCGTTCAGGTGCTCAAAAATTAGTGGAAACATGAGCGACGCTCATTT TCCGCTCAATATCTAAGTCTGATTTAGTTTTAATTCAGTATACAAAAGTG TGTTTTCTTTGGAGTCTTTCCGAATATTTGTATACTTGATTTGTATAACA AATAAAAATCAATACCATTTGTTTAGGAACTAGGGTAAATAAAGCTTGTT TGGACTCGTTGGGGTTACAATGTCAAAAACTAACTCTTTGCACGCTTATT ATTTTTAATTCAAAAATAAAGAACTCCATATCTTTGAAAAAAATCATTTG ACTCTTAAAAAAGAATAGATTTGGAGTTTGGAGCTTTTAAAAAAAAACAT GCAATGTCCCTATAACGGTTTTGGTGCAGGTAGCTGACGTATTGTTGTGA CGTTGGATGACTTAACATTAATAGTCAAATAAATAGTACCTGGCGAAAAA ATATTGTGGTCCAGACCCACTTTCCCCGCCTGGTAAATATGACCCCAGTA TGTACAGGTCTGTCGAGAATGAGAGTCCCATTATCTTTAACGTCATTAAA TTAAAAGTATTGTGTGCAGAGATTTTTTTACCCAAGTCCAAAATATATGT AGGATGGATCTTATACTGCGTTATACTGAAAATGATGTGCAAAAATGGTG CAAACACCATTTTGAACGCTTTAAGGACCAAACTTTTTGCGTCTCTCTTC ATCTAATAATGCGGATTGTAGTAAAAAGGGAGGCCAATTCAGTTTTCAAG GTCAGAAAGTACTCCTTGATGGCAGCTGCGGAAGTCAAATTTGCAAAAAT ATCGGATGGCGTTGTGCGTACTAACTATAAGTAATTGAGAAGGCGTCGCT CCGAAGCTTTTTCAGTTGTTTTTCTATAGTACTCTAATTCTGGAAGCCCC TGTATTCTAGATTTAAAACAATTCAGAGTTGTTAAAATCAAATCTTTAGG GTGATTTGATATGGAATTACCCTAATATAATAAATTACTTCAAAAATGAA TGTAAAATATAAGGTTCTTGTATATTCTGCTCATTTATTATAAAAAATCG CACCTAGAGATTTCTGGTTCGACAACAAGATATTTAATATATTATTTCGA ACTTGGAGGTATTACAAAAAAAAAATACTTGATATTCTTTCTTAATAAAG GTATCAAATTACATGTTATTCTATGATTATTTTTTTTGTTATTACTCACT TAGTGCTATCTAACAAAAGCTTGACTTTGGTGCAATTCTAAATCTTTAAG TCAAATAGTTTATTGTTTGTTTAACAAAGTAACATTGCCTATAGGTACTT TTTTTAGAAAATAATCATTAATGCTGGAGTTTCCATTAGTATGTTTATAA AGGATTTTTTTATATATCCAGAATAATTCATAAATCAATTACTTATTATT TCCATTTAAGATTAATTACAATAAAAAATCATTCAATGCAGTTCCTTAAT CTGATCATTTTTGTCTCTATGTTCAAAGGTTTGTATTGCTCAAGGAGCAC ACATGGAGGATTCCGTATTGTTGAAGGAAAAGATGCAGGAAATTTTTCGG ACTTTGTTGTTGGATTTTTTTTTATTGTACCAAAGTGAGTAGTAAAAAAA AAAAAACATAAAAACAATTTACTCTTTCTATAAGTAGTAATATTCTTTGA AATTTACATTAGTAAAGTGTGTTCGGCCAGTATTGTGTCCTCAAGATTTG TCGTCAGTGCTGTTCACTGCCTCAGAGAAAATGGAAATCCTATTTATGTC GACTCTTCTTGTCGTACCAAAGCTCCAAAGAATGTACAACCAAAGATAAA AAGCTGTAGGCTTACAAGAAATGGAGACACTCGGATCCGTGTTTGGAGAA GGGGGGCGTGGATCGTAAGGAAATCAAGAGATCTCACAAATCCATTTTCA GGTTAGTTATAACCACGTTTCGCTAAATGTGTGTGTTTTATGTAGATTCC GAGATCAAATTGCAATGGTATTTCAAATTCTGTTTGATTTTTCATGCTCT AGAGTAACTTTTTATACACCTGGAGTAAATTTATCACTGAGACGTAAATT TAGATATTTTATGGGGTAAAAGTTAGTCTAAAATATGAAATAATAAATAC TTGTTAAATAAAATTGTCACTCATTGAGATTAAATTGAGTGATGAAGTTA TACTTCAGGGCGCTGCTATTGCATGATTACATATCAGCTGTTTCTGGAAT AATTTATTATGTTTGTTTTTGAATTTTATAGTAAGATTTTTTTAAAGATA TATATGTAGCAAAAAGTTCCCCCCAGCAAGTGTTGGCATGAACTCAAGTG ACAACAGCGAACTCAAGTAATCTATAATTATACTATGCAACAAAGTTCAG TTATTGGAACGCCCACAGGCTAAAACGCACATGTGTAATTGCTATTTAAG CCATAAAATTCGAAATGATCTTCAAAAAATTTCAATAGCAATACGTTTGG CCTTTAAAGCCTTATATTAAAAATTTTGTTTTTAGAGTATAATTTCGATT CAAAGACATATTACGAAATGAAATAGCTATATACATGAAAATTAAAGATA ATAACAATTGATATGATATTTATTGAGCTATCTTGAATAGAATTTTCTAC AAAATGGGAAATTAAATATAATTAAGTCAATTATATGAATAATTGTAAAA AGCAATGAATATTTTAGAGGGGGTAAAAGGTCAGAAATTAAATATAAATA AGTCAATTAAATTACNTTACATCTAATTTATAAATATGAATCAAATCATT CTTATAAATAGGCCCTGTATTTAAATTTGAACGCCCTTGAAAGTCTCATT TAGTCTCTTATCATCTTTTTTTATTATTGGATAAGTTTCTTCTACGATAA CATTGTTTTTTGCAGGTTACATACACTATATCAAGTATATTTATCGACCC AAAGGCTCTTACTATGGAGGTGAATACAATATTAGAGGAGGATACGACAT TGTACTTCTGAAGCTGGAAAGAGGATCAACCATCAAGGACTACCTCAAAG AACCATTAAGAGGTTTTACATTTGAAAGATTGAACATTCCCTCACCAGAT TTTCAAGTATTTAATTTAATTTATATATAGTATTAATTTTTATTGAAAAA AAAAATGTATGCACCTATTGAAAAATATTCTATAAATGGAACACGCATTC TTATGTTGAATGCCTTAAGGAATTGAAATAATGTAATGTAAATGTATCTA ATTGTTTTAAGAAGTTATTTTTTTTTCTGAAGACAGGCACAACTATTATT CTACTAGTGGTAGTACCGGTATTGCCCGGAGTTATTAGACGTCGTTGAAT AGACAAATTTTGCTTTAATAATATAAAAGATAACTCCCATAGAACCCCTT AGTGTTATCTGTTTTTCATGAGTACACTCAAACGTAGTTACTCAATACTT AAATGATCTTCCGTTAAGAATGAAAAAATAATAATAACATCTTGAGAAAA AAAATCATATGACTTGATGAGCCAACAGTACTTTAGTCTCTAGAGCTCTC CCAGGCTGAGCTTTAAGTACACACATTCGCTGTTAAAAATTATTCCTCAA CTCATATTTTATAGTATAGCCAGGGTTTTGTAAATTATTGAGTTGACGTA AACGCCTTCAAGATTTCATTCTTATACAACTCCAAACTACGTATTAGTTA TGAAAATCCTTGAAGAATGTTTTGGAGAAAATAAAATCAGTTTTGACAAG GGGGGAGGGGGAGAAAGAAATAAACAAAGACATTGTCAACAATTACTCCG ATGTCAATCCCCAATTGTACTCTGAGTCTTACACATATAACTCAATAACA AATCCTCAAGGTTACTCTCCGTCTGTTATGAGAACACAAGAATGCACGAA CACAAAATCTAAATATTTAAAAAAAGGAGTGTATGTTCCATATATAGAGT ATTCCTTGGTCTATTACCACTAAAGAAGCTAATTGTGTAAAGAAAAACTA AGTATATCGATTAGAAAAGGAAAACGGTTGATGCGTGTCCTCTTCTTCTT TTTTGTTCATTATTTAATAAGTAATGTGCGTGATAACATCTCTCTCTAAA AGAAGAATTATTCCCTATCTTTGGTCTAAATTGATTTAAAAATATATGAC ACCAGGGACGTCGTCAGGAGATAGGCTGGCGGGGATATATCCCTACCCCC TCCCCCATTAAATCATTCTTGTTCTTTACAAAAAAATTAAATATTTGAAA TTTTGTTTCAAAAAATTTAATTTTTTGTGAATAGCTGTAGATTATTGAAA TTTAACTTCCAAAAAATTTAATATATGAAATTTTTTTCCAAACAAAATCA AATTTTGGGGAACATCTCTCGATTTTGGAAAAAAAAATCAAAAAATTTAA TATTTGAAATGAAATTTTTCAAATTACTTTACAGAAAAACTTAATTTTTG ATTTTTTGTTCAAAAAATTCCAAAAACCAAGTCCAAAAGTAAAATTTATA ATCCTGCGGACGTTCTGAATAAAATAATATTATAATATTTTCCCTACACT AATTTTTAAATGAAGCTTAAAATTAGCTTCATTTCCCCCTCCAAAATCAT ATAATAGGCAGCTGGTATTAACATGGGTATTCATTTGGTAATACCATTAG TCTCGCTCCCGCCTTTTCATCACGTTCTTACAAAAAAAAACATCTAAAAT TGTCACATTCTTTCAGAGCGATGATAAAAATTTAGCCACAGTAATTGGAT ACGGTGACGCTCGAAGAACACCTTGTGAAGTAGATGACAATGGTCCATCA AAATTTAACTATTGTGGTGTTGAGAAAAATTGTAACATCATGCAAAACGG ATCTTGCCATGTTATTTTTGAATATAATGGACAAAAGCATATGGGTTGTC AATTTAGTTCCACCCCAGCAATTGAGTCAAAGTTATGTACAAAATTCCTG GAAGGTTATAAGATAAATTAATATTTCAATAATAAAGCCTTACTTACCAT CCACATATTAATTAGTTATTAATAGTCCAAAAAAGATTAAATTTAAAAAG GATTTTGATGGTACTAGAAATATTTCCATAGGAAAATTGACCGACATCAA CTAATAATTAATTTTACAAATTTTGTTCTTGCTTATAAAATCTAAACAAA CCGAATTTTAATTTTATTAGGTCTATGCAGAATAAAAATACGCTGGAGGG GAAGGCAACCCCAATATATTATAAAGTAGGTACGTACTTATGTATTCTAC ATAAATGCCAACTGGGGAAGGGCAAAAATCGCCTAAATAATATAGTTTTT ACCCTTCGTCATTTATTCGTTCATTGAGGACATTCAAATTTGGTAAGATT TACAAAAGTCCGAGACCTTAATACACGCCCATATGTTGTAATCGAAAAGG TTCAGATCATGAGAGAATGTAGACCAAAAGTATCTCATTTTCATCCAAAA AAGATTAGGTTAGTTTAGAAATGTGGAAAAGGATCTTATCCTACATATAT ATATACTTAGTCGGATTTAGCAGTAACGTTTTTCATTCACGGAATGAGTG TATTAATATGTAGCAAATCAATATATGAGACTAATTGTTTTTATGGGAAT GGGAACGAAGACTGTCTTTAATTCTTAAAACTACGATATTATTGATCCGA TACCGGCTGTTTTGATGTCATTGGTCCCCAATGAGGTTTTCTTCGTTTAA ACGTCATTTTATTTGATGTACCGTTGACCAGACCCTAAAAAAATCATACA AAAAGTGTGTTCTAATTATATTTACACTCGGTAGAACAATCAAACAGCTA AATATAATATGCAGTACAAATGCCCTAATTAATTATCAAGAAAAAACTGG GCCTAATATCTTCCAAATTAATATCTTTTAAGCACTTTAAAATACGGCAA TTTTTAGATAAAAAACGTTCCTCTTTCAAATATTAATTTTTTTCCATTGT ACAAGCTACTTTAGTTTGGAAAAAATGGTATTTTTGTGTCAAAAATGGCC ACTTTAGGCCTATAGTACCATCTAAAATATTACACTATGAGTAAAAAATG GATTTTGTTTATTTATAGTATTCGGTTCATCAGTTAAAAATATTGTGCAC CTTCTTTGTAATCTTTTAAGGGTTCTAAAATGTACTCAATGATCTAGGGT TTCCCTGTTATATCAAACATAACAACCCAAAATGTAACCTTACTTGACGT GATAGTTGTAGAGCAGGATGAACAATATCTTAAGCTATGTTATTGTATAT GAAGGATTACATTACAATAATCATTTAATTTATTTCAGCTGTAGAGAACA AATCCATTTTGAAAGAGACGGAAGTATTCCTTTTTCGATCCAGCGGTAAT AATACTTATCAACCATTAACAAAATGCTTTGCAACAAATCCCTCTAAGTT TGGATGGTGTGGAACAGTTTTACTCACAAATGTCGATAAGCCTGATAAAG TATCTGACATTTATGCATCAAAATATAATGTAAGACCTGAGAATGGATGG GGCTTCTGCTCAAAATCTTGTTTCAGAGGTTACAAACATCAGCAAACAAG TGATAATAATCATTCTGGCTCTGGCAAACTGAGATACAACAAACGAAATG TTTTAAATAGTGAATACTGCTACAAAGAGTTGTATGCTCGTCTGAAACAA GGATTTGGTAAAGAGAAGTTTCTCTATGAGCCCCATATTCTATGCTTTGC ACGTAATATGACTTTCAAGACCAGATACTTTGAATTTGATGGTAAACGAA TAATTCATGAAGCTAAAGAGCCCAGTGTTGCTCTTCGACAGACGTTTGGA AGAGAGTCTAATTGGTATATTTCTCATCCGGGTGGGTACTTGAATTTACT TATTATTAAGAGATATGCAAGTATATTAGAAAATTGATTCAAAAGATGAT GCATAGGTATATGCTACGGAGATTCTGGAGGTCCTTTAATTCGAACAATA CGAAAAGGATTCAGAAGAATTCATATTTTATTAGGTATTGCAAGTAAAGG ACAAGGGATACATGGTCATTGTGGAGGGAGTTCCACTCTTGCACATTTTG TGCGAATCAAGAACTTTTCTGGTTGGCTACTCTCTTATATCAGAGATGAT CCAGGAGTCAGAGTGTTTCCTTCAGAAATGACTTTAGAGGACCTTGAGAA GTTCAAAGATTCAAATATCATGAATGAGAAAAGTTTTTATTCTTGGTTTA TTCGATTTGGAAAAGTATTTAGGAGTAAGACATCAAATTTAATGCCTAGG TTCCACAATAAATTAGAACAAAGAACCAAACGAGACGACCAAAATATATT TAATGTTTTAGTTAATCGTTTATCCTATAATAATTTATCAAGCTCCGAGG TGATCATGCAGTACATTGATGCAATTGATGCCATGACGACAACAGGTTAC CAATCATTCACAAGCAAGTATGGGCATATCGTATAAATATTTGCATAGAT CTTTCTATAGCAAAACTGATCAAATTCGGACTAAATGGGGTATTGCTGTA CTTTAAAAAATGAAATTGTAATTAGAACCCTGACTAATTTACAAAATCGA TTTTTATTTGCCAATTTTTTTTTAAATAATTGTCTTTCATCCCAAAATTA TGAGCCAAATAATTTGACAGATTCAAAATATATAATTGAAAATTCATATG GTATTATTAAAATAAATATCTTATTAGTAATGTGAATTTTAATTGCAAAT TAACTTAGAATAGTGCGTTTTCTTGTGACGTCAGCATTGTTGATTTCGGC CATCTTAAGACCCTAAACATTCAAGTTTTATTTGAATGCAAGCACTTTTT TTATTAGTATTAAGGAAAATGATAAACTATTGCCGTGTATTTGGATATCA AAATGTTACTGACAAATAAAAGGGCTTGAACCTTTATTGTCTATCAAAAA TCTAACTTTCGAGATTTATTATATACCAGAACCTAATATGTATTATAAAT ATATTATTCTAGTATTATACATTTTTATTTCTATAATGTAGGCAATAGAT TAATATATTTTTATCCAATTACCCATGGATACCAGATACCATTTCTTTAG TATCCATGAAGTATACTACTTTTATCTTCCCTTATCGTTTCAAAACAAGA TTAATTGTACAAATCTATCCATTTCATTAGGATTTTTAGTATTTCTTGGA TTTTATTTCGATTTAGTTCAAATACAATTGTTTAGTTGTTAAGTATTTTC TTATTATATGCCATTTTATTAAGTTTAATAATAAAAAATTATTGGAATTT CTATGTAATTGGCGGTGTCAGTGAAAACACTCTATTGAAGAGGTCCGGTA ACTTTTTTCAGCACTAACACAAAAGAAATTTTTAATTAAATTGAATTTAC ACCAAATTAGTACCGGGTCATCGGAGGATTATATATATATATATTTTTAG GGGGAAAGGCTTAGTTTTTGGAATTTTTTTGAAAAAAAAAATCCAAAAAC CCATATGTATGAAAAAGAAAAGTAATTTAAAAAAAAAATCCAAAAATCCC TAGCTGTTAACAAAAAAATGAATTTTTTTGAAAACAATTTCGAAAATTAA ATTTTATATTAAATTTTTTTGGGAAAAAAATTTATAAAACCATAATTATT TAGAGAAAGTTACATTTTTTGGAAAAAAAATCGAAAAGTTAAATATTTTT GGAAAAAAATTGAAAAATTAAATTTTTTGAAAAAACATTCAAATATTACA TTTTTTGGGGGGAAAAATCAAAAAGCCATAACTCTTCACAAAAAAATACA TTTTCATCCCTAATTTTGCGTAAACTTTTTTCATCCTGACAAAAAATATT ATAGTAAAAAGCAAAAATTCCTTTCGGGGGTGGGGGGGGGGGCTACMGCT TGTGGGGKAATTTACCCTTGTTCACCTGACCACTGATCTATAAGTATATC TAGATATGTACTCGTAAATTCCTAATTCTTTAAATAGGCTTCTTTGATAG AAAATAATCAAAACTTAAAATGTCAACTTTCTAAGATAAATCTGTAGTTT AAATAAATAAATGATTAAATTATCAATTATCCCCATATTTATATAATCAT GTGAACATTTGTATCTTAATTCTAAAATGAAAATTTTTTCTATCTAAGTG TTTATTGTTGTTGTTGTTTTTTTGCCGATAGAGAATCAAAAAATCACCTC AATCATAAGGATGTAAAACTTTTTGATAGTAAAGAAGAAAAGAGTTTGAA AAAGGAAAACTCAATTAATTTTAAAAAAGTAATTAGAATTAAACATTTTA TATTTACAGGATGCAAAAATAATTTAACATAAATATTTTTTGCAATTTTA GGTATCTACCAATAATCAAAAAGTTAAGAAAAAGAGATTTAATAATGAGT CAAGTTTTTTGGAAAATTCAACTGAGCCGGGATCTAAATTTCCCTTTACN ATTATATGATTGAATCGAAATTAATCCAATGCTTGTTTGTATTAAGTATA AAGTCAATTATAAATTACATATATCTGAGTAAAGTTTCTATTAATTAGTT CTATTTGTAGTCTACGTATCCAGAAGAGTAATTAAGAAGCTATTCGGCAC ACTATTAGTCCAACACTAA
back to top
Add to Basket