EMLSAG00000005311, EMLSAG00000005311-688077 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000005311
Unique NameEMLSAG00000005311-688077
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
G F48 g37265 female
  1. PreAdult2
No visible phenotype
-Missing-
20.12.2012 - 10:57
29.01.2013 - 10:06
Homology
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944104|gb|GAXK01014449.1| (TSA: Calanus finmarchicus comp9338_c18_seq34 transcribed RNA sequence)

HSP 1 Score: 151.754 bits (382), Expect = 1.710e-38
Identity = 97/271 (35.79%), Postives = 156/271 (57.56%), Query Frame = 0
Query:  979 DKELFVVKGEINEKIIMIDSLCKSNESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIKTEASVRLDTIIQELKDSSDKIVQLDQGLQQSDVKIHLMEQEGRE-------SERNVRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWAR---VPNNTSHWAP--FNGWEYFTSDRK-----IYESNDRTLRLEALTDAEEADSSIQIIR 1232
            +++L V+K  I E+   +++  +S E  VE +         Q+KE  + EII+++T   E +   +++L+  I+ ++  SD+   L + ++Q+  K   +E+ G E       S  +++ IRTD    K N W ++ +I +A RG T+VLKSEG   +HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S SW+VGT +GH YGW R       ++ W P   +GWEY    R       ++S+D TLR+E+L D E+    I+ I+
Sbjct:  140 ERDLVVLK--IKEQKETLEAFFRSLEQKVETIE------TTQIKESSRVEIIERQT---ESQERLAMQLEQKIKYVEKYSDEQHSLIKEVEQTAHK--QVEEMGSELQEYVNNSREDLQNIRTDMTTDKENFWTLLVEIYSAFRGYTVVLKSEGAVKKHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASASWLVGTVVGHQYGWLRNGSTAAASARWLPDLSSGWEYRPLVRGEDSLSSWQSDDGTLRIESLRDVEKVTELIRDIK 913          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944072|gb|GAXK01014481.1| (TSA: Calanus finmarchicus comp9338_c27_seq7 transcribed RNA sequence)

HSP 1 Score: 149.828 bits (377), Expect = 5.358e-36
Identity = 139/524 (26.53%), Postives = 245/524 (46.76%), Query Frame = 0
Query:  798 MQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIE-CKEQLIKSSVDYMNISKILFDDVRPEL-DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNER----------YREIEKRLYNELSLNSEKLLTVRNDVLDFCD-------KELFVVKGEINEKIIMIDSLCKSNESHVENL----------RGLNTKLLDQMKEQ---LQREIIKQETLISEIKTEASVRLD----TIIQELKDSSD------------------------KIVQLDQ-GLQQSDVKIHL-------MEQEGRESERN-------VRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
             Q EK  YVE L  +V+ +D+++Q+ EA  K+  E   K+N              +EE++        +LK   +D+IE  +E+ ++  V     SK  F+D   +L D+T+   +          +++SE     + + T    ++ +++ER          +R + ++    +S+ SEK++   N+  +  +       +E    K E++ K+  + +     E  +E +          R   T+ L   KE+   L++E   +  LI +  +E    ++    T+ Q+LK   D                        K+ QLDQ G +Q+ + + +       +++ G E   N       +R IR +  + K N+W ++ +I ++ RG TLV+KSEG    HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct:   34 FQAEKAQYVETLATKVSQIDEERQKKEAETKDEFEVMTKRN--------------LEEIN--------QLKITFLDSIERLQEEFLQEKV----FSKSEFEDFSKKLKDITNKTGTH--------EDKLSELEPYAQGINTKVAELENNIHERIALLIAKSEEHRSMIEKSTTSVSVFSEKIVAYENEQREISENLTKNSAEEFVAFKQEMDSKVSNLRTQSGYQEDKIEKIVESISTMNEDRSKATEQLQAQKEEITSLKKEFQNENELIVKRFSEQKGSIESINLTLEQQLKKIGDLQADEVKYLEEVNQTKIAVSDLEGKLNQLDQFGAEQNSLILAVEKTVTEKLDEVGGEVRENAGKFRDEIRNIRKEMTNDKENLWTLVVEIYSSFRGCTLVVKSEGAVSAHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 1497          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944074|gb|GAXK01014479.1| (TSA: Calanus finmarchicus comp9338_c27_seq5 transcribed RNA sequence)

HSP 1 Score: 150.214 bits (378), Expect = 7.057e-36
Identity = 139/524 (26.53%), Postives = 245/524 (46.76%), Query Frame = 0
Query:  798 MQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIE-CKEQLIKSSVDYMNISKILFDDVRPEL-DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNER----------YREIEKRLYNELSLNSEKLLTVRNDVLDFCD-------KELFVVKGEINEKIIMIDSLCKSNESHVENL----------RGLNTKLLDQMKEQ---LQREIIKQETLISEIKTEASVRLD----TIIQELKDSSD------------------------KIVQLDQ-GLQQSDVKIHL-------MEQEGRESERN-------VRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
             Q EK  YVE L  +V+ +D+++Q+ EA  K+  E   K+N              +EE++        +LK   +D+IE  +E+ ++  V     SK  F+D   +L D+T+   +          +++SE     + + T    ++ +++ER          +R + ++    +S+ SEK++   N+  +  +       +E    K E++ K+  + +     E  +E +          R   T+ L   KE+   L++E   +  LI +  +E    ++    T+ Q+LK   D                        K+ QLDQ G +Q+ + + +       +++ G E   N       +R IR +  + K N+W ++ +I ++ RG TLV+KSEG    HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct:  350 FQAEKAQYVETLATKVSQIDEERQKKEAETKDEFEVMTKRN--------------LEEIN--------QLKITFLDSIERLQEEFLQEKV----FSKSEFEDFSKKLKDITNKTGTH--------EDKLSELEPYAQGINTKVAELENNIHERIALLIAKSEEHRSMIEKSTTSVSVFSEKIVAYENEQREISENLTKNSAEEFVAFKQEMDSKVSNLRTQSGYQEDKIEKIVESISTMNEDRSKATEQLQAQKEEITSLKKEFQNENELIVKRFSEQKGSIESINLTLEQQLKKIGDLQADEVKYLEEVNQTKIAVSDLEGKLNQLDQFGAEQNSLILAVEKTVTEKLDEVGGEVRENAGKFRDEIRNIRKEMTNDKENLWTLVVEIYSSFRGCTLVVKSEGAVSAHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 1813          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944073|gb|GAXK01014480.1| (TSA: Calanus finmarchicus comp9338_c27_seq6 transcribed RNA sequence)

HSP 1 Score: 149.828 bits (377), Expect = 7.353e-36
Identity = 139/524 (26.53%), Postives = 245/524 (46.76%), Query Frame = 0
Query:  798 MQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIE-CKEQLIKSSVDYMNISKILFDDVRPEL-DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNER----------YREIEKRLYNELSLNSEKLLTVRNDVLDFCD-------KELFVVKGEINEKIIMIDSLCKSNESHVENL----------RGLNTKLLDQMKEQ---LQREIIKQETLISEIKTEASVRLD----TIIQELKDSSD------------------------KIVQLDQ-GLQQSDVKIHL-------MEQEGRESERN-------VRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
             Q EK  YVE L  +V+ +D+++Q+ EA  K+  E   K+N              +EE++        +LK   +D+IE  +E+ ++  V     SK  F+D   +L D+T+   +          +++SE     + + T    ++ +++ER          +R + ++    +S+ SEK++   N+  +  +       +E    K E++ K+  + +     E  +E +          R   T+ L   KE+   L++E   +  LI +  +E    ++    T+ Q+LK   D                        K+ QLDQ G +Q+ + + +       +++ G E   N       +R IR +  + K N+W ++ +I ++ RG TLV+KSEG    HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct:  186 FQAEKAQYVETLATKVSQIDEERQKKEAETKDEFEVMTKRN--------------LEEIN--------QLKITFLDSIERLQEEFLQEKV----FSKSEFEDFSKKLKDITNKTGTH--------EDKLSELEPYAQGINTKVAELENNIHERIALLIAKSEEHRSMIEKSTTSVSVFSEKIVAYENEQREISENLTKNSAEEFVAFKQEMDSKVSNLRTQSGYQEDKIEKIVESISTMNEDRSKATEQLQAQKEEITSLKKEFQNENELIVKRFSEQKGSIESINLTLEQQLKKIGDLQADEVKYLEEVNQTKIAVSDLEGKLNQLDQFGAEQNSLILAVEKTVTEKLDEVGGEVRENAGKFRDEIRNIRKEMTNDKENLWTLVVEIYSSFRGCTLVVKSEGAVSAHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 1649          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944075|gb|GAXK01014478.1| (TSA: Calanus finmarchicus comp9338_c27_seq4 transcribed RNA sequence)

HSP 1 Score: 150.599 bits (379), Expect = 8.645e-36
Identity = 139/524 (26.53%), Postives = 245/524 (46.76%), Query Frame = 0
Query:  798 MQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIE-CKEQLIKSSVDYMNISKILFDDVRPEL-DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNER----------YREIEKRLYNELSLNSEKLLTVRNDVLDFCD-------KELFVVKGEINEKIIMIDSLCKSNESHVENL----------RGLNTKLLDQMKEQ---LQREIIKQETLISEIKTEASVRLD----TIIQELKDSSD------------------------KIVQLDQ-GLQQSDVKIHL-------MEQEGRESERN-------VRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
             Q EK  YVE L  +V+ +D+++Q+ EA  K+  E   K+N              +EE++        +LK   +D+IE  +E+ ++  V     SK  F+D   +L D+T+   +          +++SE     + + T    ++ +++ER          +R + ++    +S+ SEK++   N+  +  +       +E    K E++ K+  + +     E  +E +          R   T+ L   KE+   L++E   +  LI +  +E    ++    T+ Q+LK   D                        K+ QLDQ G +Q+ + + +       +++ G E   N       +R IR +  + K N+W ++ +I ++ RG TLV+KSEG    HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct: 1331 FQAEKAQYVETLATKVSQIDEERQKKEAETKDEFEVMTKRN--------------LEEIN--------QLKITFLDSIERLQEEFLQEKV----FSKSEFEDFSKKLKDITNKTGTH--------EDKLSELEPYAQGINTKVAELENNIHERIALLIAKSEEHRSMIEKSTTSVSVFSEKIVAYENEQREISENLTKNSAEEFVAFKQEMDSKVSNLRTQSGYQEDKIEKIVESISTMNEDRSKATEQLQAQKEEITSLKKEFQNENELIVKRFSEQKGSIESINLTLEQQLKKIGDLQADEVKYLEEVNQTKIAVSDLEGKLNQLDQFGAEQNSLILAVEKTVTEKLDEVGGEVRENAGKFRDEIRNIRKEMTNDKENLWTLVVEIYSSFRGCTLVVKSEGAVSAHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 2794          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944076|gb|GAXK01014477.1| (TSA: Calanus finmarchicus comp9338_c27_seq3 transcribed RNA sequence)

HSP 1 Score: 150.214 bits (378), Expect = 1.149e-35
Identity = 139/524 (26.53%), Postives = 245/524 (46.76%), Query Frame = 0
Query:  798 MQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIE-CKEQLIKSSVDYMNISKILFDDVRPEL-DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNER----------YREIEKRLYNELSLNSEKLLTVRNDVLDFCD-------KELFVVKGEINEKIIMIDSLCKSNESHVENL----------RGLNTKLLDQMKEQ---LQREIIKQETLISEIKTEASVRLD----TIIQELKDSSD------------------------KIVQLDQ-GLQQSDVKIHL-------MEQEGRESERN-------VRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
             Q EK  YVE L  +V+ +D+++Q+ EA  K+  E   K+N              +EE++        +LK   +D+IE  +E+ ++  V     SK  F+D   +L D+T+   +          +++SE     + + T    ++ +++ER          +R + ++    +S+ SEK++   N+  +  +       +E    K E++ K+  + +     E  +E +          R   T+ L   KE+   L++E   +  LI +  +E    ++    T+ Q+LK   D                        K+ QLDQ G +Q+ + + +       +++ G E   N       +R IR +  + K N+W ++ +I ++ RG TLV+KSEG    HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct: 1477 FQAEKAQYVETLATKVSQIDEERQKKEAETKDEFEVMTKRN--------------LEEIN--------QLKITFLDSIERLQEEFLQEKV----FSKSEFEDFSKKLKDITNKTGTH--------EDKLSELEPYAQGINTKVAELENNIHERIALLIAKSEEHRSMIEKSTTSVSVFSEKIVAYENEQREISENLTKNSAEEFVAFKQEMDSKVSNLRTQSGYQEDKIEKIVESISTMNEDRSKATEQLQAQKEEITSLKKEFQNENELIVKRFSEQKGSIESINLTLEQQLKKIGDLQADEVKYLEEVNQTKIAVSDLEGKLNQLDQFGAEQNSLILAVEKTVTEKLDEVGGEVRENAGKFRDEIRNIRKEMTNDKENLWTLVVEIYSSFRGCTLVVKSEGAVSAHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 2940          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944078|gb|GAXK01014475.1| (TSA: Calanus finmarchicus comp9338_c27_seq1 transcribed RNA sequence)

HSP 1 Score: 150.599 bits (379), Expect = 1.223e-35
Identity = 139/524 (26.53%), Postives = 248/524 (47.33%), Query Frame = 0
Query:  798 MQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIE-CKEQLIKSSVDYMNISKILFDDVRPEL-DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNER----------YREIEKRLYNELSLNSEKLLTVRNDVLDFCD-------KELFVVKGEINEKIIMIDSLCKSNESH----VENLRGLN---TKLLDQMKEQ------LQREIIKQETLISEIKTEASVRLD----TIIQELKDSSD------------------------KIVQLDQ-GLQQSDVKIHL-------MEQEGRESERN-------VRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
             Q EK  YVE L  +V+ +D+++Q+ EA  K+  E   K+N              +EE++        +LK   +D+IE  +E+ ++  V     SK  F+D   +L D+T+   +          +++SE     + + T    ++ +++ER          +R + ++    +S+ SEK++   N+  +  +       +E    K E++ K+  + +     E      VE++  +N   +K  +Q++ Q      L++E   +  LI +  +E    ++    T+ Q+LK   D                        K+ QLDQ G +Q+ + + +       +++ G E   N       +R IR +  + K N+W ++ +I ++ RG TLV+KSEG    HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct: 2159 FQAEKAQYVETLATKVSQIDEERQKKEAETKDEFEVMTKRN--------------LEEIN--------QLKITFLDSIERLQEEFLQEKV----FSKSEFEDFSKKLKDITNKTGTH--------EDKLSELEPYAQGINTKVAELENNIHERIALLIAKSEEHRSMIEKSTTSVSVFSEKIVAYENEQREISENLTKNSAEEFVAFKQEMDSKVSNLRTQSGYQEDKIEKIVESISSMNEERSKATEQLQAQKEEITSLKKEFQNENELIVKRFSEQKGSIESINLTLEQQLKKIGDLQADEVKYLEEVNQTKIAVSDLEGKLNQLDQFGAEQNSLILAVEKTVTEKLDEVGGEVRENAGKFRDEIRNIRKEMTNDKENLWTLVVEIYSSFRGCTLVVKSEGAVSAHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 3622          

HSP 2 Score: 33.4982 bits (75), Expect = 7.003e+0
Identity = 17/37 (45.95%), Postives = 23/37 (62.16%), Query Frame = 0
Query: 1004 ESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIK 1040
            E HV NLR LN KLLDQ++E++      QE  I  ++
Sbjct:  587 EGHVTNLRELNVKLLDQVREKMDAHETVQENTIENLR 697          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944077|gb|GAXK01014476.1| (TSA: Calanus finmarchicus comp9338_c27_seq2 transcribed RNA sequence)

HSP 1 Score: 149.828 bits (377), Expect = 1.441e-35
Identity = 139/524 (26.53%), Postives = 245/524 (46.76%), Query Frame = 0
Query:  798 MQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIE-CKEQLIKSSVDYMNISKILFDDVRPEL-DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNER----------YREIEKRLYNELSLNSEKLLTVRNDVLDFCD-------KELFVVKGEINEKIIMIDSLCKSNESHVENL----------RGLNTKLLDQMKEQ---LQREIIKQETLISEIKTEASVRLD----TIIQELKDSSD------------------------KIVQLDQ-GLQQSDVKIHL-------MEQEGRESERN-------VRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
             Q EK  YVE L  +V+ +D+++Q+ EA  K+  E   K+N              +EE++        +LK   +D+IE  +E+ ++  V     SK  F+D   +L D+T+   +          +++SE     + + T    ++ +++ER          +R + ++    +S+ SEK++   N+  +  +       +E    K E++ K+  + +     E  +E +          R   T+ L   KE+   L++E   +  LI +  +E    ++    T+ Q+LK   D                        K+ QLDQ G +Q+ + + +       +++ G E   N       +R IR +  + K N+W ++ +I ++ RG TLV+KSEG    HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct: 1582 FQAEKAQYVETLATKVSQIDEERQKKEAETKDEFEVMTKRN--------------LEEIN--------QLKITFLDSIERLQEEFLQEKV----FSKSEFEDFSKKLKDITNKTGTH--------EDKLSELEPYAQGINTKVAELENNIHERIALLIAKSEEHRSMIEKSTTSVSVFSEKIVAYENEQREISENLTKNSAEEFVAFKQEMDSKVSNLRTQSGYQEDKIEKIVESISTMNEDRSKATEQLQAQKEEITSLKKEFQNENELIVKRFSEQKGSIESINLTLEQQLKKIGDLQADEVKYLEEVNQTKIAVSDLEGKLNQLDQFGAEQNSLILAVEKTVTEKLDEVGGEVRENAGKFRDEIRNIRKEMTNDKENLWTLVVEIYSSFRGCTLVVKSEGAVSAHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 3045          

HSP 2 Score: 33.4982 bits (75), Expect = 6.095e+0
Identity = 17/37 (45.95%), Postives = 23/37 (62.16%), Query Frame = 0
Query: 1004 ESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIK 1040
            E HV NLR LN KLLDQ++E++      QE  I  ++
Sbjct:   10 EGHVTNLRELNVKLLDQVREKMDAHETVQENTIENLR 120          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944115|gb|GAXK01014438.1| (TSA: Calanus finmarchicus comp9338_c18_seq23 transcribed RNA sequence)

HSP 1 Score: 145.591 bits (366), Expect = 2.231e-35
Identity = 95/275 (34.55%), Postives = 157/275 (57.09%), Query Frame = 0
Query:  979 DKELFVVKGEINEKIIMIDSLCKSNESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIKTEASVRLDTIIQELKDSSDKIVQLDQGLQQSDVKIHLMEQEGRE-------SERNVRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
            +++L V+K  I E+   +++  +S E  VE +         Q+KE  + EII+++T   E +   +++L+  I+ ++  SD+   L + ++Q+  K   +E+ G E       S  +++ IRTD    K N W ++ +I +A RG T+VLKSEG   +HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct:  693 ERDLVVLK--IKEQKETLEAFFRSLEQKVETIE------TTQIKESSRVEIIERQT---ESQERLAMQLEQKIKYVEKYSDEQHSLIKEVEQTAHK--QVEEMGSELQEYVNNSREDLQNIRTDMTTDKENFWTLLVEIYSAFRGYTVVLKSEGAVKKHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 1472          
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Match: gi|592944116|gb|GAXK01014437.1| (TSA: Calanus finmarchicus comp9338_c18_seq22 transcribed RNA sequence)

HSP 1 Score: 145.591 bits (366), Expect = 2.300e-35
Identity = 95/275 (34.55%), Postives = 157/275 (57.09%), Query Frame = 0
Query:  979 DKELFVVKGEINEKIIMIDSLCKSNESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIKTEASVRLDTIIQELKDSSDKIVQLDQGLQQSDVKIHLMEQEGRE-------SERNVRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTS---HWAP--FNGWEY---------FTSDRKIYESNDRTLRLEALTDAEEADSSIQIIR 1232
            +++L V+K  I E+   +++  +S E  VE +         Q+KE  + EII+++T   E +   +++L+  I+ ++  SD+   L + ++Q+  K   +E+ G E       S  +++ IRTD    K N W ++ +I +A RG T+VLKSEG   +HQ D  GVYR++D++N+RP YKQD GEN+IYY+  S +W VGT +GH YGW +  + ++    W P    GWEY          TS+   + S+D +LR+E+L D E+ +  I+ I+
Sbjct:  706 ERDLVVLK--IKEQKETLEAFFRSLEQKVETIE------TTQIKESSRVEIIERQT---ESQERLAMQLEQKIKYVEKYSDEQHSLIKEVEQTAHK--QVEEMGSELQEYVNNSREDLQNIRTDMTTDKENFWTLLVEIYSAFRGYTVVLKSEGAVKKHQSDVLGVYRMVDSYNDRPVYKQDGGENYIYYSSASNTWFVGTVVGHQYGWLKNSSESASSKRWIPDLKTGWEYRPLVRSSDSLTSN--TWLSDDGSLRIESLRDVEKVNELIRDIK 1485          
BLAST of EMLSAG00000005311 vs. L. salmonis peptides
Match: EMLSAP00000005311 (pep:novel supercontig:LSalAtl2s:LSalAtl2s283:445721:453151:-1 gene:EMLSAG00000005311 transcript:EMLSAT00000005311 description:"maker-LSalAtl2s283-augustus-gene-5.10")

HSP 1 Score: 2476.43 bits (6417), Expect = 0.000e+0
Identity = 1245/1245 (100.00%), Postives = 1245/1245 (100.00%), Query Frame = 0
Query:    1 MESDIKNEIHKNVFPKLVDVESKTVNFYSEIHDKIVPSINDIQLKYNEELIPRIQSFENKYVLEVDEKLWPHVNKMHDKIYEDMDXKFXPLVHELREIEPIVRELESQILISREKVNSISPKIDEIQEIISNSQNEINSKIWPEINSLQSSLNILDPDVTQIKEKLVDTQNIVNNEIWPHIDKLSLTQTEQFNLSVQNIESKYDIEIHEKLWPFIKDMDKDLKLELQENVWPAIDDLRLVKPFISESTSQFNLINEEIEVLKKITDNSTNEISNKIWPKITQISVEQNEQVSVNIQNIENKFNIEINDKLWPYVQEMNTFLKDEVEGKLIPHVQELDDLRPQLNDVRETVKDVNAKXEKSLDEIFNSLWPHVKSLNIKLSDDIIQNIKNLEIKFDTEIFKKMWPFINDMDRDIKKEIHEGMWPSMKELQEYIPVIKEMETKLTSVTSQLETVELKSEKSHYEIVEYLRPNVETVTMRIDSEVMPKVKDVETILSLEIFEKVWPFIRELDDRVTKDLYEKLWPQVNEIVPKIKDVHARVAFADPGDLKNKIESINISIDDRFQEIYPKIKDMTDKISFLEPVAYGTAEKLDIFVPKLDSLELRIDERTSKTVQEVNLVVNERFGLLEPGLAKFDQRLTILEPRVSETIEKLSIMEPRSSELGEKLTFLEKQNLVLRLLEIETKMSAMEPKSDDLEYRLADIEPQLLDLSKLVKENVEPLSSELEKHIQNNVDPTLKRLESEFNEMILSHTSFKQQNDIIESQIIPKIRDEINVEISNINIEIKERILPKIFSLEEQHIMQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIECKEQLIKSSVDYMNISKILFDDVRPELDVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNERYREIEKRLYNELSLNSEKLLTVRNDVLDFCDKELFVVKGEINEKIIMIDSLCKSNESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIKTEASVRLDTIIQELKDSSDKIVQLDQGLQQSDVKIHLMEQEGRESERNVRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTSHWAPFNGWEYFTSDRKIYESNDRTLRLEALTDAEEADSSIQIIREKELTKNESIEKN 1245
            MESDIKNEIHKNVFPKLVDVESKTVNFYSEIHDKIVPSINDIQLKYNEELIPRIQSFENKYVLEVDEKLWPHVNKMHDKIYEDMDXKFXPLVHELREIEPIVRELESQILISREKVNSISPKIDEIQEIISNSQNEINSKIWPEINSLQSSLNILDPDVTQIKEKLVDTQNIVNNEIWPHIDKLSLTQTEQFNLSVQNIESKYDIEIHEKLWPFIKDMDKDLKLELQENVWPAIDDLRLVKPFISESTSQFNLINEEIEVLKKITDNSTNEISNKIWPKITQISVEQNEQVSVNIQNIENKFNIEINDKLWPYVQEMNTFLKDEVEGKLIPHVQELDDLRPQLNDVRETVKDVNAKXEKSLDEIFNSLWPHVKSLNIKLSDDIIQNIKNLEIKFDTEIFKKMWPFINDMDRDIKKEIHEGMWPSMKELQEYIPVIKEMETKLTSVTSQLETVELKSEKSHYEIVEYLRPNVETVTMRIDSEVMPKVKDVETILSLEIFEKVWPFIRELDDRVTKDLYEKLWPQVNEIVPKIKDVHARVAFADPGDLKNKIESINISIDDRFQEIYPKIKDMTDKISFLEPVAYGTAEKLDIFVPKLDSLELRIDERTSKTVQEVNLVVNERFGLLEPGLAKFDQRLTILEPRVSETIEKLSIMEPRSSELGEKLTFLEKQNLVLRLLEIETKMSAMEPKSDDLEYRLADIEPQLLDLSKLVKENVEPLSSELEKHIQNNVDPTLKRLESEFNEMILSHTSFKQQNDIIESQIIPKIRDEINVEISNINIEIKERILPKIFSLEEQHIMQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIECKEQLIKSSVDYMNISKILFDDVRPELDVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNERYREIEKRLYNELSLNSEKLLTVRNDVLDFCDKELFVVKGEINEKIIMIDSLCKSNESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIKTEASVRLDTIIQELKDSSDKIVQLDQGLQQSDVKIHLMEQEGRESERNVRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTSHWAPFNGWEYFTSDRKIYESNDRTLRLEALTDAEEADSSIQIIREKELTKNESIEKN
Sbjct:    1 MESDIKNEIHKNVFPKLVDVESKTVNFYSEIHDKIVPSINDIQLKYNEELIPRIQSFENKYVLEVDEKLWPHVNKMHDKIYEDMDXKFXPLVHELREIEPIVRELESQILISREKVNSISPKIDEIQEIISNSQNEINSKIWPEINSLQSSLNILDPDVTQIKEKLVDTQNIVNNEIWPHIDKLSLTQTEQFNLSVQNIESKYDIEIHEKLWPFIKDMDKDLKLELQENVWPAIDDLRLVKPFISESTSQFNLINEEIEVLKKITDNSTNEISNKIWPKITQISVEQNEQVSVNIQNIENKFNIEINDKLWPYVQEMNTFLKDEVEGKLIPHVQELDDLRPQLNDVRETVKDVNAKXEKSLDEIFNSLWPHVKSLNIKLSDDIIQNIKNLEIKFDTEIFKKMWPFINDMDRDIKKEIHEGMWPSMKELQEYIPVIKEMETKLTSVTSQLETVELKSEKSHYEIVEYLRPNVETVTMRIDSEVMPKVKDVETILSLEIFEKVWPFIRELDDRVTKDLYEKLWPQVNEIVPKIKDVHARVAFADPGDLKNKIESINISIDDRFQEIYPKIKDMTDKISFLEPVAYGTAEKLDIFVPKLDSLELRIDERTSKTVQEVNLVVNERFGLLEPGLAKFDQRLTILEPRVSETIEKLSIMEPRSSELGEKLTFLEKQNLVLRLLEIETKMSAMEPKSDDLEYRLADIEPQLLDLSKLVKENVEPLSSELEKHIQNNVDPTLKRLESEFNEMILSHTSFKQQNDIIESQIIPKIRDEINVEISNINIEIKERILPKIFSLEEQHIMQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIECKEQLIKSSVDYMNISKILFDDVRPELDVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNERYREIEKRLYNELSLNSEKLLTVRNDVLDFCDKELFVVKGEINEKIIMIDSLCKSNESHVENLRGLNTKLLDQMKEQLQREIIKQETLISEIKTEASVRLDTIIQELKDSSDKIVQLDQGLQQSDVKIHLMEQEGRESERNVRGIRTDFEDCKNNVWNVMTQISAALRGNTLVLKSEGLALEHQPDAFGVYRLIDTFNNRPAYKQDEGENFIYYNGGSKSWMVGTRIGHNYGWARVPNNTSHWAPFNGWEYFTSDRKIYESNDRTLRLEALTDAEEADSSIQIIREKELTKNESIEKN 1245          
BLAST of EMLSAG00000005311 vs. L. salmonis peptides
Match: EMLSAP00000005312 (pep:novel supercontig:LSalAtl2s:LSalAtl2s283:453775:494068:-1 gene:EMLSAG00000005312 transcript:EMLSAT00000005312 description:"maker-LSalAtl2s283-snap-gene-5.13")

HSP 1 Score: 200.675 bits (509), Expect = 4.138e-52
Identity = 284/1261 (22.52%), Postives = 573/1261 (45.44%), Query Frame = 0
Query:   19 DVESKTVNFYSEIHDKIVPSINDIQLKYNEELIPRIQSFENKYVLEVDEKLWPHVNKMHDKIYE---DMDXKFXPLVHELREIEPIVRELESQILISREKVNSISPKIDEIQEIISNSQNEINSKIWPEINSLQSSLNI-LDP-------DVTQIKEKLVDTQNIVNNEIWPHIDKLSLTQTEQFNLSVQNIESKYDIEIHEKLWPFIKDMDKDLKLELQENVWPAIDDLR----LVKPFISESTS-------QFNLINEEIEVLKKI--------TDNSTNEISNKIWPKITQISVEQNEQVSVN----IQNIENKF---NIEINDKLWPYVQEMNTFLKDEVEGKLIPHVQELDDLRPQLNDVRETV----KDVNAKXEKSLDEIFNSLWPHV----------------KSLNIKL-----------SDDIIQNIKNLEIKF---DTEIFKKMWPFINDMDRDIKKEIHEGMWPSMKELQEYIPVIKEMETKLTSVTSQLETVELKSEKSHYEIVEYLRPNVETVTMRIDSEVMPKVKDVET----------ILSL------------------------EIFEKVWPFIRELDDRVTKDLYEKLWPQVNEIVPKIKDVHARVAFADPGDLKNKIESINISIDDRFQEIYPKIKDMTDKISFLEPVAYGTAEKLDIFVPKLDSLELRIDERTSKTVQEVNLVVNERFGLLEPGLAKFDQRLTILEPRVSETIEKLSIMEPRSSELGEKLTFLEKQNLVLRLLEIETKMSAMEPKSDDLEYRLADIEPQLLDLSKLVKENVEPLSSELEKHIQNNVD----PTLKRLES---EFNEMILSHTSFKQQNDIIE---SQIIPKIRDEINVEISNINIEIKERILPKIFSLEEQHIMQIEKVHYVEALQDRVNLLDDQKQRSEALIKESLEDAVKKNRDSFESLKQSLIIKMEELDNNDKDHWDKLKALEIDTIECKEQLIKSSVDYMNISKILFDDVRPEL----DVTSTKCSELFQELYKLTERVSESSVSVKDVQTSSRVIQEDLNERYREIEKRLYNELSLNSEKLLTVRNDVLDFCD------KELFVVKGEINEKII----MIDSL---CKSNESHVENLRGL----------NTKLLDQMKEQLQREIIKQ-----ETLISEIKTEASVRLDTIIQE------------------LKDSSDKIVQLDQGLQQSDVKIHLMEQEGRESERNVRGIRTDFEDCKNNVWNVMTQISAAL 1114
            DV    +N  +++ DKI   +NDI  + NE        F+ KY  E+++ +WP + K+  +I+E   D+  +    +   +  E     +   ++I  E  N I+PK  ++++ ++N++ E+  K+WP +  L   ++  + P       +V  +   L      + N +WP I  ++   +EQ ++S+ N+E KYD EI + LWPF+K+MDKD K+EL E +WP I+ L      + P I            +   IN E++  +KI        T+N+T EI NKI   +TQ S +QN +V+      I  +E+K     +EI +KLWP++Q M++ +K+E+  K+ P +    +L+ ++++V        +D N + +  L ++ N +   +                K + I L           +D I + ++ L+I     + E+ +K+WP+I +MD+DIK E+ E +WP + ++++  P I+ + +K+ S+  +++ V+ K+  +  E+   L P +  +   ID ++   + + +T          +LSL                        E++EK+WP+++E+D     ++ E+LWP++N    K+K + A++                       +EI PKIKD+ D+            E ++  +PKL++++  ID++ S+  ++  + + ER   L P L K       +E  + E       ++ ++S+  +K++    +++   ++ IE K              + +I P+L  L+ L+ + ++  +  +E      ++    PT+K ++    + N++  S    + Q   IE   ++   ++ +++   I +I+++  E I P++  +E  +  ++E    V+ ++D+VN +  Q +  E  I     D +      FE+  + +  K+ E++    +   KLK +E                        FD+++P+L    D TS    E+F +L+           ++K++  S ++++  L    R++E +L N +    EK+  +  DV    D      KE   + G+IN K+      +D+L    K  E+ VEN++ L          + K +  ++ +   E+ ++     +T  SE K+E    L   ++E                  +KD   KI  L+  L++ ++++  +  +  + E+NV  ++  F++ +    N   +I   L
Sbjct:  552 DVADNLINKLNDVQDKIYKDMNDITKQTNE--------FQLKYANELNDSMWPRIEKLDKRIFELGGDVQQQINLQISNYQS-ETTTNIMNEVMIIINEFKNEINPKHKDLEKRVANNEVELFEKLWPFVKDLDREMSTKVSPFMKTTVENVESLHTNLNKCNEEIFNNVWPFIKNINKESSEQLSISINNLEKKYDNEIFDNLWPFVKEMDKDFKIELGEKMWPQINSLENKITELNPKIENQNEIVQTILPKLETINSEVD--RKISHSINLFKTENNT-EIQNKIQLNLTQYSEKQNSEVNDKLWDKINEVESKTLNSEVEIFEKLWPFIQSMDSDVKEELADKIWPEINNCKELQIKISEVENKTSLYQQDANKEFDSKLLKMENEMKDQINININNFRLENNIEIDKKIEINLENYNRDQSSNVTDKIWERLEELQISSHDNNIELHEKLWPYILEMDKDIKIEMGEKLWPEVNKIKDVEPKIERINSKIQSIEPRIDEVDSKANHTEKEVYNQLLPKMNNIDSEIDRKISVNINNFKTENNTDITNKILLSLKEYKKEQESEVNNKIWEKITEIQAELYEKLWPYVQEMDKDNKVEMTERLWPELN----KVKKIEAQL-----------------------KEITPKIKDVEDR------ALTSQNEIVERVIPKLNTIDSEIDKKISEMDKDHKIEITER---LWPELNKVKD----IEVHLKEITPMFDEIDSKTSDKLDKMSNKYGEDVKQTVINIENKYDT----------EIKNIWPELEKLNSLINDKIDNQTKVMENQYSREINEKLWPTIKDIKERSEKINQIERSIIEIQPQISKIEKDSTEYKSELFEKVWPTIKSIDVKYMEEIAPQVMKVENTYKSEVE--DKVKDVEDKVNKIQPQMKDVEKKI-----DYLNPKLKEFENEVEKINPKLHEVERKCDNLNPKLKNVEDK----------------------FDNLKPQLKELSDTTSKSHKEIFDKLWP----------TMKELLESKQLVEPKL----RDLEPKLKN-IEGKVEKIHPMMKDVEHKIDNFNPKLKEFENLFGKINPKLSDVEKKVDNLNPKLKDVEAKVENIKPLLKEVEKIATNSQKDIKNIESKYNSEVFEKLWPFLKTFESEFKSEVHNNLLPKMKEFEPKLKDVEGKVEKIHPMMKDVEKKIDDLNPKLKEFEIRVDKINPKLSDVEKNVENLKPQFKEVEKTATNSHKEIFDKL 1706          

HSP 2 Score: 197.978 bits (502), Expect = 2.695e-51
Identity = 217/904 (24.00%), Postives = 411/904 (45.46%), Query Frame = 0
Query:    6 KNEIHKNVFPKLVDVESK-------TVNFY-----SEIHDKIVPSINDIQLKYNEE----LIPRIQSFENKYV---LEVDEKLWPHVNKMHDKIYEDMDXKFXPLVHELREIEPIVRELESQILISREKVNSISPKIDEIQEIISNSQNEINSKIWPEINSLQSSLNI-LDPDV-TQIKEKLVDTQNIVNNEIWPHIDKLSLTQTEQFNLSVQNIESKYDIEIHEKLWPFIKDMDKDLKLELQENVWPAIDDLRLVKPFISESTSQFNLINEEIEVLKKITDNSTNEISNKIWPKITQISVEQNEQVSVNIQNIENKFNIEIND----------------------------------KLWPYVQEMNTFLKDEVEGKLIPHVQELDDLRPQLNDVRETVKDVNAKXEKSLDEIF------------------------------NSLWP----------HVK------------------SLNIKLSDDIIQNIKNLEIKFDTEIFKKMWP-------FIND--------MDRDIKKEIHEGMWPSMKELQEYIPVIKEMETKLTSVTSQLETVELKSEKSHYEIVEYLRPNVETVTMRIDSEVMPKVKDVETILSLEIFEKVWPFIRELDDRVTKDLYEKLWPQVNEIVPKIKDVHARVAFADP--GDLKNKIESINISIDDRFQEIYPKIKDMTDKISFLEPVAYGTAEKLDIFVPKLDSLELRIDERTSKTVQEVNLVVNERFGLLEPGLAKFDQRLTILEPRVSETIEKLSIMEPRSSELGEKLTFLEKQ--NLVLRLLEIETKMSAMEPKSDDLEYRLADIEPQLLDLSKLVKENVEPLSSELEKHIQNNVDPTLKRLESEFNEMILS---------HTSFKQQNDIIESQIIPKIRD 768
            +NEI + + PKL  + S+       ++N +     +EI +KI  ++     K N E    L  +I   E+K +   +E+ EKLWP +  M   + E++  K  P ++  +E++  + E+E++  + ++  N       E    +   +NE+  +I   IN+ +   NI +D  +   ++    D  + V ++IW  +++L ++  +             +IE+HEKLWP+I +MDKD+K+E+ E +WP ++ ++ V+P I    S+   I   I+ +    +++  E+ N++ PK+  I  E + ++SVNI N + + N +I +                                  KLWPYVQEM+   K E+  +L P + ++  +  QL ++   +KDV  +   S +EI                                 LWP          H+K                   ++ K  +D+ Q + N+E K+DTEI K +WP        IND        M+    +EI+E +WP++K+++E    I ++E  +  +  Q+  +E  S +   E+ E + P ++++ ++   E+ P+V  VE     E+ +KV            KD+ +K    VN+I P++KDV  ++ + +P   + +N++E IN           PK+ ++  K   L P      +K D   P+L  L     + TSK+ +E+       F  L P + +  +   ++EP++ +   KL  +E +  ++   +  +E +  N   +L E E     + PK  D+E ++ ++ P+L D+   V EN++PL  E+EK I  N    +K +ES++N  +            + FK +   + + ++PK+++
Sbjct:  786 QNEIVQTILPKLETINSEVDRKISHSINLFKTENNTEIQNKIQLNLTQYSEKQNSEVNDKLWDKINEVESKTLNSEVEIFEKLWPFIQSMDSDVKEELADKIWPEINNCKELQIKISEVENKTSLYQQDANK------EFDSKLLKMENEMKDQINININNFRLENNIEIDKKIEINLENYNRDQSSNVTDKIWERLEELQISSHDN------------NIELHEKLWPYILEMDKDIKIEMGEKLWPEVNKIKDVEPKIERINSKIQSIEPRIDEVDSKANHTEKEVYNQLLPKMNNIDSEIDRKISVNINNFKTENNTDITNKILLSLKEYKKEQESEVNNKIWEKITEIQAELYEKLWPYVQEMDKDNKVEMTERLWPELNKVKKIEAQLKEITPKIKDVEDRALTSQNEIVERVIPKLNTIDSEIDKKISEMDKDHKIEITERLWPELNKVKDIEVHLKEITPMFDEIDSKTSDKLDKMSNKYGEDVKQTVINIENKYDTEI-KNIWPELEKLNSLINDKIDNQTKVMENQYSREINEKLWPTIKDIKERSEKINQIERSIIEIQPQISKIEKDSTEYKSELFEKVWPTIKSIDVKYMEEIAPQVMKVENTYKSEVEDKV------------KDVEDK----VNKIQPQMKDVEKKIDYLNPKLKEFENEVEKIN-----------PKLHEVERKCDNLNPKLKNVEDKFDNLKPQLKEL----SDTTSKSHKEI-------FDKLWPTMKELLESKQLVEPKLRDLEPKLKNIEGKVEKIHPMMKDVEHKIDNFNPKLKEFENLFGKINPKLSDVEKKVDNLNPKLKDVEAKV-ENIKPLLKEVEK-IATNSQKDIKNIESKYNSEVFEKLWPFLKTFESEFKSE---VHNNLLPKMKE 1627          

HSP 3 Score: 171.4 bits (433), Expect = 3.795e-43
Identity = 193/777 (24.84%), Postives = 392/777 (50.45%), Query Frame = 0
Query:   11 KNVFPKLVDVESKTVNFYSEIHDKIVPSINDIQLKYNEELIPRIQSFENKYVLEVDEKLWPHVNKMHD---------KIYEDMDXKFXPLVHEL-----REIEPIVRELESQ-------ILISREKVNS-ISPKIDEIQEIISNS-QNEINSKIWP----------EINSLQSSLNILDPDVTQIKEKLVDTQNIVNNEIWPHIDKLSLTQTEQFNLSVQNIESKYDIEIHEK----------LWPFIKDMDKDL-----KLELQEN----VWPAIDDLRL----VKPFISESTSQFNLINEEIEVLKKITDNSTNEISNKIWPKITQISVEQNEQVSVNIQNIENKF-NIEINDKLWPYVQEMNTFLKDEVEGKL---IPHVQELDDL----RPQLNDVRETVKDVNAKXEKSLDEIFNSLWPHVKSLNIKLSDDIIQNIKNLEIKFDTEIFKKMWPFINDMDRDIKKEIHEGMWPSMKELQEYIPVIKEMETKLTSVTSQLETVELKSEKSHYEIVEYLRPNVETVTMRIDSEVMPKVKDVETILSLEIFEKVWPFIRELDDRVT---KDLYEKLWPQVNEIVPKIKDVHARVAFADPGDLKNKIESINISIDDRFQEIYPKIKDMTDKISFLEPVAYGTAEKLDIFVPKLDSLELRIDERTSKTVQEV-NLVVNERFGLLEPGLAKFD------------QRLTILEPRVSETIEKLSIMEPRSSELGEKLTFLEKQNLVLRLLEIETKMSAMEPKSDDLEYRLADIEPQLLDL 707
            K + PK+ DVE + +   +EI ++++P +N I    + E+  +I   +  + +E+ E+LWP +NK+ D          +++++D K    + ++      +++  V  +E++       I    EK+NS I+ KID   +++ N    EIN K+WP          +IN ++ S+  + P +++I++   + ++ +  ++WP I  + +   E+    V  +E+ Y  E+ +K          + P +KD++K +     KL+  EN    + P + ++      + P +     +F+ +  +++ L   T  S  EI +K+WP + ++ +E  + V   ++++E K  NIE        V++++  +KD VE K+    P ++E ++L     P+L+DV + V ++N K  K ++    ++ P +K +  K++ +  ++IKN+E K+++E+F+K+WPF+   + + K E+H  + P MKE +   P +K++E K+  +   ++ VE K        ++ L P ++   +R+D ++ PK+ DVE  +     E + P  +E++   T   K++++KLWP + E++   K V  ++      DL+ K++ +        ++I+P +KD+  KI  L P       K+D   PKL  +E  ++    +  + + N   +E F  L P L + D             R+  LEP++ +  +K+  + P+  ++ +K+      NL  +L E E K+  + PK  D+E ++  IEP+L D+
Sbjct: 1161 KEITPKIKDVEDRALTSQNEIVERVIPKLNTI----DSEIDKKISEMDKDHKIEITERLWPELNKVKDIEVHLKEITPMFDEIDSKTSDKLDKMSNKYGEDVKQTVINIENKYDTEIKNIWPELEKLNSLINDKIDNQTKVMENQYSREINEKLWPTIKDIKERSEKINQIERSIIEIQPQISKIEKDSTEYKSELFEKVWPTIKSIDVKYMEEIAPQVMKVENTYKSEVEDKVKDVEDKVNKIQPQMKDVEKKIDYLNPKLKEFENEVEKINPKLHEVERKCDNLNPKLKNVEDKFDNLKPQLKELSDTTSKSHKEIFDKLWPTMKEL-LESKQLVEPKLRDLEPKLKNIE------GKVEKIHPMMKD-VEHKIDNFNPKLKEFENLFGKINPKLSDVEKKVDNLNPKL-KDVEAKVENIKPLLKEVE-KIATNSQKDIKNIESKYNSEVFEKLWPFLKTFESEFKSEVHNNLLPKMKEFE---PKLKDVEGKVEKIHPMMKDVEKK--------IDDLNPKLKEFEIRVD-KINPKLSDVEKNV-----ENLKPQFKEVEKTATNSHKEIFDKLWPAIKELLESKKFVEPKLK-----DLEPKLKEV--------EKIHPMMKDVEKKIDDLNPKLKEFEIKVDKINPKLSDVEKNVENLKPQLKENIENKYDSEIFQKLWPQLKELDVEFKTEVLKNLAPRMKDLEPKLKDVQDKVEKIHPKMKDVEQKI-----DNLNPKLKEFEDKVEKINPKLFDVEKKVDIIEPKLKDV 1888          

HSP 4 Score: 149.058 bits (375), Expect = 3.063e-36
Identity = 128/439 (29.16%), Postives = 216/439 (49.20%), Query Frame = 0
Query:  201 SKYDIEIHEKLWPFIKDMDKDLKLELQENVWPAID----DLRLVKPFISES----TSQFN--LINEEIEVLKKITDN---STNEISNKIWPKITQISVEQNEQVSVNIQNIENKFNIEINDKLWPYVQ---------------------------------------------EMNTFLKD--------EVE--GKLIPHVQELD-----DLRPQLNDVRETVKDVNAKXEKSLDEIFNSLWPHVKSLNIKLSDDIIQNIKNLEIKFDTEIFKKMWPFINDMDRDIKKEIHEGMWPSMKELQEYI----PVIKEMETKLTSVTSQLETV--ELKSEKSH----------YEIVEYLRPNVETVTMRIDSEV----MPKVKDVETIL---SLEIFEKVWPFIRELDDRVTKDLYEKLWPQVN---EIVPKIKDVHARVAF 540
            +K ++EIHEKLWP+IK+MD D K EL+E VWP+++    D+ L    + E+    + +FN  L++ +    K + DN     N++ +KI+  +  I+ + NE         + K+  E+ND +WP ++                                             E+N   KD        EVE   KL P V++LD      + P +    E V+ ++    K  +EIFN++WP +K++N + S+ +  +I NLE K+D EIF  +WPF+ +MD+D K E+ E MWP +  L+  I    P I+     + ++  +LET+  E+  + SH           EI   ++ N+   + + +SEV      K+ +VE+      +EIFEK+WPFI+ +D  V ++L +K+WP++N   E+  KI +V  + + 
Sbjct:  480 AKLELEIHEKLWPYIKEMDHDYKAELKEKVWPSVEGIIADINLKMSKMEENHINLSKEFNIQLVDLQNRTQKDVADNLINKLNDVQDKIYKDMNDITKQTNE--------FQLKYANELNDSMWPRIEKLDKRIFELGGDVQQQINLQISNYQSETTTNIMNEVMIIINEFKNEINPKHKDLEKRVANNEVELFEKLWPFVKDLDREMSTKVSPFMKTTVENVESLHTNLNKCNEEIFNNVWPFIKNINKESSEQLSISINNLEKKYDNEIFDNLWPFVKEMDKDFKIELGEKMWPQINSLENKITELNPKIENQNEIVQTILPKLETINSEVDRKISHSINLFKTENNTEIQNKIQLNLTQYSEKQNSEVNDKLWDKINEVESKTLNSEVEIFEKLWPFIQSMDSDVKEELADKIWPEINNCKELQIKISEVENKTSL 910          

HSP 5 Score: 68.9366 bits (167), Expect = 7.758e-12
Identity = 69/260 (26.54%), Postives = 121/260 (46.54%), Query Frame = 0
Query:    1 MESDIKNEIHKNVFPKLVDVESKTVNFYSEIHDKIVPSINDIQLKYNEELIPRIQSFENKYVLEVDEKLWPHVNKMHDKIYEDMDXKFXPLVHELREIEPIVRELESQILISREKVNSISPKIDEIQEIISNSQNEINSKIWPEINSLQSSLNILDPDVTQIKEKLVDTQNI--VNNEIWPHID------------------KLSLTQTEQFNLSVQ---NIESKYDIEIHEKLWPFIKDMDKDLKLELQENVWPAIDDL 237
             ES+ K+E+H N+ PK+ + E K  +   ++ +KI P + D++ K  ++L P+++ FE    + VD                              +I P + ++E         V ++ P+  E+++  +NS  EI  K+WP I  L  S   ++P +  ++ KL + + I  +  ++   ID                  KLS  +    NL  Q   NIE+KYD EI +KLWP +K++D + K E+ +N+ P + DL
Sbjct: 1609 FESEFKSEVHNNLLPKMKEFEPKLKDVEGKV-EKIHPMMKDVEKKI-DDLNPKLKEFE----IRVD------------------------------KINPKLSDVEKN-------VENLKPQFKEVEKTATNSHKEIFDKLWPAIKELLESKKFVEPKLKDLEPKLKEVEKIHPMMKDVEKKIDDLNPKLKEFEIKVDKINPKLSDVEKNVENLKPQLKENIENKYDSEIFQKLWPQLKELDVEFKTEVLKNLAPRMKDL 1825          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000005311 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005311 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592944104|gb|GAXK01014449.1|1.710e-3835.79TSA: Calanus finmarchicus comp9338_c18_seq34 trans... [more]
gi|592944072|gb|GAXK01014481.1|5.358e-3626.53TSA: Calanus finmarchicus comp9338_c27_seq7 transc... [more]
gi|592944074|gb|GAXK01014479.1|7.057e-3626.53TSA: Calanus finmarchicus comp9338_c27_seq5 transc... [more]
gi|592944073|gb|GAXK01014480.1|7.353e-3626.53TSA: Calanus finmarchicus comp9338_c27_seq6 transc... [more]
gi|592944075|gb|GAXK01014478.1|8.645e-3626.53TSA: Calanus finmarchicus comp9338_c27_seq4 transc... [more]
gi|592944076|gb|GAXK01014477.1|1.149e-3526.53TSA: Calanus finmarchicus comp9338_c27_seq3 transc... [more]
gi|592944078|gb|GAXK01014475.1|1.223e-3526.53TSA: Calanus finmarchicus comp9338_c27_seq1 transc... [more]
gi|592944077|gb|GAXK01014476.1|1.441e-3526.53TSA: Calanus finmarchicus comp9338_c27_seq2 transc... [more]
gi|592944115|gb|GAXK01014438.1|2.231e-3534.55TSA: Calanus finmarchicus comp9338_c18_seq23 trans... [more]
gi|592944116|gb|GAXK01014437.1|2.300e-3534.55TSA: Calanus finmarchicus comp9338_c18_seq22 trans... [more]

Pages

back to top
BLAST of EMLSAG00000005311 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 2
Match NameE-valueIdentityDescription
EMLSAP000000053110.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s283:44572... [more]
EMLSAP000000053124.138e-5222.52pep:novel supercontig:LSalAtl2s:LSalAtl2s283:45377... [more]
back to top
BLAST of EMLSAG00000005311 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005311 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005311 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EMLSAG00000005311 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s283supercontigLSalAtl2s283:445721..453151 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NoteHypothetical protein
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s283-augustus-gene-5.10
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000005311 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000005311EMLSAT00000005311-701158Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s283:445721..453151-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000005311-688077 ID=EMLSAG00000005311-688077|Name=EMLSAG00000005311|organism=Lepeophtheirus salmonis|type=gene|length=7431bp|location=Sequence derived from alignment at LSalAtl2s283:445721..453151- (Lepeophtheirus salmonis)
ATGGAAAGTGATATCAAAAATGAGATCCATAAGAATGTATTTCCAAAACT TGTGGATGTTGAGTCTAAGACTGTCAACTTTTATTCTGAAATCCATGACA AGATTGTACCTTCTATCAATGATATTCAATTGAAGTACAATGAAGAGTTG ATTCCTCGTATTCAATCGTTTGAAAATAAATATGTTTTAGAAGTTGACGA GAAGCTGTGGCCTCATGTTAATAAAATGCATGATAAAATATATGAAGATA TGGATARTAAGTTTTYTCCMCTTGTACATGAATTAAGGGAAATTGAACCC ATTGTTCGTGAACTTGAATCTCAAATTTTAATATCAAGGGAGAAAGTTAA TTCAATTTCTCCAAAGATTGATGAAATCCAAGAAATTATTTCTAATTCTC AAAATGAAATTAATTCTAAGATATGGCCAGAAATTAATAGTTTGCAATCT TCACTAAATATCCTTGATCCTGATGTTACTCAAATAAAAGAGAAGTTAGT GGACACTCAAAATATTGTCAATAACGAAATTTGGCCGCATATTGATAAAC TTAGTTTAACTCAAACTGAACAATTTAACCTTTCTGTGCAGAATATTGAA AGTAAGTATGATATTGAAATTCACGAAAAACTTTGGCCATTTATTAAAGA TATGGATAAGGATTTGAAACTTGAACTTCAAGAAAATGTTTGGCCTGCCA TTGATGATCTCCGATTGGTTAAACCATTTATATCTGAATCAACATCACAA TTTAATTTGATTAATGAAGAAATAGAAGTTTTGAAGAAAATAACAGATAA TTCTACTAATGAAATCTCCAATAAGATTTGGCCCAAAATCACACAAATAA GCGTTGAGCAAAATGAGCAAGTCTCTGTAAACATCCAAAATATTGAGAAC AAGTTTAACATTGAAATCAATGACAAATTATGGCCTTATGTTCAAGAAAT GAATACTTTCTTGAAAGACGAAGTAGAAGGTAAATTGATACCACATGTTC AAGAATTGGATGATTTGAGACCTCAGCTCAATGATGTTAGGGAGACAGTT AAGGATGTCAATGCTAAGGYAGAAAAATCTCTTGATGAAATTTTCAACTC TCTTTGGCCTCATGTCAAGAGTTTGAATATCAAATTATCTGATGATATCA TTCAAAATATTAAGAATCTTGAAATTAAGTTTGACACCGAAATTTTTAAG AAAATGTGGCCATTTATTAATGATATGGACCGAGATATTAAAAAGGAGAT ACATGAAGGTATGTGGCCCAGTATGAAGGAATTACAAGAATATATTCCAG TCATAAAAGAAATGGAAACTAAATTAACATCAGTTACATCTCAGCTTGAA ACTGTGGAATTAAAATCTGAAAAATCTCATTATGAAATTGTTGAATATTT GCGTCCTAACGTTGAAACTGTAACCATGAGAATCGATTCTGAAGTAATGC CTAAAGTAAAGGATGTGGAAACTATATTATCACTTGAAATATTTGAAAAG GTTTGGCCATTTATCAGAGAACTTGACGATAGAGTTACAAAGGATTTGTA TGAAAAGTTGTGGCCTCAGGTAAACGAAATTGTACCAAAGATCAAGGATG TTCATGCCCGTGTTGCATTTGCAGATCCAGGGGATCTCAAAAACAAAATT GAAAGTATCAATATTAGTATTGATGATAGATTCCAAGAAATATATCCCAA GATCAAGGACATGACTGATAAGATATCATTTCTTGAGCCCGTTGCTTATG GTACTGCTGAAAAGCTTGATATCTTTGTTCCAAAACTTGATTCTTTAGAA TTGAGAATTGATGAAAGAACGTCCAAAACTGTTCAAGAAGTTAATTTGGT GGTAAATGAAAGATTTGGCCTACTTGAACCAGGCTTAGCCAAATTTGATC AACGTCTCACAATATTAGAGCCACGCGTATCCGAAACGATAGAAAAACTC TCAATAATGGAACCTAGAAGTTCAGAACTAGGAGAAAAATTGACTTTCCT AGAAAAACAAAACTTAGTTCTTCGTCTTTTAGAGATTGAAACTAAGATGT CAGCCATGGAACCTAAATCTGATGACTTAGAATATAGATTAGCAGATATT GAACCTCAACTCCTCGATTTATCTAAACTTGTAAAGGAAAATGTTGAGCC ACTTTCTTCAGAACTTGAAAAACATATTCAGAATAATGTGGACCCTACTC TTAAACGACTTGAATCAGAGTTTAATGAAATGATTTTAAGCCATACCTCA TTTAAACAGCAGAATGATATAATTGAATCCCAAATTATACCGAAGATAAG AGATGAAATCAACGTAGAAATATCTAACATCAATATTGAAATTAAAGAGA GAATTCTTCCAAAGATATTTTCTCTAGAAGAGCAACATATTATGCAAATA GAAAAAGTGCATTATGTTGAGGCTTTACAAGATAGAGTAAATCTATTAGA CGATCAAAAACAGCGAAGTGAAGCTCTTATCAAAGAATCTTTAGAGGACG CTGTTAAGAAGAACAGAGATTCATTTGAGTCATTGAAACAATCATTAATT ATAAAAATGGAAGAATTAGATAACAATGATAAGGACCATTGGGACAAATT GAAAGCTCTCGAAATTGATACCATAGAATGCAAGGAACAGCTGATCAAGT CAAGTGTCGATTATATGAATATTTCAAAGATTCTATTTGATGATGTTCGG CCTGAACTTGATGTCACATCCACTAAATGTTCAGAGTTATTTCAGGAACT CTATAAATTAACTGAACGAGTCTCAGAGAGCTCTGTATCAGTAAAGGACG TTCAAACTTCATCACGTGTTATACAAGAAGACTTAAATGAAAGATATAGA GAGATAGAAAAGAGGTTATATAATGAATTGTCCCTCAACTCAGAAAAGCT TCTGACTGTTAGGAACGATGTTCTCGATTTCTGTGATAAAGAATTGTTTG TAGTGAAGGGAGAAATCAATGAAAAGATCATCATGATAGATTCTTTGTGC AAGTCCAACGAGTCTCATGTAGAAAACTTGAGAGGTCTGAATACCAAACT TTTGGATCAAATGAAGGAACAACTTCAACGAGAAATAATAAAACAAGAGA CTCTCATCTCAGAAATTAAAACTGAGGCATCTGTTCGCCTTGATACGATT ATTCAGGAATTGAAAGATAGCTCTGATAAAATTGTGCAACTTGATCAAGG ACTTCAACAATCCGATGTCAAAATCCATTTAATGGAACAAGAAGGAAGAG AAAGCGAAAGGAACGTCAGAGGAATTCGTAAGTCATTTTATATTTTATTT AAAACTAATATTATATAGCTAACAATCCTAATAAAAAAAGATAGATATTA CAATTATTACTTTGTTTTTGTTTTAATATTTAAAATTGTATATACTTAAT AAATTGCTTTATTTTTAAGCTTCTTTATAAATACCTAATAAAAGTAATAT GAAACATATTACATCTTGTATATCTCTTGTGTTTTCAAGAGGTTGCGTGA TTTCAAACATTGTTAATCTTTCGCTGCTTTTACTATATTTTAATTTAACC TATTATGTATTTATAACCTGAAACATAACCATGCCTAAATATTTTATCAA TTAACCTCATCACATCTTACTAGTATTGTAGTGGTTTCAATCTTCGATAA TTAATCTATAATTATATTCATCGAAGTTTGAACCAAATGCACACACAAGG AAGTAAAGAAGTTATCTATAGTTTGATAGTGTTTTTTGTTGGTCATTTTA TTTTTTATTTTTTTGTATTTAAAAACATTTATTTGTTATGTTGTCTTTGG GCTGTTTTTTTTATTTTAATTTTTTTTACATTAAAATTTGCTTGGTGTTT GAGTAGATTTGCTTGCTGGGAGGGAAATGATTTCCTAAGTTACTTAGATA GTTTTTAGTTACTATGAGTATAATTTGTAACTTGGGAATGTCTTTTGATC ACAACTAAATAATGAAGGAAATCTACTCCAACATTAGGACAGTAAAAGCT TGAGGTGACTGTGCTTTTTCTTAATTTTCATTCATTAATTTATTTATTTG CACTTGGACGATGATACCACATGCATATCACTTATATTTGTAAATGATTT TATTGCATGATAGATTTTTTTATGATTTTTTAAATCATCTCCAGTATGAA GAGAAGAGAAAAAGTATAGAACCACCTTCCAGTTAATGTTGTAAAATACA TACATCATTCAAAGCTTTTGCTTACACAATTAATTAGAAATACATACATA CATTCATAATATGTAGATGCTTGCCCAGGACTGTACATATTTCATAACAA TGGTTGATATCACACATTCAAAAAAATATTTTTTTTACTGTATTGTGAAA GATATCATATCGTTGGTATTTAACAATGGGTTAATTGGAACTTGAAGTTG ACTTAAAGTAAGAAAAAGAAACAAATACGTAAGACCCCAGCAAAAAGCAA CAAAAAAATCATTTTTTATTCAGTTTTCTTTCGTTTATTGATGTTATTGA ACAACATGTTTAATAGGTAACATTGGTGGCCTGAGAAATTGGATTCGTAG AGCGTGTTGTCTGTGTCCTGGCTCAAGGCATTTTTGTCATTCAAATAATT CAACAACTTCAAGTTCCAATMCCCACCAGCAAACCATTTCCCTATCATCA TCAGTCGAATCATTCTCACATTATTATAGGAACTGATTTCGAAGACTGCA AGAACAACGTATGGAATGTCATGACTCAAATTAGTGCTGCTTTAAGTAAG TGATGCACGAAAAAGTTGTACACCTAACCCATTGACCACAATCATGTATA TTTTCTAATAAATTCTAGGAGGAAATACACTTGTACTTAAATCTGAAGGA CTAGCTCTAGAGCATCAACCTGACGCTTTTGGTGTTTACAGACTAATCGA TACTTTTAACAATAGACCTGCATATAAGCAAGACGAGGGCGAAAACTTTA TTTATTATAACGGAGGATCTAAATCTTGGATGGTTGGAACACGTATTGGA CATAATTATGGATGGGCTCGAGTTCCAAACAATACTAGTCATTGGGCCCC TTTCAATGGATGGGAATATTTCACTTCCGATAGGAAGATCTATGAATCAA ATGATAGAACACTCCGTCTTGAAGCACTTACAGGTACATTTATATATTTG AAATTCTTCATTTTGTTTGTAGTGCTACAATATTTAGTTATTGTAATCGT AATCGTAGTTTTAATCAATAGTTATGTTACTCACGCTTTTTTTTTTTTTG TCTTCTACTTATTTTTTGCGCTCAACCATCTGTTGAGCATATTTGCATAC CTACATACATACTCCAACTACTATCTTCCTGTAAGTGTACATACATTTGT GCATTAATATTAGGGTGACCATATTTTATGTTCCTAGAAATGAAATGCCT TGCTTAGAGGAGAGAGGGGATAATATTTTGAAATCAATAAATTTGAGAAT AAAGTACTAACGATTCTTGTTTTTATTTTTTTTATGAAATATATTTTGGA TTCTTATGTTTCCTTAAATTAAATTAATTTAATTGGCACGCCGACGGACT GGTTGTAAAAAAAAATTATGGTTGGTCACCTTAAATTATATATGTAATTA GATCCCGGATCTTTATATTTATGACATAATAATTGTACATATGTATGTAT GTCTACATATTGACACATCAATTAAATCACACATTATCTATTGGCCTTAT TATTGGAATTTTCCGTCACTCCATAGGAACCGAGACTCGGGTTTTTGGTC GATGGGGTTCAATACCGTGGTGGGCCATTTGCGCTTTACTTTTATTCCCC TTATTGTTCTTCCTTCTTTTTGGCGATCGGAGCAATTCGGGTCTTTTTTC GTCATCTTGCAAAGATCCTTGGACAACGTCGTCAATCAATCCTATATAAT AACCATTAATCACTTAGTATTAATTACAGAGGATGATCAAATCTTCTTCT CCTGTTCCCATGTTTTTCAACCCCAAGTTCTCATGTTCCCCAAATTCATA AATGCTTATGACATTCACTTATCACGAAATCGCACAGGGTAATTATTTTT TTTTGTTTTTTTGTTTCTTTTATTCTTCTTTTTTTTACCTTGTCTTCTTC TTCTATTCCTTTTTTCTATTTCTCMCATTCATTTGAATAGTGTTTTTTTT TTTTTTTTGAAATGTTCAATATTCGAGTAATCTTTTATTGTCTTCAGTCA ATGAAATTTATTATTTCATTTCTTCGTTAACTACCACACTTCTAGTCCTA TTTCTTTTCTTCTCTGTACATATCTACAGCATACATATACCAATATTTCC CTGTCTCTTAAAATATGTGCTTATTATCATTTAGTTACTTCAACCTCTTT ACTTTACTTTAATTGACATTCTGAAGATTCTGCATGATGTTCAGAAGTTC ATTTTGCGTATACGCACTATATACCAAGGGCATCGGAATCAATTCGTAAA CCAATGGCCTCTGGGCTCCCGATTCCTGTGTCCCTACTATTAAGAAATAC TCTATACATGTACTACGTATCCTTTTTTAAATGTATAAAGCCTATTTTTT AGAGTAAGATAAATATGAAATGAAAGAGAGGGAATAGAATTAAAACAACC GTGTAATGCATGTATTATGGAATTAAAATATTTAATGGGGTTGATCTATT TATTTTATGGCATCAAAATAATAATTCTTTAATAAAAAAGTTATTTTAAT TCCTTTCATTTTATAAATATTCTACTCAAGTAAAAAAAGAAAATCGTCCT TGTTTAAAAAAAAGGAAGGAAAAAAAATGAGTACTTGATTCATGTATATG TTAAGTATTCCTTTCTGTAATATACAAATCGTTGGCCCAGAGCGAAAGAG CAACAACTAATTACTTTTTATCAATAATTAGATTTGTTGTTTGTTACAAA CATATTAATTACATATACTTCAGGGGTGTCTGCAGAATTATATTATGTGT TAGGTAGGGAGGGGGGTAGTGCTTAGTTTTTGGATTTTTTTTCCAAAAAA ATATAGAAATTAGAATTATGAAAATTTTTGAAAAAAATTATCAAAAAATA AATTTTATATATTACATTTTTATTTTATTACAATATTATTCACAAAAATT AAATTTTTTGCAAAAAATTTCAAACATCCACAGCTATTCACAAAAAATTA AATTTTTGAAAAATAAATTGGAATTTTAAATATTTGGAACATAAATTGAA TTATTAAATTTCAAAAATTAATTTTTCTAGTAAAAAACAAGAATTCCTTA CTATTGCTCTGGGTCCACTTTTATGAAATTACATATTTCCATTTTTNNNN NATAATCACTTTGTATTTATACTTTTCTATTTCTTTCTTCCATTATTTTA GATGCTGAAGAGGCTGATAGTTCCATCCAGATTATTCGTGAAAAAGAGTT AACCAAGAACGAGTCCATAGAAAAGAATTGA
back to top
Add to Basket