EMLSAG00000006214, EMLSAG00000006214-688980 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000006214
Unique NameEMLSAG00000006214-688980
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
D F29 g2282_trehalose female
  1. PreAdult2
a bit short eggstrings (?), other wise normal. One very strange looking animal
female reproduction
24.08.2012 (All day)
03.10.2012 (All day)
Homology
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1 "Facilitated trehalose transporter Tret1" species:7176 "Culex quinquefasciatus" [GO:0005886 "plasma membrane" evidence=ISS] [GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS] [GO:0015771 "trehalose transport" evidence=ISS] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 eggNOG:COG0477 InterPro:IPR016196 SUPFAM:SSF103473 InterPro:IPR020846 PROSITE:PS50850 HOGENOM:HOG000202868 TIGRFAMs:TIGR00879 OrthoDB:EOG7N8ZV9 GO:GO:0015574 KO:K14258 EMBL:DS231885 RefSeq:XP_001846280.1 UniGene:Cpi.12494 ProteinModelPortal:B0WC46 STRING:7176.CPIJ004516-PA EnsemblMetazoa:CPIJ004516-RA GeneID:6036204 KEGG:cqu:CpipJ_CPIJ004516 VectorBase:CPIJ004516 PhylomeDB:B0WC46 Uniprot:B0WC46)

HSP 1 Score: 259.225 bits (661), Expect = 4.193e-78
Identity = 155/444 (34.91%), Postives = 256/444 (57.66%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G S  ++SP +V +  ++   F ++     W+  I+    + GG   G LI+  GRK  +   A  + +S  +I  A +  M+  GR L+G S G  S+S P Y+ E      RG LG++      IGILL  +A +Y  +    F         +I ++ IPE+P +++    +  AR  LQ LRG + D++ E   LK ++ S  +      ++A  DLLK  NLKPLLIS+ +M  QQ SGINAV+ Y+  IF+ A + +     TII+ +V  IATF A ++ D+LGR++LL IS  ++I+TL T+G ++++ ++  +++  I WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  +   +G +  F+++GS+ ++ L+  I +VPET+GK+L++I R
Sbjct:   56 QVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLVGGILGGPLIEYLGRKNTILATATPFIISWLLIACATHVAMVLVGRALSGFSVGVASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGNYMDWSELAFLGATLPVPFLILMFLIPETPRWYVSRGRDDRARKALQWLRGKKADVDPE---LKGIIKSHQDAERHASQSAMLDLLKKTNLKPLLISLGLMFFQQLSGINAVIFYTVQIFQDAGSTIDENLCTIIVGVVNFIATFIATLLIDRLGRKMLLYISDIAMIITLMTLGGFFYVKNNGGDVSH-IGWLPLASFVIFVLGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTFADIIASIGTHGAFWMFGSVCVVGLVFVIMYVPETQGKSLEDIER 495          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1-2 "Trehalose transporter 1-2" species:7227 "Drosophila melanogaster" [GO:0005355 "glucose transmembrane transporter activity" evidence=ISS] [GO:0005353 "fructose transmembrane transporter activity" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0016020 "membrane" evidence=IDA] [GO:0015771 "trehalose transport" evidence=IDA] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 EMBL:AE013599 GO:GO:0016021 GO:GO:0005886 eggNOG:COG0477 InterPro:IPR016196 SUPFAM:SSF103473 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 GO:GO:0022891 GeneTree:ENSGT00720000108754 OrthoDB:EOG7N8ZV9 KO:K14258 EMBL:AB369551 EMBL:AY122079 RefSeq:NP_610694.1 RefSeq:NP_725070.1 UniGene:Dm.13541 ProteinModelPortal:Q8MKK4 SMR:Q8MKK4 STRING:7227.FBpp0087180 PaxDb:Q8MKK4 PRIDE:Q8MKK4 EnsemblMetazoa:FBtr0088075 GeneID:36249 KEGG:dme:Dmel_CG8234 UCSC:CG8234-RA CTD:36249 FlyBase:FBgn0033644 InParanoid:Q8MKK4 PhylomeDB:Q8MKK4 GenomeRNAi:36249 NextBio:797550 Bgee:Q8MKK4 Uniprot:Q8MKK4)

HSP 1 Score: 257.299 bits (656), Expect = 1.132e-77
Identity = 155/441 (35.15%), Postives = 249/441 (56.46%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V ++ ++   F ++K    W+  I+   A+AGG   G LI+  GR+  +   AV + +S  +I  A    M+  GRFL G   G  S+S P Y+ E      RG LG++   +  IGIL+  +A  +  +    F         +I +  IPE+P + +    E  AR  L+ LRG E D+E E+  L    A  + +A  +   +L K  NLKPL IS+ +M  QQ SGINAV+ Y+  IFK A + +     TII+ +V   ATF   I+ D+LGR++LL +S  ++I+TL  +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++ +  NW   F+VT TF  L+  +G +  F+++G+I I+ L   I FVPET+GK+L+EI R
Sbjct:   28 QVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSH-LGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIER 467          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" species:7238 "Drosophila sechellia" [GO:0005886 "plasma membrane" evidence=ISS] [GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS] [GO:0015771 "trehalose transport" evidence=ISS] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 InterPro:IPR016196 SUPFAM:SSF103473 EMBL:CH480816 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 GO:GO:0022891 OrthoDB:EOG7N8ZV9 KO:K14258 RefSeq:XP_002033423.1 EnsemblMetazoa:FBtr0204284 GeneID:6608699 KEGG:dse:Dsec_GM21299 FlyBase:FBgn0176180 Uniprot:B4HNS1)

HSP 1 Score: 254.988 bits (650), Expect = 8.933e-77
Identity = 157/455 (34.51%), Postives = 253/455 (55.60%), Query Frame = 0
Query:    7 AVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            +V  E   +N    Q+  A   S  +L++G    ++SP +V ++ ++   F ++K    W+  I+   A+AGG   G LI+  GR+  +   AV + +S  +I  A    M+  GRFL G   G  S+S P Y+ E      RG LG++   +  IGIL+  +A  +  +    F         +I +  IPE+P + +    E  AR  L+ LRG E D+E E+  L    A  + +A  +   +L K  NLKPL IS+ +M  QQ SGINAV+ Y+  IFK A + +     TII+ +V   ATF   I+ D+LGR++LL +S  ++ILTL  +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++ +  NW   F+VT TF  L+  +G +  F+++G + I+ L   I +VPET+GK+L+EI R
Sbjct:   14 SVPAEGTKANFTFSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRNTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSILAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKDLMQSQAEADSQATRNTCLELFKRINLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLCTIIVGIVNFFATFMGIILIDRLGRKILLYVSDIAMILTLSILGGFFYCKAHGPDVSH-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGPHGAFWLFGVVCIVGLFFVIIYVPETRGKSLEEIER 467          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" species:7240 "Drosophila simulans" [GO:0005886 "plasma membrane" evidence=ISS] [GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS] [GO:0015771 "trehalose transport" evidence=ISS] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 InterPro:IPR016196 SUPFAM:SSF103473 EMBL:CM000362 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 GO:GO:0022891 OrthoDB:EOG7N8ZV9 KO:K14258 RefSeq:XP_002081065.1 UniGene:Dsi.2261 EnsemblMetazoa:FBtr0210718 GeneID:6734029 KEGG:dsi:Dsim_GD10808 FlyBase:FBgn0182571 Uniprot:B4QBN3)

HSP 1 Score: 253.832 bits (647), Expect = 2.508e-76
Identity = 157/455 (34.51%), Postives = 252/455 (55.38%), Query Frame = 0
Query:    7 AVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            +V  E   +N    Q+  A   S  +L++G    ++SP +V ++ ++   F ++K    W+  I+   A+AGG   G LI+  GR+  +   AV + +S  +I  A    M+  GRFL G   G  S+S P Y+ E      RG LG++   +  IGIL+  +A  +  +    F         +I +  IPE+P + +    E  AR  L+ LRG E D+E E+  L    A  + +A  +   +L K  NLKPL IS+ +M  QQ SGINAV+ Y+  IFK A + +     TII+ +V   ATF   ++ D+LGR++LL IS  ++ILTL  +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++ +  NW   F+VT TF  L+  +G +  F+++G + I+ L   I  VPET+GK+L+EI R
Sbjct:   14 SVPAEGPKANFTFSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRTTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKDLMQSQAEADSQARRNTCLELFKRINLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLCTIIVGIVNFFATFMGILLIDRLGRKILLYISDIAMILTLSILGGFFYCKAHGPDVSH-LGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGVVCIVGLFFVIICVPETRGKSLEEIER 467          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1 "Facilitated trehalose transporter Tret1" species:319348 "Polypedilum vanderplanki" [GO:0005886 "plasma membrane" evidence=IDA] [GO:0015574 "trehalose transmembrane transporter activity" evidence=IDA] [GO:0015771 "trehalose transport" evidence=IDA] [GO:0015767 "lactose transport" evidence=IDA] [GO:0015768 "maltose transport" evidence=IDA] [GO:0015770 "sucrose transport" evidence=IDA] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 GO:GO:0006950 InterPro:IPR016196 SUPFAM:SSF103473 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 GO:GO:0015574 EMBL:AB272983 ProteinModelPortal:A5LGM7 Uniprot:A5LGM7)

HSP 1 Score: 254.218 bits (648), Expect = 2.678e-76
Identity = 167/465 (35.91%), Postives = 261/465 (56.13%), Query Frame = 0
Query:    2 EDTNNAVNVEIRSSNG-FLYQLFTASIA-SQAALLMGCSLGWSSPVIVLLSKSK-DGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            ED    + +   ++N  ++Y    A+IA S  ++++G +  ++SP +V +  +    F +++ E  W+  I+    +AGG   G  I+  GRK  +   AV + ++  +I  A   WM+ AGR L+G   G  S+S P Y+ E      RG LG++      IGIL+  +A  Y  +    F         ++    IPE+P + +    E  AR  LQ LRG + D+E E   LK +V S  E      + A  DL+K  NLKPLLI++ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V   ATFFA ++ D+LGR++LL IS  ++++TL T+GT+++  +   +++  I WLPL    ++VI FS G GPIPWL++ EI   +I+G  +++A+G NW   F+VT TF  +   +G +  F+ +G I +I L   I FVPET+GK+L+EI R
Sbjct:   22 EDGKAKLEIYRPTTNPIYIYTQILAAIAVSMGSMVVGFASAYTSPALVSMQNTTITSFKVTEQEASWVGGIMPLAGLAGGIAGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPETPRWFVTRGREERARKALQWLRGKKADVEPE---LKGIVKSHCEAERHASQNAIFDLMKRSNLKPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVNFGATFFATVLIDRLGRKILLYISEVAMVITLLTLGTFFYYKNSGNDVSN-IGWLPLASFVIYVIGFSSGVGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADIVAAIGNHGAFWFFGVICLIGLFFVIFFVPETQGKSLEEIER 482          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1 "Facilitated trehalose transporter Tret1" species:7165 "Anopheles gambiae" [GO:0005886 "plasma membrane" evidence=IDA] [GO:0015574 "trehalose transmembrane transporter activity" evidence=IDA] [GO:0015771 "trehalose transport" evidence=IDA] [GO:0015767 "lactose transport" evidence=IDA] [GO:0015768 "maltose transport" evidence=IDA] [GO:0015770 "sucrose transport" evidence=IDA] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 eggNOG:COG0477 InterPro:IPR016196 SUPFAM:SSF103473 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 EMBL:AAAB01008960 OrthoDB:EOG7N8ZV9 GO:GO:0015574 KO:K14258 OMA:DIERKMM HOGENOM:HOG000230660 EMBL:AB369548 RefSeq:XP_001688679.1 RefSeq:XP_001688680.1 RefSeq:XP_315568.3 ProteinModelPortal:Q7PIR5 STRING:7165.AGAP005563-PA EnsemblMetazoa:AGAP005563-RA GeneID:1276247 KEGG:aga:AgaP_AGAP005563 VectorBase:AGAP005563 CTD:1276247 PhylomeDB:Q7PIR5 Uniprot:Q7PIR5)

HSP 1 Score: 256.529 bits (654), Expect = 1.070e-74
Identity = 159/441 (36.05%), Postives = 258/441 (58.50%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHMVI----FLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G S  ++SP +V +  ++   F ++     W+  I+    +AGG   G +I+  GRK  +   A  + +S  +I  A +  M+  GR L+G+  G  S+S P Y+ E      RG LG++      IGILL  +A   LD+    + G  + I     ++ IPE+P +++  N E  AR  LQ LRG + D+E E+  +          A+ S   DLL   NLKPLLIS+ +M  QQ SGINAV+ Y+  IF+SA + +     TII+ +V  IATF A ++ D+LGR++LL IS  ++I+TL T+GT++++ ++  ++++ I WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  ++  +G +  F+++GSI I+ L+  I +VPET+GK+L++I R
Sbjct:  332 QVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLAGGILGGPMIEYLGRKNTILATATPFIISWLLIGCATHVAMVLVGRALSGLCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYLDWSGLAFLGAALPIPFLLLMFLIPETPRWYVSRNREDRARKALQWLRGRKADVEPELKGISKSHQDAERHASSSAMLDLLNKANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQSAGSTIDEKLCTIIVGVVNFIATFIATVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVSE-IGWLPLAAFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTFADITASIGNHGAFWMFGSICIVGLLFVIVYVPETQGKSLEDIER 771          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:CG10960 species:7227 "Drosophila melanogaster" [GO:0005355 "glucose transmembrane transporter activity" evidence=ISS] [GO:0016021 "integral component of membrane" evidence=IEA] [GO:0055085 "transmembrane transport" evidence=IEA] [GO:0046427 "positive regulation of JAK-STAT cascade" evidence=IMP] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00217 GO:GO:0016021 EMBL:AE014296 InterPro:IPR016196 SUPFAM:SSF103473 GO:GO:0046427 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 GO:GO:0022891 GeneTree:ENSGT00720000108754 UniGene:Dm.11335 GeneID:39458 KEGG:dme:Dmel_CG10960 FlyBase:FBgn0036316 GenomeRNAi:39458 NextBio:813747 EMBL:AY119564 RefSeq:NP_648605.1 SMR:Q9VU17 MINT:MINT-883914 EnsemblMetazoa:FBtr0075942 UCSC:CG10960-RB InParanoid:Q9VU17 OMA:NENGAKY Uniprot:Q9VU17)

HSP 1 Score: 249.595 bits (636), Expect = 3.883e-74
Identity = 155/433 (35.80%), Postives = 241/433 (55.66%), Query Frame = 0
Query:   39 LGWSSPVIVLLSKSKDG--FVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLI-NLALDYCFYYYN---GFHMVIF---LYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNV--VASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNE-VPQ 458
            LGW+SP    +    +G  F + K +  W+ S +  GA       G+LI+  GRK  +    + + L   +++ A    ML+A RF+ G++ G   ++AP Y  EI+    RG LG  FQ+M+TIGIL +  +      ++ +   G   +IF    +F+PESP Y +  +    A   +Q LRG E D E E+  L+        N+   ++ L +    K L IS+ +M  QQ  GINAV+ Y+  IF  A+T ++    TI++ ++ V+ATF + +V DKLGRR+LL  SG S+ ++   IG Y+FL   +     ++ WLP+  L L +I FS+GYGP+PWL+M E+FA +IKGF  ++A  SNW + F+VT TF  L+D +G    F+++  + ++ +I     VPETKGK+L+EI +    N   PQ
Sbjct:  101 LGWTSPAETEIVDRGEGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANKVNVWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCLFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQ 533          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1 "Facilitated trehalose transporter Tret1" species:46245 "Drosophila pseudoobscura pseudoobscura" [GO:0005886 "plasma membrane" evidence=ISS] [GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS] [GO:0015771 "trehalose transport" evidence=ISS] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 eggNOG:COG0477 InterPro:IPR016196 SUPFAM:SSF103473 EMBL:CM000071 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 OrthoDB:EOG7N8ZV9 GO:GO:0015574 KO:K14258 RefSeq:XP_001360559.2 STRING:7237.FBpp0277612 GeneID:4803914 KEGG:dpo:Dpse_GA15593 FlyBase:FBgn0075610 InParanoid:Q291H8 Uniprot:Q291H8)

HSP 1 Score: 253.832 bits (647), Expect = 2.300e-73
Identity = 158/441 (35.83%), Postives = 254/441 (57.60%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V + +++   F ++     W+  I+    +AGG   G  I+  GR+  +   A+ + +S  +I  A    M+ AGRFL G   G  S+S P Y+ E      RG LG++      IGILL  +A   +D+    + G  +    +I ++ IPE+P + +    E  AR  L  LRG E D+E E+  L    A  + +A  +   +LLK  NLKPL IS+ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V  +ATF A ++ D+ GR++LL +S  ++I+TLF +G +++  SH  ++++ + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  + D +G +  F+++GSI  I L   I +VPET+GKTL++I R
Sbjct:  407 QVLAALSVSLGSLVVGFVSAYTSPALVSMTNRNMTSFEVTPQAASWVGGIMPLAGLAGGIAGGPFIEYLGRRNTILATAIPFIVSSLLIACAVNVAMVLAGRFLAGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGTYMDWSMLAFLGAALPVPFLILMFLIPETPRWFVSRGREEKARKALSWLRGKEADVEPELKGLMRSQADADRQATQNKMMELLKRNNLKPLSISLGLMFFQQLSGINAVIFYTVSIFKDAGSTIDGNLCTIIVGIVNFMATFIATLLIDRAGRKILLYVSNIAMIITLFVLGGFFYCKSHGQDVSQ-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPSKIRGSAASVATAFNWSCTFVVTKTFQDMIDFMGAHGAFWLFGSICFIGLFFVILYVPETQGKTLEDIER 846          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1 "Facilitated trehalose transporter Tret1" species:7234 "Drosophila persimilis" [GO:0005886 "plasma membrane" evidence=ISS] [GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS] [GO:0015771 "trehalose transport" evidence=ISS] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 InterPro:IPR016196 SUPFAM:SSF103473 EMBL:CH479181 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 OrthoDB:EOG7N8ZV9 GO:GO:0015574 KO:K14258 RefSeq:XP_002016109.1 GeneID:6590176 KEGG:dpe:Dper_GL11419 FlyBase:FBgn0149028 Uniprot:B4GAP7)

HSP 1 Score: 253.832 bits (647), Expect = 2.324e-73
Identity = 158/441 (35.83%), Postives = 254/441 (57.60%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V + +++   F ++     W+  I+    +AGG   G  I+  GR+  +   A+ + +S  +I  A    M+ AGRFL G   G  S+S P Y+ E      RG LG++      IGILL  +A   +D+    + G  +    +I ++ IPE+P + +    E  AR  L  LRG E D+E E+  L    A  + +A  +   +LLK  NLKPL IS+ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V  +ATF A ++ D+ GR++LL +S  ++I+TLF +G +++  SH  ++++ + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  + D +G +  F+++GSI  I L   I +VPET+GKTL++I R
Sbjct:  408 QVLAALSVSLGSLVVGFVSAYTSPALVSMTNRNMTSFEVTPQAASWVGGIMPLAGLAGGIAGGPFIEYLGRRNTILATAIPFIVSSLLIACAVNVAMVLAGRFLAGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGTYMDWSMLAFLGAALPVPFLILMFLIPETPRWFVSRGREEKARKALSWLRGKEADVEPELKGLMRSQADADRQATQNKMMELLKRNNLKPLSISLGLMFFQQLSGINAVIFYTVSIFKDAGSTIDGNLCTIIVGIVNFMATFIATLLIDRAGRKILLYVSNIAMIITLFVLGGFFYCKSHGQDVSQ-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPSKIRGSAASVATAFNWSCTFVVTKTFQDMIDFMGAHGAFWLFGSICFIGLFFVILYVPETQGKTLEDIER 847          
BLAST of EMLSAG00000006214 vs. GO
Match: - (symbol:Tret1 "Facilitated trehalose transporter Tret1" species:7217 "Drosophila ananassae" [GO:0005886 "plasma membrane" evidence=ISS] [GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS] [GO:0015771 "trehalose transport" evidence=ISS] InterPro:IPR003663 InterPro:IPR005828 InterPro:IPR005829 Pfam:PF00083 PRINTS:PR00171 PROSITE:PS00216 PROSITE:PS00217 GO:GO:0016021 GO:GO:0005886 eggNOG:COG0477 InterPro:IPR016196 SUPFAM:SSF103473 EMBL:CH902619 InterPro:IPR020846 PROSITE:PS50850 TIGRFAMs:TIGR00879 OrthoDB:EOG7N8ZV9 GO:GO:0015574 KO:K14258 RefSeq:XP_001959931.1 STRING:7217.FBpp0116306 GeneID:6495957 KEGG:dan:Dana_GF13114 FlyBase:FBgn0090147 InParanoid:B3MG58 Uniprot:B3MG58)

HSP 1 Score: 249.21 bits (635), Expect = 1.223e-71
Identity = 154/441 (34.92%), Postives = 252/441 (57.14%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V ++ ++   F ++     W+  I+    +AGG   G  I+  GR+  +   AV + +S  +I  A    M+ AGRFL G   G  S+S P Y+ E      RG LG++      IGILL  +A   +D+    + G  +    ++ ++ IPE+P + +    E  AR  L  LRG E D+E E+  L    A  + +   +   +LLK  N KPL IS+ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V  +ATF A ++ D+ GR++LL +S  ++I+TLF +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  + D++G +  F+++G+I  I L   I +VPET+GKTL++I R
Sbjct:  405 QVLAALSVSLGSLVVGFVSAYTSPALVSMVDRNITSFEVTPQAASWVGGIMPLAGLAGGIAGGPFIEYLGRRNTILATAVPFIVSSLLIACAVNVAMVLAGRFLAGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGTYMDWSMLAFLGAALPVPFLVLMFLIPETPRWFVSRGREERARKALSWLRGKEADVEPELKGLMRSQADADRQGTQNTMLELLKRSNFKPLSISLGLMFFQQLSGINAVIFYTVSIFKDAGSTIDGNVCTIIVGVVNFLATFIATLLIDRAGRKILLYVSNIAMIITLFVLGGFFYCKAHGPDVSH-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPAKIRGSAASVATAFNWTCTFVVTKTFQDMIDVMGAHGAFWLFGAICFIGLFFVILYVPETQGKTLEDIER 844          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592914092|gb|GAXK01044283.1| (TSA: Calanus finmarchicus comp130728_c1_seq2 transcribed RNA sequence)

HSP 1 Score: 294.664 bits (753), Expect = 3.799e-91
Identity = 177/449 (39.42%), Postives = 273/449 (60.80%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKSK--DGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLI---NLALDYCFYYYNGFHMV----IFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEV-NVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSH--NYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLFKPNEVP 457
            Q F A  A+   L+MG S+GWSSP   LL+K++  DGF L+  E  W+  ++  GA+ GG   G L+ K GRK A+   A ++A+S  ++V A   W+++ GRF  GV  G  SI  P Y++E ++AS RG LG   Q+MVT G++L+    +   + +   +   M+    I L F+PE+P ++L       AR  L+ LRG   +++E  ++LK+V  S    A   DL  S NL P +IS+ +M+GQQ SG+NAV+ Y  SIF+ + ++L      II+  V ++AT FAA+V DK GRR+LL  S S +++++  +G ++++  +  + ++AK I  LP+  LSL V +FS+G+GPIPWL+MSE+F+PE+K   S+I++  NW + FLVT  F  +   V +   F+++G   I+       FVPETKGK+LDEI +LF+ +E P
Sbjct:  287 QFFAAFAATLGNLVMGTSIGWSSPAGPLLAKTEQEDGFNLTDDENSWVGCLMPAGALLGGQVGGLLMTKLGRKGAMMTGAAMFAISYLLLVVAPNVWVIYVGRFCTGVCTGICSIVCPVYVAETATASRRGFLGSCVQLMVTFGVMLVIVVGVCGSWRWISISCLVMIVVWMIALIFVPETPAHYLSQKKYREARESLEWLRGTVHVDQEYQDILKSVEESAKLSAGLGDLFSSSNLAPFIISLWLMLGQQFSGMNAVMFYCVSIFQQSGSSLNSNVANIIIGGVQIVATIFAALVMDKAGRRLLLNFSSSLMVISIGALGAFFYIADNLGDEDLAKKIELLPVASLSLFVFAFSIGFGPIPWLMMSELFSPEVKSLASSISTTFNWTLAFLVTKFFTTMVAAVTEAGAFWMFGGFTILTFFFCFFFVPETKGKSLDEIQQLFR-SEKP 1630          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592914093|gb|GAXK01044282.1| (TSA: Calanus finmarchicus comp130728_c1_seq1 transcribed RNA sequence)

HSP 1 Score: 293.123 bits (749), Expect = 2.002e-90
Identity = 175/447 (39.15%), Postives = 269/447 (60.18%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSK--SKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLI---NLALDYCFYYYNGFHMV----IFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEV-NVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSH--NYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLFKPNE 455
            Q F A  A+   L+MG  +GWSSP   LL+K   +DGF LS  E  W+  ++  GA+ GG   G L+ K GRK A+   A ++A+S  ++V A   W+++ GRF  GV  G  SI  P Y++E ++AS RG LG   Q+MVT G++L+    +   + +   +   M+    I L F+PE+P ++L       AR  L+ LRG   +++E  ++LK+V  S    A   DL  S NL P +IS+ +M+GQQ SG+NAV+ Y  SIF+ + ++L      II+  V ++AT FAA+V DK GRR+LL  S S +++++  +G ++++  +  + ++AK I  LP+  LSL V +FS+G+GPIPWL+MSE+F+PE+K   S+I++  NW + FLVT  F  +   V +   F+++G   I+       FVPETKGK+LDEI +LF+  +
Sbjct:  323 QFFAAFAATLGNLVMGTCIGWSSPAGPLLAKPEEEDGFSLSDDENSWVGCLMPAGALLGGQVGGLLMTKLGRKGAMMTGAAMFAVSYLLLVVAPNVWVIYVGRFCTGVCTGICSIVCPVYVAETATASRRGFLGSCVQLMVTFGVMLVIVVGVCGSWRWISISCLVMIVVWMIALIFVPETPAHYLSQKKYREARESLEWLRGTVHVDQEYQDILKSVEESAKLSAGLGDLFSSSNLAPFIISLWLMLGQQFSGMNAVMFYCVSIFQQSGSSLNSNVANIIIGGVQIVATIFAALVMDKAGRRLLLNFSSSLMVISIGALGAFFYIADNLGDEDLAKKIELLPVASLSLFVFAFSIGFGPIPWLMMSELFSPEVKSLASSISTTFNWTLAFLVTKFFTTMVAAVTEAGAFWMFGGFTILTFFFCFFFVPETKGKSLDEIQQLFRSEK 1663          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592781903|gb|GAXK01172665.1| (TSA: Calanus finmarchicus comp1812412_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 275.404 bits (703), Expect = 2.550e-85
Identity = 173/448 (38.62%), Postives = 268/448 (59.82%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKS--KDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILL-INLALDYCFYYYN----GFHMV--IFLYFIPESPVYHLINNNEPLARSVLQRLRGDED---IEEEVNVLKN-VVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNY---EIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLFK 452
            Q F A +A+  + + G S GW SPV+  L KS    GF +  + EGW+ S +  GA+ GGP AG L+D  GRK  + V A+L+A+S  V+V +     ++AGR   G+  G  S+  P YI+E +S   RG LG   Q++VT+G+L   +L     + + +    GF ++    L  +PE+P YH+    E  A + L  LRG ED   I EE+  +K  V+ + + ++ F+ + +  NL PLLI++L+M  QQ SGI+ V+ Y++ IF  A ++L P  +TI++  V V+ATF  A + D+LGRR LL  S   ++L++  +G ++F+  HN    E+A T+  LP++ LS+ + +FS+G GPIPWL+MSE+F+P  +G  S+I    NW + F+    FP L  L+G  + F+  G+I+++  +L    VPETKGKTL+EI RLF+
Sbjct:   18 QYFVALVAAFGSFVFGTSGGWPSPVLPQLRKSFTDGGFYIDDASEGWVGSTMPIGALIGGPVAGLLVDLIGRKHTMMVTALLFAMSYLVLVISPNIMFVYAGRIATGLCTGMASLVCPLYIAETASPDVRGFLGSWIQLLVTVGVLASYSLGAIVTWRWLSAICIGFSLIWMCILILVPETPSYHISKGLETDATASLVWLRGVEDKRDISEELEEIKEGVILASSNRSGFTTIFQRQNLIPLLIALLLMFSQQFSGISVVIVYTDDIFADAGSSLAPSTQTIVLGGVQVVATFIGAALMDRLGRRFLLMFSSVVMLLSICVLGAFFFIK-HNLDDIELANTLSVLPIVALSIFIAAFSVGLGPIPWLMMSELFSPSTRGMASSIVVCFNWSLCFVTIKFFPGLKILIGMAITFWCLGAILMVCTVLIFLTVPETKGKTLEEIQRLFE 1358          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592879872|gb|GAXK01078029.1| (TSA: Calanus finmarchicus comp3136550_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 246.514 bits (628), Expect = 2.522e-74
Identity = 145/390 (37.18%), Postives = 225/390 (57.69%), Query Frame = 0
Query:   84 LIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILL---------------INLALDYCFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEV-NVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFL--DSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLFKPNE 455
            ++ K GRK A+ + + +YALS   +V A   W ++ GRFL G+  G  S+  P Y+ EI++  NRG LG   Q MVT+G+LL               + L  D  + +         L  +PE+P Y L  N E  AR+ L  LR   +IEEE+  +  ++  S        DL ++ NL P  IS+ +M+GQQ SGINAV+ Y   IF+++ ++L    E+ I+  V VI+TFF A + DK GRR+LL +S S + ++   +G ++F+  +  N  +A  I  LP+  +SL + +FS+G+GPIPWL+MSE+F+PE++   S+ A   NW + FLVT  F  + + V +   F+I+ +I++ + +  I FVPETKGK LD+I ++FK + 
Sbjct:    6 MMSKFGRKDAMLMVSSMYALSYLFLVVAPNPWFIYIGRFLTGICTGICSLVCPVYVGEIATPDNRGLLGSCIQGMVTVGVLLGMGIGSFNSWRWLSVVCLLADLAWAF--------LLLLVPETPAYLLSKNKEDEARASLSWLRNGSNIEEELLEIKSSLEESSKLSGNIRDLFRAPNLAPFTISMFLMLGQQLSGINAVVFYVVDIFEASGSSLNSNLESCIVGGVQVISTFFGAYIMDKTGRRLLLNLSSSIMAVSAAGLGAFFFIAQNQDNTALASKIGMLPVASMSLFIFAFSIGFGPIPWLMMSELFSPEVRSLASSFAVSFNWILAFLVTKFFTNIVNAVSESFAFWIFTAILVGVFLFCIFFVPETKGKKLDDIQKMFKSDR 1151          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592767747|gb|GAXK01186821.1| (TSA: Calanus finmarchicus comp1504958_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 223.016 bits (567), Expect = 4.454e-65
Identity = 153/445 (34.38%), Postives = 244/445 (54.83%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVS-AQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYC-FYYYNGFHMVIFLYF---IPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLF-KPNE 455
            Q+  A   S  +L++G +  WSSP I  L        +S +E  W+ S++   A+ GG   G  +DK GRK+ + ++  L  ++ G++V+ A   +M++AGR + G   G  S+S P Y++E      RG+LG++   +  +G+L+       +D+      +    + FL     IPESP + +       A   L+ LRG + +  +E   LK+      +       L   +L PL + + +MM QQ SGINAV+ YS SIF  + +   P   TII+ +V + AT  + ++ D+LGR++LL IS   ++++L  +G +Y    H+  I+      PL+ L +++ISFS G+GPIPWLLM E+     +G  +AI +GSNW   F VT TF  L +LVG   VF++YG +  + L+  +  VPET+GK+L+EI RLF KP+E
Sbjct:   90 QIRAAIAVSLGSLVVGFTSAWSSPAIASLQSEGSIIPISDTEASWVGSLMPLTALVGGLTGGTALDKIGRKMTI-LSTSLPFIAAGLMVTFASNVYMIYAGRAVAGFCIGVMSLSLPVYLAETIHPEVRGRLGMLPTTLGNMGVLICYACGAWMDWSQLSLVSAVLPIPFLAMMCPIPESPTFLMSKQKNMKALKSLEWLRGQNNETSDEFLRLKSAEKENMKSRTTGFPLTRSDLHPLSLCLGLMMFQQLSGINAVMFYSVSIFVDSGSA-TPHVSTIILGVVNIFATIMSNLLIDRLGRKILLYISSMGMMISLGVLGAHY----HSEAISTVT---PLVALVVYIISFSFGFGPIPWLLMGELLPSRSRGTCAAITTGSNWAATFAVTKTFLDLKNLVGAATVFWMYGLVCGLALLFIMVCVPETRGKSLEEIERLFTKPHE 1397          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592954787|gb|GAXK01003766.1| (TSA: Calanus finmarchicus comp455036_c3_seq2 transcribed RNA sequence)

HSP 1 Score: 210.305 bits (534), Expect = 5.594e-60
Identity = 145/455 (31.87%), Postives = 244/455 (53.63%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEG-WLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFY-YYNGFHMV------IFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEV-NVLKNVVASLN-EKAAFSDLL-KSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSA--HTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFL----DSH-----NYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLFK 452
            QL  A  A+  A   G  L W +P +  +    D  +    EEG W+A+I + G +  GP AG+L+ + G+K  + + A+ +     +I+ +    ML+ GR L G S G   + AP+Y SEI+  S RG LG + Q++ T+G+L + +   Y  +   +G  +V      ++++F+PESPV+ +       A+  L  LRG   D+E E+  + +NV AS +     F  L+     L P+L+S+++M  QQ SG+NAV+SY+  IFK A     L P    I++ +   +    + ++ D+ GR+VLL  S   + ++L  +G Y++L    DS      + +  K +  +PL+ L   + +FS+G+GP+PW+L SE+F+ E K   SA  +  NW   FLV   +P   + +  +  +F +G+I ++  +  + FVPETKGKT +++   FK
Sbjct:  100 QLVPALAATIGAFGCGNVLAWPAPALEAIVDCADCDISLTEEEGSWVAAIAYIGCVCVGPFAGFLMPRLGKKWTMIILALPFIAGWLMIIFSVNAPMLYIGRLLTGFSAGAFGLLAPSYTSEIAEPSIRGALGSLQQLVATLGVLFVTVVGKYVTWRVLSGILLVFPTLMAVWMFFMPESPVFLISKGRRDDAKKALLFLRGPHIDVEPELLTIEQNVEASKHVGSVGFVTLISDKVYLIPILLSMVLMFLQQFSGVNAVISYAVQIFKDAGLEDTLDPFICNILVAISQSVFVVVSMLLVDRFGRKVLLIASDFLMSVSLIALGVYFYLKFEVDSKAETYISEDTLKDLAVVPLVALLSFIAAFSIGFGPLPWVLNSELFSKEAKAPASAFCASFNWMCSFLVVKLYPTADESLHTHNTYFFFGAICLLGTVFIMLFVPETKGKTEEDMKEYFK 1464          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592954788|gb|GAXK01003765.1| (TSA: Calanus finmarchicus comp455036_c3_seq1 transcribed RNA sequence)

HSP 1 Score: 210.305 bits (534), Expect = 7.515e-60
Identity = 145/455 (31.87%), Postives = 244/455 (53.63%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEG-WLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFY-YYNGFHMV------IFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEV-NVLKNVVASLN-EKAAFSDLL-KSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSA--HTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFL----DSH-----NYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLFK 452
            QL  A  A+  A   G  L W +P +  +    D  +    EEG W+A+I + G +  GP AG+L+ + G+K  + + A+ +     +I+ +    ML+ GR L G S G   + AP+Y SEI+  S RG LG + Q++ T+G+L + +   Y  +   +G  +V      ++++F+PESPV+ +       A+  L  LRG   D+E E+  + +NV AS +     F  L+     L P+L+S+++M  QQ SG+NAV+SY+  IFK A     L P    I++ +   +    + ++ D+ GR+VLL  S   + ++L  +G Y++L    DS      + +  K +  +PL+ L   + +FS+G+GP+PW+L SE+F+ E K   SA  +  NW   FLV   +P   + +  +  +F +G+I ++  +  + FVPETKGKT +++   FK
Sbjct:  100 QLVPALAATIGAFGCGNVLAWPAPALEAIVDCADCDISLTEEEGSWVAAIAYIGCVCVGPFAGFLMPRLGKKWTMIILALPFIAGWLMIIFSVNAPMLYIGRLLTGFSAGAFGLLAPSYTSEIAEPSIRGALGSLQQLVATLGVLFVTVVGKYVTWRVLSGILLVFPTLMAVWMFFMPESPVFLISKGRRDDAKKALLFLRGPHIDVEPELLTIEQNVEASKHVGSVGFVTLISDKVYLIPILLSMVLMFLQQFSGVNAVISYAVQIFKDAGLEDTLDPFICNILVAISQSVFVVVSMLLVDRFGRKVLLIASDFLMSVSLIALGVYFYLKFEVDSKAETYISEDTLKDLAVVPLVALLSFIAAFSIGFGPLPWVLNSELFSKEAKAPASAFCASFNWMCSFLVVKLYPTADESLHTHNTYFFFGAICLLGTVFIMLFVPETKGKTEEDMKEYFK 1464          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592913837|gb|GAXK01044538.1| (TSA: Calanus finmarchicus comp242096_c2_seq3 transcribed RNA sequence)

HSP 1 Score: 206.068 bits (523), Expect = 1.963e-58
Identity = 149/490 (30.41%), Postives = 244/490 (49.80%), Query Frame = 0
Query:    7 AVNVEIRSSNG--FLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFH------MVIFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNEKAAFSDLLKSCN---LKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYY-----------------FLDSHNYEIA----------KTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLF--KPNE 455
            A N+ ++ S G   L QL     A+  A  +G  + W +  I  +   +D   L+  +E  + +I   G+      A +     G+K  L   +V +     V+V A    ML AGR L G S G   ++AP Y +EI+ A  RG LG + Q+MV  GIL IN+     +   +G        + ++++F+P SPV+ +   N   AR  LQ LRG +  I+ E+ +++  V           +    N   LKP+ IS+++M  QQ SGIN VLSYS  IFKS+ +++      +++  + V  TFF  ++ +K GR+VLL IS   I +++  +  ++                  LD+ N   A           +  WLPL+ L + +++F++G+GPIPW+L  E+  PE +G  ++I +  NW + ++V    P L + +G    +FI+  I ++  +  I  VPETKGK+ D+I  LF  KP++
Sbjct:   99 ADNICVKMSEGSSLLPQLIATLGATLGAFALGNVIAWPATAIYQIGD-EDKMELTTEQESQVVAISMIGSAVVPIVAAFSFPAIGKKWTLIALSVPFIGGWVVLVFANSYGMLLAGRILTGFSGGAFVLAAPAYTAEIAEAKYRGALGALMQLMVCFGILFINVNCSTNWQLLSGLCIAFPALLAVWMFFMPRSPVFLVSKGNMEEARKSLQFLRGKNAKIDGELAMIEEDVKQSKSMGTVGPMQLFTNPQYLKPMGISLVLMSLQQLSGINYVLSYSTLIFKSSGSDIDSCLSAMLVGGIQVAGTFFTTLIIEKFGRKVLLVISDFFICVSMLGVAVFFKMYEDCAECKFEATTNSSLDAFNSSAATMGFVSKATVDSFGWLPLVSLMVFILAFAIGFGPIPWVLNVELMPPEARGIAASICTSFNWIISYIVAKFIPTLGEEIGASSCYFIFAGIALVGTVFIILVVPETKGKSEDDIRNLFSGKPSQ 1565          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592913838|gb|GAXK01044537.1| (TSA: Calanus finmarchicus comp242096_c2_seq2 transcribed RNA sequence)

HSP 1 Score: 196.823 bits (499), Expect = 9.553e-55
Identity = 146/494 (29.55%), Postives = 243/494 (49.19%), Query Frame = 0
Query:    7 AVNVEIRSSNG--FLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFH------MVIFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNEKAAFSDLLKSCN---LKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFL---------------------DSHNYEIAKTI----------RWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLF--KPNE 455
            A N+ ++ S G   L QL     A+  A  +G  + W +  I  +   +D   L+  +E  + +I   G+      A +     G+K  L   +V +     V+V A    ML AGR L G S G   ++AP Y +EI+ A  RG LG + Q+MV  GIL IN+     +   +G        + ++++F+P SPV+ +   N   AR  LQ LRG +  I+ E+ +++  V           +    N   LKP+ IS+++M  QQ SGIN VLSYS  IFKS+ +++      +++  + V  TF   ++ +K GR+VLL IS   I +++  +  ++ +                     +S    +A ++           WLPL+ L + V SFS+G+GPIPW++  E+  PE +G  +++ +  NW + ++V    P L + +     +FI+ +I ++  +  I  VPETKGK+ D+I  LF  KP++
Sbjct:   99 ADNICVKMSEGSSLLPQLIATLGATLGAFALGNVIAWPATAIYQIGD-EDKMELTTEQESQVVAISMIGSAVVPIVAAFSFPAIGKKWTLIALSVPFIGGWVVLVFANSYGMLLAGRILTGFSGGAFVLAAPAYTAEIAEAKYRGALGALMQLMVCFGILFINVNCSTNWQLLSGLCIAFPALLAVWMFFMPRSPVFLVSKGNMEEARKSLQFLRGKNAKIDGELAMIEEDVKQSKSMGTVGPMQLFTNPQYLKPMGISLVLMSLQQLSGINYVLSYSTLIFKSSGSDIDSCLSAMMVGAIQVGGTFLTTLIIEKFGRKVLLVISDFFICVSMVGVAVFFKMYEDCAECKFEAISTNSTSDAFNSSATTMAASVFVSEATINNFGWLPLVSLLVFVFSFSIGFGPIPWVMNVELMPPEARGIAASVCTSFNWIISYIVAKFIPTLGESIHASSCYFIFAAIALVGTVFIILVVPETKGKSEDDIRNLFSGKPSQ 1577          
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Match: gi|592761324|gb|GAXK01193089.1| (TSA: Calanus finmarchicus comp729906_c0_seq2 transcribed RNA sequence)

HSP 1 Score: 195.282 bits (495), Expect = 5.551e-54
Identity = 149/482 (30.91%), Postives = 240/482 (49.79%), Query Frame = 0
Query:    6 NAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDG-----FVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDY-------CFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNEKAAFS--DLLKSCN-LKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFL-DSHN--------------YEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGXXXXXXXXXXXAFVPETKGKTLDEIHRLFKPNE 455
            N   V    S  FL   F    A+  +  +G  L W +P +  LS +S  G      +LS  ++ W+A++L FGA   GP AG L+ + G+K  + + ++   +    ++ A    ML+ GRFL G S  F S+ AP YI+EI     RG L    Q+M  +G+L       +                +VI L FIP SP + L    +  A+S L   RG D ++ +E+  +++ V +  +K A +   +LKS   LKPL IS+++M+ QQ SGI  + SY   IF++A T       +I++ ++ V  T  + +V DK GRR LL +S   I +    +GT++++ +SH+               E    + WLPL  +    +++SMG GP+PW+L +E+F+ E K   S++ +  NW   F+V    P L +L+G    +  + ++      L +  VPETKGKT +EI + F   +
Sbjct:  295 NKYEVSTSRSGQFLATFF----ATIGSFGLGTVLSWPAPTLPQLSAQSCSGSCEGLLILSVEQQSWVAALLNFGAFTAGPLAGLLMPRYGKKRTMAILSLPIFIGWLCLIFASNVEMLYVGRFLTGFSGAF-SMLAPGYIAEICEVEIRGSLASFMQVMTMMGLLFTYTVGTFLPWRQLSAVCSVVPIVVVICLSFIPRSPSFLLSIGMKEDAKSALLFFRGKDSNVTKELIEIESSVDNREQKNALNIYGILKSKTYLKPLCISLVLMLLQQFSGIKVISSYIVQIFQNAGTKFDANICSIVVGVIQVTGTSISVLVVDKFGRRRLLILSEMFISIAFCMLGTFFYIQESHSPCPALDTCQDQFVTAETVDNLAWLPLASIVTFAVAYSMGMGPLPWVLNAELFSKEAKDHSSSLCASFNWLCSFMVVKFSPSLENLIGASGSYLSFAALAACGTFLIVISVPETKGKTEEEIQQGFNKGK 1725          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000006214 (pep:novel supercontig:LSalAtl2s:LSalAtl2s33:164805:166416:-1 gene:EMLSAG00000006214 transcript:EMLSAT00000006214 description:"maker-LSalAtl2s33-snap-gene-1.28")

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 475/475 (100.00%), Postives = 475/475 (100.00%), Query Frame = 0
Query:    1 MEDTNNAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEVNVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQNDEEGVEEEREELNEDD 475
            MEDTNNAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEVNVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQNDEEGVEEEREELNEDD
Sbjct:    1 MEDTNNAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEVNVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQNDEEGVEEEREELNEDD 475          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000001976 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1350:32996:37917:1 gene:EMLSAG00000001976 transcript:EMLSAT00000001976 description:"snap_masked-LSalAtl2s1350-processed-gene-0.2")

HSP 1 Score: 192.586 bits (488), Expect = 7.645e-57
Identity = 109/263 (41.44%), Postives = 168/263 (63.88%), Query Frame = 0
Query:  191 ESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNV-VASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLF 451
             +P + + NN    AR+ LQ LRG   DI  E+N ++ + + +L  K    +L K   +KPL +S+ +M  QQ SGINAVL YS SIF+SA +++     TII+ +V + AT F+ ++ D+LGR++LL IS   +I +L   G Y+++   N EI +    +PL+ L +++ISFS+G+GPIPWL+M EIF   I+G  +++++  NW   F+VT TF  L  ++GQ  VF+++  I+II     I FVPET+GKTL++I RL+
Sbjct:    2 STPRFLVANNKATAARASLQWLRGSHADITAELNEIEAMNILALKSKFKIKELFKMTYMKPLFVSMGLMFFQQFSGINAVLFYSVSIFESAGSSIDSNLATIILGIVNICATIFSNVLIDRLGRKILLYISLIGMIGSLGVFGAYFYM--RNSEILQLSGIIPLVALVVYIISFSVGFGPIPWLMMGEIFPARIRGPAASLSTAFNWTCTFVVTKTFMDLQIVLGQSGVFWLFAGILIISCFFVIFFVPETRGKTLEDIERLY 262          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000011269 (pep:novel supercontig:LSalAtl2s:LSalAtl2s772:258663:279791:1 gene:EMLSAG00000011269 transcript:EMLSAT00000011269 description:"maker-LSalAtl2s772-augustus-gene-2.12")

HSP 1 Score: 159.458 bits (402), Expect = 5.963e-43
Identity = 124/425 (29.18%), Postives = 212/425 (49.88%), Query Frame = 0
Query:   58 LSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLA--LGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYY--------NGFHMVIFLYFIPESPVY--HLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNEKAAFSDLLKSCN--LKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFK-PNEVPQNDEEGVEE 466
            L +S++   ASI  FG + G   AG L +  GRK +  +G    L  LS  +I  A     L  GRF +G   G+ +  +  Y+ EIS+   RG  G++  +   +G+L   +   Y   +               I L   PESP +  H+   +E  A+ V+Q +RG + +I+ E+N L+N +   +  +   DLL        PL IS+ +M+  Q SGI+ +L+Y+  IF +A  +      TI + + ++++      +  K+ RR +L +S   I  TL  +G Y+ L    +     I WLPL+ L +++ +F++GYG + W+  +EI   +I+   ++++ G    + FL+T TF +L  ++    VF++YG + ++  +  + F+PETK K   EI   FK   E PQ+    V+E
Sbjct:   95 LDESDQSLYASIPSFGMLLGSLSAGPLANIIGRKWSCIIGTCGSL-TLSFSLIAFAPNVISLQXGRFFSGCGLGYATTISTLYLIEISTPDTRGLSGVIPALFGALGVLTCQILGAYITNWRILAGILGTVNIPFFIALLPCPESPTFLIHVRKIDE--AQKVIQFIRGPNWNIDSEMNDLQNALLHTSSNS-MRDLLWGGREIWSPLFISLGLMLFSQFSGISIILNYTVDIFTAAAGSSDQFLGTICVGIALLLSNMCTLFLVSKMRRRTMLSVSSLGISFTLIVMGVYFHLKEIKHHSLDNISWLPLVDLMIYIFAFNLGYGALTWVTAAEILPSKIRSLATSLSVGFVCLISFLLTYTFGLLIGIIHIRGVFWLYGGLSLLGFLYILKFIPETKDKNEKEIQAHFKRKKESPQSAPLAVQE 515          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000012347 (pep:novel supercontig:LSalAtl2s:LSalAtl2s901:31947:33380:1 gene:EMLSAG00000012347 transcript:EMLSAT00000012347 description:"augustus_masked-LSalAtl2s901-processed-gene-0.0")

HSP 1 Score: 151.369 bits (381), Expect = 2.434e-40
Identity = 126/410 (30.73%), Postives = 215/410 (52.44%), Query Frame = 0
Query:   66 LASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKW---MLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLIN-------LALDYCFYYYNGFHM------VIFLYFIPESPVYHLIN-NNEPLARSVLQRLRGDEDIEEEVNVLKNVV-ASLNEKA-AFSDLLKSCNL-KPLLISILVMMGQQASGINAVLSYSESIFKSAHTNL-KPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYM-VFFIYGSIMIILLILSIAF-VPETKGKTLDEIHRLFK 452
            + SI   G + GG   G +  + GRK  L  N +L  L   ++  ++      +L  GR + G++ G  +  +P Y+SEIS  S RG +G ++Q+++T+ ILL         L  +  + Y  G  +      ++ L   PESP Y L++ ++E  A S L  LRG  ++ +E+  +KN   A+ N K  +F +++ + +L KPL+++ ++M+ QQ SGINA + YS SIF+SA  +L +    T+ M  + V  T  + ++ ++ GR+ L+ I     +  +F       L     +    + ++ ++     VI F+ G G IPW  ++E+F    +G  ++IA  +NW    LV L F     ++G Y+ +FFI   I+  L I+ + F VPETK KT++EI  +FK
Sbjct:   74 IVSIFCVGGMIGGTVVGTIASRVGRKGGLMWNNILAILGALLLFFSKMSGSAIVLILGRLVIGINSGINAGLSPMYLSEISPTSMRGAVGTVYQLIITMSILLAXILGMSSVLGNEAGWPYLLGLTVFPAILQLVTLPLCPESPKYLLLDVDDEQKALSSLNWLRGKVEVHDEIEEMKNEKEATKNMKTVSFMEIITNSSLRKPLIVAQMMMLAQQLSGINAAMFYSTSIFESAGLSLSESQYATLAMGAMNVGMTLVSLVLIERAGRKTLMLIG----LFIMFITTILLMLCLLLSKTVAVLSYVSIIMXIGFVIGFATGPGSIPWFFVTELFTQNARGMATSIAVVTNWTANTLVGLGFAPFQYILGPYVFLFFI---IVQFLFIIYVKFQVPETKNKTIEEITAVFK 476          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000011803 (pep:novel supercontig:LSalAtl2s:LSalAtl2s824:287074:289093:-1 gene:EMLSAG00000011803 transcript:EMLSAT00000011803 description:"maker-LSalAtl2s824-augustus-gene-2.41")

HSP 1 Score: 149.443 bits (376), Expect = 2.230e-39
Identity = 140/484 (28.93%), Postives = 224/484 (46.28%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVI-VLLSKSKD--GFVLSKSEE--GWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVS-AQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFH---------MVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEVNVLK---NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFL----DSHNYE-------------------------------IAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLF 451
            Q+F    AS    L G S+G++   I  L++ + D  GF    S++   W+ S+++ G I GG  + + +D  GR+  L      + LS  +++       M + GR LNG++ G     A  YI EISS   R  LG   Q M T+G+L  +  +   F+ +NG            ++  YF+PESP + L+   E  A   L+ LRG +D   E+ +LK    +V   NEK +   L+K    K LLIS+ +M     SG +  + YS SIF+   +++KP + TII+ LV++++   +     K  R+ ++ +S   I      IG   FL     S +Y                                +  +I WLPLLC+   +   ++G   + W++ SEI  P+ +   ++I     +  GFLVT TF    ++  +   F+IY  I +      + FVPETKGKT +E+   F
Sbjct:   41 QIFATLFASLGCFLNGTSIGYTGVAIPSLMNGTFDVYGFPADYSQQQVSWITSLMYVGCILGGLFSRFFMDFMGRRRTLLYIVNTFYLSGHILIFFGSCAEMFYIGRILNGIALGLELCVASVYIVEISSTDMRAILGYFIQFMGTLGVLY-SFTMGGLFFNWNGLTAASGVFIIPFILATYFMPESPHWLLLKGYEFQAVQSLEWLRGRDDAAVELEILKIKKYLVLKENEKLSGLGLIKESP-KTLLISLTMMFFWMFSGYSLYIVYSVSIFEMVGSSIKPSSATIIVGLVLLLSCLVSVYTVSKWSRKWMMIVSMFLIFFFNLIIGFCMFLHERAKSQDYNGSIEKHLFISEEINSLNETMVREEYLNLSQSVGVSIGWLPLLCVIGIIFFGNVGQATLIWIVTSEITPPKSRNIVNSILISFAFFCGFLVTKTFVDFVEIFKESKTFWIYSGIAVFGTFFIMIFVPETKGKTNNEMRIYF 522          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000006518 (pep:novel supercontig:LSalAtl2s:LSalAtl2s357:254996:268499:-1 gene:EMLSAG00000006518 transcript:EMLSAT00000006518 description:"maker-LSalAtl2s357-augustus-gene-2.13")

HSP 1 Score: 147.517 bits (371), Expect = 8.157e-39
Identity = 128/486 (26.34%), Postives = 219/486 (45.06%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKS----KDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLAL-GVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHMV--IFL-------YFIPESPVYHLINNNEPLARSVLQRLRGDED--IEEEVNVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLF-------------------TIGTYYFLDSHNYEIAKTI-----------------RWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPN 454
            Q     I +   LL G S+G++   I  L       K+   L++ +  W+ S+L  G   GG  + Y+++K GRK  L  + +  Y      I  A    M+  GRF  GV  G     A  Y+ EI+SA  R  L    Q M T+G+L  +      F  +N   ++  IFL        F+PESP + +    E  A   L+ LRG +D  I+ E+  +K  V    ++ +   +L   ++KP ++S+ +M     S  N ++ Y  +I ++A +++KP +  II  LV++++   + +V  K  R+ ++ +S     +  F                   TIG + F+ ++N      I                  WLPL C++  +   ++GYG + W + SEI  P+ +   +++     +  GF +T TF  L + V +   F+IYG I  +  + ++ F+PETKG   +EI   +  N
Sbjct:   56 QTLATGIITLGCLLNGSSIGYTGIAIPSLMNGTNIYKNPLNLNQQDISWITSLLPLGCFFGGLMSIYVMEKLGRKKTLLFITSTFYLFGYLFIYLASNMQMICTGRFFCGVGFGLELSVATVYVVEIASADMRRVLKHFVQFMGTLGVLF-SFITGGLFLDWNTLALINLIFLAPFALGLTFLPESPHWLIHKGYEYQASESLEWLRGRDDAAIDREIEKIKRHVMLRQKENSAGIMLLKGSIKPFIVSLFIMFFMIFSAQNMIIFYLSTILETAGSSIKPTSGVIICGLVLLLSCVVSLVVISKTKRKWVMVLSMFLTAVFHFILGGCMHFHENAKGPYYNGTIGKHLFMVAYNSSATGEIIYTHEHLTMNDTVAFGSGWLPLFCITSIIFIGNIGYGTLTWAVTSEIMPPKCRNTCNSVLLSMAFFCGFFITKTFVDLVESVNESGAFWIYGGITALGGLFTLIFIPETKGVPFEEIRNFYYKN 540          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000010913 (pep:novel supercontig:LSalAtl2s:LSalAtl2s72:122407:123843:-1 gene:EMLSAG00000010913 transcript:EMLSAT00000010913 description:"augustus_masked-LSalAtl2s72-processed-gene-1.0")

HSP 1 Score: 144.436 bits (363), Expect = 5.855e-38
Identity = 121/398 (30.40%), Postives = 197/398 (49.50%), Query Frame = 0
Query:   86 DKXGRKLALGVNAVLYALSLGVIVSAQYKWM-----LFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINL------------ALDYCFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSV--LQRLRGDEDIEEEVNVLKNVVASLNEKAAFSDLLKSCNL-KPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLA-ETIIMDLVMVIATFFAAIVSDKLGRRV--LLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQND 460
            +K GR+  L  N +L  + LGV++ +  K +     L  GR   G +CG  +   P Y++E++  + RG LG + Q+  T G LL  +             +             I L F PESP Y  I  N+   RS+  L++LRG  D+E+E N + +   S ++  +   ++ +  L KPL I+IL+ + QQ +GI  +  YS  IF+ A  + +  +  T+ +  VMV+ T     + DK GRR   L+ ++G ++   L TI   +F+      I+       ++     V+ F++G G IPWL+  E+FA E +   S+IA+  NW    +VTL FPI+     + + F  +G I++IL I     +PETK +T++EI  L   N  P+  
Sbjct:   75 EKVGRQKGLLFNQIL--VFLGVVLMSISKDISSYPSLVIGRLFMGGACGLFTGLVPLYVNEVAPINLRGGLGTVNQLAXTCGXLLAQILGQKEILGGSSWPILLSLSIIPAIIQSILLPFCPESPRYMAITKNDK-ERSLKALRKLRGTHDVEDEYNSIVS-EGSNSDSLSIKQVITASELRKPLTIAILMHLSQQITGIVGIFFYSSKIFRRAGISEESSSYATVGVGSVMVVMTLITIPLMDKSGRRPLHLIGMAGMTVACVLTTIA--FFVAGDTTTISGGATAFLIISTLTFVVFFALGPGSIPWLITGELFATESRPAASSIATTVNWTASLIVTLVFPIIP---AKKLTFVPFGIILVILFIPLYILLPETKNRTIEEILVLLNKNRKPKES 463          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000004187 (pep:novel supercontig:LSalAtl2s:LSalAtl2s221:105327:111902:-1 gene:EMLSAG00000004187 transcript:EMLSAT00000004187 description:"maker-LSalAtl2s221-augustus-gene-1.6")

HSP 1 Score: 119.783 bits (299), Expect = 1.446e-29
Identity = 111/399 (27.82%), Postives = 182/399 (45.61%), Query Frame = 0
Query:   84 LIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHMVI------FLYFI-----PESPVYHLINNNEPLARSVLQRLRG---------DED---IEEEVNVLK-NVVASLNEKAAFSD-LLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTY-YFLDSHNYEIAK--------TIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIH 448
            LI K GR+  L   ++ ++LS  +   A    M++   F  G       ++   YISEI+  S R  L    ++   +G LL + AL     + N   + I       + FI     PE+P + +  N +  A   L+ LRG         D+D   + EE+  L  N+     +++  S  ++ S   +PL I+  VM   + SG+ A   Y+  IF+ +  +  P    ++   V +I++  + I+ D +GR  LL IS   +   L   G + YF  S   E  +           W+PL C+   V +FS+G  PI WLL+ E+F  E +  G A+ +   +   F+   TF  L   +G +  F+ Y  I  I L+ ++ +VPETKG +LDE+ 
Sbjct:   95 LILKHGRRRILLFVSLPFSLSWLLTTIASNVEMIYVTAFAVGFCSSIVQLATQVYISEIAHPSIRASLCSSSKVFSQVG-LLTSFALGA---WLNWRQLAIVCAIGPIMTFIAALNVPETPSFLVFTNQDKRAERSLRWLRGASYYTHDAFDDDNMGVSEELATLHANIRMKREQRSCCSKKVVMSQLFRPLSITCGVMFFTRFSGVTAFNFYAVPIFRESFESFNPHLAAVLTGSVQLISSAMSGILCDLVGRLPLLVISSVLMSGALAGFGVFSYFQRSDFIEATEGGAILSYAQHDWIPLACVVTFVAAFSLGLNPISWLLIGEVFPIEYRSLGPALTTSFGYVCAFIGVKTFVDLRLWLGLFGTFWTYAVIAAIGLLFTLLYVPETKGMSLDEME 489          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000009294 (pep:novel supercontig:LSalAtl2s:LSalAtl2s595:126531:128399:1 gene:EMLSAG00000009294 transcript:EMLSAT00000009294 description:"augustus_masked-LSalAtl2s595-processed-gene-1.1")

HSP 1 Score: 109.768 bits (273), Expect = 3.087e-26
Identity = 130/456 (28.51%), Postives = 206/456 (45.18%), Query Frame = 0
Query:   27 IASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKW-MLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA------LDYCFYYYNGFH----MVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEVNVLKNVVASLNEKA-AFSDLLKSCN----LKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLA--ETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSH-NYEIAKT--IRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQNDE 461
            I +   + +G  LG+S+   V+L +    F  S  E+ W+ASI     I     AG L  K GRK++L +   L      ++  A+  + +L   R   G     + +    Y+ EIS   NR        I V IGI +I +A        Y   +  G      ++I L  +PESP + +       A   L++LR  + I +E++ +   + +  + A +F + ++  N    LKPL+I ++V    QA+G  AV  Y+  I      NL+  A    I + L+ VIA+        K  RR LL      + L LF I     L      EI  +   + LPL+ LSL+ + F +G   IP+LL+ E+   +IK   S+++ G      F V   FP L   +G  M +  YGS  + L I +   VPET  K+L E+  +F+  E+ ++ E
Sbjct:   21 IGAIPGMAIGTVLGYSA---VMLPRLGSKF--SLEEKSWIASITAIFPIFSCFMAGILAQKIGRKISLLIFLSLTCTGWIILPFAKESFALLMVSRIFQGFGIILSLLQ--LYLVEISELRNRDLNCSFPSIFVNIGITVIYIADTLIDDWSYVAVFGAGCTALSILLIILCGVPESPYWLIQIGRTEDAIKNLEKLRDLDSIPQEIDNITETIKNNGKMANSFKEQIQELNSLEVLKPLMILLIVGSLSQATGQYAVAFYAVDIIIEFLPNLRNEAYYTAIGVGLLRVIASILGIFFIKKFKRRSLLMSHSFMMGLCLFAISAIVGLKPFFRPEIVASWVFQILPLVLLSLYSLFFGLGVNLIPYLLVGELCPSKIKNLTSSLSIGLMSISIFXVVKIFPTLLATIGCSMTYLFYGSFCMGLAIFTYCCVPETSNKSLQELQGIFR-KEIQKDTE 468          
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Match: EMLSAP00000001825 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1314:155107:157706:1 gene:EMLSAG00000001825 transcript:EMLSAT00000001825 description:"maker-LSalAtl2s1314-augustus-gene-0.31")

HSP 1 Score: 108.997 bits (271), Expect = 5.699e-26
Identity = 115/448 (25.67%), Postives = 200/448 (44.64%), Query Frame = 0
Query:   44 PVIVLLSKSKDG-----FVLSKSEEGWLASI---------LFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLI---------NLALDYCFYYYNGFHMVIF---LYFIPESPVYHLINNNEPLARSVLQRLRGD-EDIEEEVN-VLKNVVASLN-EKAAFSDLLK------SCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLT-FPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNE 455
            P I L   + +G     FV+SK E  W A +         +FFG + G         + G +  L + A+L  +   +I  A    M+  GRFLNGV  G    S  T++SEI    +R        + ++ G+L+          NL    C     G   V+F   L  +P+SP ++        A+  L   R   +D+EEE   +++ +  S+  EK +F + +K      +C  KP +I  ++ + Q  SG+ AV++Y+  + + + T +     TII   + +     A  +   L R+ L+ IS     L   +I +   L     E      + P+  +SL+++SF+ G+  IP+L + E + P ++   + + S   + +GF + L  FP + +  G    F   G + +   I +   +PETKG TL++I  LF+  +
Sbjct:   26 PTIALSQLTNNGTESCSFVMSKEEGSWFAGLLGIGGICGSVFFGTLIG--------QRIGNRKTLLLAAILDIIGWLLIAFAVNSPMMMGGRFLNGVFVGTIGPSGYTFLSEIMHRKHRASCSQATSVAISAGMLVTYGLGSVISWNLLAIGC-----GISSVLFFIMLLTMPDSPYWNASIGKIEEAKKSLSHFRSKKDDVEEEFKEIMEGIQKSIKKEKISFFEAMKLLFTDETC-YKPFIILSVLFLIQTLSGLYAVIAYAIQVLEESRTPIDTNLGTIISGAMRLFFGTLAIPLFFYLPRKTLMYISTG---LACLSISSLGILGLLELETNTFTTYFPVGAISLYMVSFTFGFQSIPFLYLGEYYPPHVRQHLAGLTSTLRF-LGFFIMLKLFPQMMEFFGPNYTFIFLGLVCLFAGIYAKVVLPETKGLTLNQIQDLFRTKK 455          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681185|sp|B0WC46.1|TRET1_CULQU (RecName: Full=Facilitated trehalose transporter Tret1)

HSP 1 Score: 259.225 bits (661), Expect = 1.624e-79
Identity = 155/444 (34.91%), Postives = 256/444 (57.66%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G S  ++SP +V +  ++   F ++     W+  I+    + GG   G LI+  GRK  +   A  + +S  +I  A +  M+  GR L+G S G  S+S P Y+ E      RG LG++      IGILL  +A +Y  +    F         +I ++ IPE+P +++    +  AR  LQ LRG + D++ E   LK ++ S  +      ++A  DLLK  NLKPLLIS+ +M  QQ SGINAV+ Y+  IF+ A + +     TII+ +V  IATF A ++ D+LGR++LL IS  ++I+TL T+G ++++ ++  +++  I WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  +   +G +  F+++GS+ ++ L+  I +VPET+GK+L++I R
Sbjct:   56 QVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLVGGILGGPLIEYLGRKNTILATATPFIISWLLIACATHVAMVLVGRALSGFSVGVASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGNYMDWSELAFLGATLPVPFLILMFLIPETPRWYVSRGRDDRARKALQWLRGKKADVDPE---LKGIIKSHQDAERHASQSAMLDLLKKTNLKPLLISLGLMFFQQLSGINAVIFYTVQIFQDAGSTIDENLCTIIVGVVNFIATFIATLLIDRLGRKMLLYISDIAMIITLMTLGGFFYVKNNGGDVSH-IGWLPLASFVIFVLGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTFADIIASIGTHGAFWMFGSVCVVGLVFVIMYVPETQGKSLEDIER 495          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|75016605|sp|Q8MKK4.1|TRE12_DROME (RecName: Full=Facilitated trehalose transporter Tret1-2 homolog; Short=DmTret1-2)

HSP 1 Score: 257.299 bits (656), Expect = 4.292e-79
Identity = 155/441 (35.15%), Postives = 249/441 (56.46%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V ++ ++   F ++K    W+  I+   A+AGG   G LI+  GR+  +   AV + +S  +I  A    M+  GRFL G   G  S+S P Y+ E      RG LG++   +  IGIL+  +A  +  +    F         +I +  IPE+P + +    E  AR  L+ LRG E D+E E+  L    A  + +A  +   +L K  NLKPL IS+ +M  QQ SGINAV+ Y+  IFK A + +     TII+ +V   ATF   I+ D+LGR++LL +S  ++I+TL  +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++ +  NW   F+VT TF  L+  +G +  F+++G+I I+ L   I FVPET+GK+L+EI R
Sbjct:   28 QVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSH-LGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIER 467          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681181|sp|B4HNS1.1|TRE12_DROSE (RecName: Full=Facilitated trehalose transporter Tret1-2 homolog)

HSP 1 Score: 254.988 bits (650), Expect = 3.459e-78
Identity = 157/455 (34.51%), Postives = 253/455 (55.60%), Query Frame = 0
Query:    7 AVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            +V  E   +N    Q+  A   S  +L++G    ++SP +V ++ ++   F ++K    W+  I+   A+AGG   G LI+  GR+  +   AV + +S  +I  A    M+  GRFL G   G  S+S P Y+ E      RG LG++   +  IGIL+  +A  +  +    F         +I +  IPE+P + +    E  AR  L+ LRG E D+E E+  L    A  + +A  +   +L K  NLKPL IS+ +M  QQ SGINAV+ Y+  IFK A + +     TII+ +V   ATF   I+ D+LGR++LL +S  ++ILTL  +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++ +  NW   F+VT TF  L+  +G +  F+++G + I+ L   I +VPET+GK+L+EI R
Sbjct:   14 SVPAEGTKANFTFSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRNTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSILAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKDLMQSQAEADSQATRNTCLELFKRINLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLCTIIVGIVNFFATFMGIILIDRLGRKILLYVSDIAMILTLSILGGFFYCKAHGPDVSH-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGPHGAFWLFGVVCIVGLFFVIIYVPETRGKSLEEIER 467          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681182|sp|B4QBN3.1|TRE12_DROSI (RecName: Full=Facilitated trehalose transporter Tret1-2 homolog)

HSP 1 Score: 253.832 bits (647), Expect = 9.816e-78
Identity = 157/455 (34.51%), Postives = 252/455 (55.38%), Query Frame = 0
Query:    7 AVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            +V  E   +N    Q+  A   S  +L++G    ++SP +V ++ ++   F ++K    W+  I+   A+AGG   G LI+  GR+  +   AV + +S  +I  A    M+  GRFL G   G  S+S P Y+ E      RG LG++   +  IGIL+  +A  +  +    F         +I +  IPE+P + +    E  AR  L+ LRG E D+E E+  L    A  + +A  +   +L K  NLKPL IS+ +M  QQ SGINAV+ Y+  IFK A + +     TII+ +V   ATF   ++ D+LGR++LL IS  ++ILTL  +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++ +  NW   F+VT TF  L+  +G +  F+++G + I+ L   I  VPET+GK+L+EI R
Sbjct:   14 SVPAEGPKANFTFSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRTTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKDLMQSQAEADSQARRNTCLELFKRINLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLCTIIVGIVNFFATFMGILLIDRLGRKILLYISDIAMILTLSILGGFFYCKAHGPDVSH-LGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGVVCIVGLFFVIICVPETRGKSLEEIER 467          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681126|sp|A5LGM7.1|TRET1_POLVA (RecName: Full=Facilitated trehalose transporter Tret1; Short=PvTret1)

HSP 1 Score: 254.218 bits (648), Expect = 1.068e-77
Identity = 167/465 (35.91%), Postives = 261/465 (56.13%), Query Frame = 0
Query:    2 EDTNNAVNVEIRSSNG-FLYQLFTASIA-SQAALLMGCSLGWSSPVIVLLSKSK-DGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            ED    + +   ++N  ++Y    A+IA S  ++++G +  ++SP +V +  +    F +++ E  W+  I+    +AGG   G  I+  GRK  +   AV + ++  +I  A   WM+ AGR L+G   G  S+S P Y+ E      RG LG++      IGIL+  +A  Y  +    F         ++    IPE+P + +    E  AR  LQ LRG + D+E E   LK +V S  E      + A  DL+K  NLKPLLI++ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V   ATFFA ++ D+LGR++LL IS  ++++TL T+GT+++  +   +++  I WLPL    ++VI FS G GPIPWL++ EI   +I+G  +++A+G NW   F+VT TF  +   +G +  F+ +G I +I L   I FVPET+GK+L+EI R
Sbjct:   22 EDGKAKLEIYRPTTNPIYIYTQILAAIAVSMGSMVVGFASAYTSPALVSMQNTTITSFKVTEQEASWVGGIMPLAGLAGGIAGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPETPRWFVTRGREERARKALQWLRGKKADVEPE---LKGIVKSHCEAERHASQNAIFDLMKRSNLKPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVNFGATFFATVLIDRLGRKILLYISEVAMVITLLTLGTFFYYKNSGNDVSN-IGWLPLASFVIYVIGFSSGVGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADIVAAIGNHGAFWFFGVICLIGLFFVIFFVPETQGKSLEEIER 482          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681253|sp|Q7PIR5.3|TRET1_ANOGA (RecName: Full=Facilitated trehalose transporter Tret1; Short=AgTRET1)

HSP 1 Score: 256.529 bits (654), Expect = 6.872e-76
Identity = 159/441 (36.05%), Postives = 258/441 (58.50%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHMVI----FLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G S  ++SP +V +  ++   F ++     W+  I+    +AGG   G +I+  GRK  +   A  + +S  +I  A +  M+  GR L+G+  G  S+S P Y+ E      RG LG++      IGILL  +A   LD+    + G  + I     ++ IPE+P +++  N E  AR  LQ LRG + D+E E+  +          A+ S   DLL   NLKPLLIS+ +M  QQ SGINAV+ Y+  IF+SA + +     TII+ +V  IATF A ++ D+LGR++LL IS  ++I+TL T+GT++++ ++  ++++ I WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  ++  +G +  F+++GSI I+ L+  I +VPET+GK+L++I R
Sbjct:  332 QVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLAGGILGGPMIEYLGRKNTILATATPFIISWLLIGCATHVAMVLVGRALSGLCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYLDWSGLAFLGAALPIPFLLLMFLIPETPRWYVSRNREDRARKALQWLRGRKADVEPELKGISKSHQDAERHASSSAMLDLLNKANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQSAGSTIDEKLCTIIVGVVNFIATFIATVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVSE-IGWLPLAAFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTFADITASIGNHGAFWMFGSICIVGLLFVIVYVPETQGKSLEDIER 771          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681254|sp|Q291H8.3|TRET1_DROPS (RecName: Full=Facilitated trehalose transporter Tret1)

HSP 1 Score: 253.832 bits (647), Expect = 1.910e-74
Identity = 158/441 (35.83%), Postives = 254/441 (57.60%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V + +++   F ++     W+  I+    +AGG   G  I+  GR+  +   A+ + +S  +I  A    M+ AGRFL G   G  S+S P Y+ E      RG LG++      IGILL  +A   +D+    + G  +    +I ++ IPE+P + +    E  AR  L  LRG E D+E E+  L    A  + +A  +   +LLK  NLKPL IS+ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V  +ATF A ++ D+ GR++LL +S  ++I+TLF +G +++  SH  ++++ + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  + D +G +  F+++GSI  I L   I +VPET+GKTL++I R
Sbjct:  407 QVLAALSVSLGSLVVGFVSAYTSPALVSMTNRNMTSFEVTPQAASWVGGIMPLAGLAGGIAGGPFIEYLGRRNTILATAIPFIVSSLLIACAVNVAMVLAGRFLAGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGTYMDWSMLAFLGAALPVPFLILMFLIPETPRWFVSRGREEKARKALSWLRGKEADVEPELKGLMRSQADADRQATQNKMMELLKRNNLKPLSISLGLMFFQQLSGINAVIFYTVSIFKDAGSTIDGNLCTIIVGIVNFMATFIATLLIDRAGRKILLYVSNIAMIITLFVLGGFFYCKSHGQDVSQ-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPSKIRGSAASVATAFNWSCTFVVTKTFQDMIDFMGAHGAFWLFGSICFIGLFFVILYVPETQGKTLEDIER 846          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681218|sp|B4GAP7.2|TRET1_DROPE (RecName: Full=Facilitated trehalose transporter Tret1)

HSP 1 Score: 253.832 bits (647), Expect = 1.937e-74
Identity = 158/441 (35.83%), Postives = 254/441 (57.60%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V + +++   F ++     W+  I+    +AGG   G  I+  GR+  +   A+ + +S  +I  A    M+ AGRFL G   G  S+S P Y+ E      RG LG++      IGILL  +A   +D+    + G  +    +I ++ IPE+P + +    E  AR  L  LRG E D+E E+  L    A  + +A  +   +LLK  NLKPL IS+ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V  +ATF A ++ D+ GR++LL +S  ++I+TLF +G +++  SH  ++++ + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  + D +G +  F+++GSI  I L   I +VPET+GKTL++I R
Sbjct:  408 QVLAALSVSLGSLVVGFVSAYTSPALVSMTNRNMTSFEVTPQAASWVGGIMPLAGLAGGIAGGPFIEYLGRRNTILATAIPFIVSSLLIACAVNVAMVLAGRFLAGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGTYMDWSMLAFLGAALPVPFLILMFLIPETPRWFVSRGREEKARKALSWLRGKEADVEPELKGLMRSQADADRQATQNKMMELLKRNNLKPLSISLGLMFFQQLSGINAVIFYTVSIFKDAGSTIDGNLCTIIVGIVNFMATFIATLLIDRAGRKILLYVSNIAMIITLFVLGGFFYCKSHGQDVSQ-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPSKIRGSAASVATAFNWSCTFVVTKTFQDMIDFMGAHGAFWLFGSICFIGLFFVILYVPETQGKTLEDIER 847          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|300681219|sp|B3MG58.2|TRET1_DROAN (RecName: Full=Facilitated trehalose transporter Tret1)

HSP 1 Score: 249.21 bits (635), Expect = 1.110e-72
Identity = 154/441 (34.92%), Postives = 252/441 (57.14%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V ++ ++   F ++     W+  I+    +AGG   G  I+  GR+  +   AV + +S  +I  A    M+ AGRFL G   G  S+S P Y+ E      RG LG++      IGILL  +A   +D+    + G  +    ++ ++ IPE+P + +    E  AR  L  LRG E D+E E+  L    A  + +   +   +LLK  N KPL IS+ +M  QQ SGINAV+ Y+ SIFK A + +     TII+ +V  +ATF A ++ D+ GR++LL +S  ++I+TLF +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  + D++G +  F+++G+I  I L   I +VPET+GKTL++I R
Sbjct:  405 QVLAALSVSLGSLVVGFVSAYTSPALVSMVDRNITSFEVTPQAASWVGGIMPLAGLAGGIAGGPFIEYLGRRNTILATAVPFIVSSLLIACAVNVAMVLAGRFLAGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGTYMDWSMLAFLGAALPVPFLVLMFLIPETPRWFVSRGREERARKALSWLRGKEADVEPELKGLMRSQADADRQGTQNTMLELLKRSNFKPLSISLGLMFFQQLSGINAVIFYTVSIFKDAGSTIDGNVCTIIVGVVNFLATFIATLLIDRAGRKILLYVSNIAMIITLFVLGGFFYCKAHGPDVSH-LGWLPLSCFVIYILGFSLGFGPIPWLMMGEILPAKIRGSAASVATAFNWTCTFVVTKTFQDMIDVMGAHGAFWLFGAICFIGLFFVILYVPETQGKTLEDIER 844          
BLAST of EMLSAG00000006214 vs. SwissProt
Match: gi|122069442|sp|Q17NV8.1|TRET1_AEDAE (RecName: Full=Facilitated trehalose transporter Tret1)

HSP 1 Score: 248.054 bits (632), Expect = 1.278e-72
Identity = 156/444 (35.14%), Postives = 259/444 (58.33%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHMVI----FLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G S  ++SP +V +  ++   F ++     W+  I+    +AGG   G LI+  GRK  +   A  + +S  +I  A +  M+  GR L+G S G  S+S P Y+ E      RG LG++      IGILL  +A   +D+    + G  + I     ++ IPE+P +++    +  AR  LQ LRG + D++ E   LK ++ S  +      ++A  DL+K  NLKPLLIS+ +M  QQ SGINAV+ Y+  IF+ A + +     TII+ +V  IATF A ++ D+LGR++LL IS  ++I+TL T+G ++++ +   ++++ + WLPL    ++V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  + + +G +  F+++GSI +I L   I +VPET+GK+L++I R
Sbjct:  345 QVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLAGGILGGPLIEYLGRKNTILATATPFIISWLLIACATHVAMVLVGRALSGFSVGVASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYMDWSGLAFLGAALPIPFLLLMFLIPETPRWYVSRGRDDRARKALQWLRGKKADVDPE---LKGIIKSHQDAERHASQSAMLDLMKKANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQDAGSTIDENLCTIIVGVVNFIATFIATMLIDRLGRKMLLYISDVAMIITLMTLGGFFYVKNSGQDVSQ-VGWLPLAAFVIYVLGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFIVTKTFADIINAIGTHGTFWMFGSICVIGLAFVIFYVPETQGKSLEDIER 784          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: gb|EEC13160.1| (transporter, putative, partial [Ixodes scapularis])

HSP 1 Score: 278.1 bits (710), Expect = 1.134e-87
Identity = 168/452 (37.17%), Postives = 258/452 (57.08%), Query Frame = 0
Query:   25 ASIASQAALLMGCSLGWSSPVIVLLSKS-KDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRL-RGDEDIEEEVNVLK-NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIA-KTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQNDEEGVE 465
            A+ A   ++ MG +LG+SSP I  L ++  + F LS  EE W  S+L  GA+ GG  AG+L++  GRKLA+  +++ + +   +I +A    +L  GR + G   G  S++ P Y+SEIS    RG LG   Q+ VTIGIL +     Y  +             M + + F+ ESP + L  +    A   LQ L  G  D E E N ++ N+  S  E     +L +    KP+LIS+ +M  QQ SGINAV+ Y+ +IF+SA + +      II+ +V V+AT  A ++ DK GRRVLL +S S + ++L  +G Y+++   N E A  ++ WLPL+CLSL +I FS G GPIPWL+M E+    ++GF ++I +  NW + F+VT TF  + +L+  Y  ++ +   M++  ++ + F+PETKGKTL+EI   F+  EVP+   + VE
Sbjct:    3 AASAWLGSVAMGTNLGYSSPAIPSLKRNDSNSFTLSAGEETWFGSLLTLGALTGGLVAGFLVESLGRKLAIIFSSLGFVVGWLLIATAGTVLVLCLGRVITGFFTGIISLAVPVYVSEISRPEVRGLLGTGIQLSVTIGILAVFFFGKYLNWSSLAILCMTVPAAMAVLMIFMAESPRWLLQKDKRDEALKALQFLYAGSTDHEAERNAIEANIKMSPKESFQMKELQQPFIYKPILISLFLMFAQQFSGINAVMFYAVAIFQSAGSTIPAEDCMIIIGVVQVLATLVATMIMDKGGRRVLLLVSASMLAVSLAILGGYHYVKETNGEGAVSSMGWLPLVCLSLFIIGFSFGMGPIPWLMMGELMPSRVRGFATSICTCFNWTLAFVVTKTFNDMLNLLSTYGTYWFFCGCMLLSFVVVVLFLPETKGKTLEEIELAFRGTEVPKAAGQDVE 454          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: AAM68715.1 (trehalose transporter 1-2 [Drosophila melanogaster])

HSP 1 Score: 257.299 bits (656), Expect = 2.080e-79
Identity = 155/441 (35.15%), Postives = 249/441 (56.46%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLS-KSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  +L++G    ++SP +V ++ ++   F ++K    W+  I+   A+AGG   G LI+  GR+  +   AV + +S  +I  A    M+  GRFL G   G  S+S P Y+ E      RG LG++   +  IGIL+  +A  +  +    F         +I +  IPE+P + +    E  AR  L+ LRG E D+E E+  L    A  + +A  +   +L K  NLKPL IS+ +M  QQ SGINAV+ Y+  IFK A + +     TII+ +V   ATF   I+ D+LGR++LL +S  ++I+TL  +G +++  +H  +++  + WLPL C  ++++ FS+G+GPIPWL+M EI   +I+G  +++ +  NW   F+VT TF  L+  +G +  F+++G+I I+ L   I FVPET+GK+L+EI R
Sbjct:   28 QVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSH-LGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIER 467          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: XP_624342.1 (PREDICTED: facilitated trehalose transporter Tret1-like [Apis mellifera])

HSP 1 Score: 255.758 bits (652), Expect = 4.431e-79
Identity = 161/449 (35.86%), Postives = 242/449 (53.90%), Query Frame = 0
Query:   28 ASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLG---VIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNG------------FHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGD--EDIEEEVNVLK-NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQ 458
            A      +GC +GWS+P + LL   K+  +   S    +A+I   GA  G P   +LIDK GRK  +   +++ A  LG   +I+      +L  GRFL G   G   +  P Y +EIS    RG LGI FQ+++ IGIL       YC  Y                  VI + F+PESP+++++  NE  A+  ++  RG   E+I++E+ + K  V  S  ++  F   +K   LK L I+  +M  QQ SGINA++ YSE+IFK    +L PL + ++  +V VIA   AA + D++GR+VLL +S + + + L  +  ++ +   N  +A T+ WLPLLC  L+++SF +G GPIPW  M EIF  ++KG  S  A+  NW + F+VT++F  + D VG   VFF +  I  + +I  I  + ETKGKT  EI R F   E+ +
Sbjct:   24 ACMGGFSLGCGIGWSAPCVELL---KEEHMYDISAIALIAAIFPLGAACGLPIVPFLIDKIGRKWLM--LSLIPAFILGWVFIIIGVSVFALLVVGRFLTGACGGMFCVIVPMYSAEISEKQIRGTLGIFFQLLLVIGILY-----AYCCGYARNVVTTTGLCLVGPILFVIMMIFMPESPMFYMVKRNEEAAKRSMRFFRGPDYEEIDDELAIFKEQVEKSALQQVTFGAFMKKAVLKTLGIAYGLMFAQQFSGINAIIFYSETIFKLTGVDLDPLMQMVVFAVVQVIACLIAAALIDQVGRKVLLVVSFTVMCICLIGLAVFFIIKESNPPLADTLYWLPLLCACLYILSFCLGAGPIPWAYMGEIFPTKLKGTASTSAALFNWILAFIVTVSFSSVVDAVGIAPVFFFFALICALSVIFVIFLLVETKGKTFTEIQREFGTFEIEE 462          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: XP_016771989.1 (PREDICTED: facilitated trehalose transporter Tret1-like [Apis mellifera])

HSP 1 Score: 255.758 bits (652), Expect = 4.431e-79
Identity = 161/449 (35.86%), Postives = 242/449 (53.90%), Query Frame = 0
Query:   28 ASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLG---VIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNG------------FHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGD--EDIEEEVNVLK-NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQ 458
            A      +GC +GWS+P + LL   K+  +   S    +A+I   GA  G P   +LIDK GRK  +   +++ A  LG   +I+      +L  GRFL G   G   +  P Y +EIS    RG LGI FQ+++ IGIL       YC  Y                  VI + F+PESP+++++  NE  A+  ++  RG   E+I++E+ + K  V  S  ++  F   +K   LK L I+  +M  QQ SGINA++ YSE+IFK    +L PL + ++  +V VIA   AA + D++GR+VLL +S + + + L  +  ++ +   N  +A T+ WLPLLC  L+++SF +G GPIPW  M EIF  ++KG  S  A+  NW + F+VT++F  + D VG   VFF +  I  + +I  I  + ETKGKT  EI R F   E+ +
Sbjct:   24 ACMGGFSLGCGIGWSAPCVELL---KEEHMYDISAIALIAAIFPLGAACGLPIVPFLIDKIGRKWLM--LSLIPAFILGWVFIIIGVSVFALLVVGRFLTGACGGMFCVIVPMYSAEISEKQIRGTLGIFFQLLLVIGILY-----AYCCGYARNVVTTTGLCLVGPILFVIMMIFMPESPMFYMVKRNEEAAKRSMRFFRGPDYEEIDDELAIFKEQVEKSALQQVTFGAFMKKAVLKTLGIAYGLMFAQQFSGINAIIFYSETIFKLTGVDLDPLMQMVVFAVVQVIACLIAAALIDQVGRKVLLVVSFTVMCICLIGLAVFFIIKESNPPLADTLYWLPLLCACLYILSFCLGAGPIPWAYMGEIFPTKLKGTASTSAALFNWILAFIVTVSFSSVVDAVGIAPVFFFFALICALSVIFVIFLLVETKGKTFTEIQREFGTFEIEE 462          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: XP_006562664.1 (PREDICTED: facilitated trehalose transporter Tret1-like [Apis mellifera])

HSP 1 Score: 255.758 bits (652), Expect = 4.431e-79
Identity = 161/449 (35.86%), Postives = 242/449 (53.90%), Query Frame = 0
Query:   28 ASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLG---VIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNG------------FHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGD--EDIEEEVNVLK-NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQ 458
            A      +GC +GWS+P + LL   K+  +   S    +A+I   GA  G P   +LIDK GRK  +   +++ A  LG   +I+      +L  GRFL G   G   +  P Y +EIS    RG LGI FQ+++ IGIL       YC  Y                  VI + F+PESP+++++  NE  A+  ++  RG   E+I++E+ + K  V  S  ++  F   +K   LK L I+  +M  QQ SGINA++ YSE+IFK    +L PL + ++  +V VIA   AA + D++GR+VLL +S + + + L  +  ++ +   N  +A T+ WLPLLC  L+++SF +G GPIPW  M EIF  ++KG  S  A+  NW + F+VT++F  + D VG   VFF +  I  + +I  I  + ETKGKT  EI R F   E+ +
Sbjct:   24 ACMGGFSLGCGIGWSAPCVELL---KEEHMYDISAIALIAAIFPLGAACGLPIVPFLIDKIGRKWLM--LSLIPAFILGWVFIIIGVSVFALLVVGRFLTGACGGMFCVIVPMYSAEISEKQIRGTLGIFFQLLLVIGILY-----AYCCGYARNVVTTTGLCLVGPILFVIMMIFMPESPMFYMVKRNEEAAKRSMRFFRGPDYEEIDDELAIFKEQVEKSALQQVTFGAFMKKAVLKTLGIAYGLMFAQQFSGINAIIFYSETIFKLTGVDLDPLMQMVVFAVVQVIACLIAAALIDQVGRKVLLVVSFTVMCICLIGLAVFFIIKESNPPLADTLYWLPLLCACLYILSFCLGAGPIPWAYMGEIFPTKLKGTASTSAALFNWILAFIVTVSFSSVVDAVGIAPVFFFFALICALSVIFVIFLLVETKGKTFTEIQREFGTFEIEE 462          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: XP_006562663.1 (PREDICTED: facilitated trehalose transporter Tret1-like [Apis mellifera])

HSP 1 Score: 255.758 bits (652), Expect = 4.431e-79
Identity = 161/449 (35.86%), Postives = 242/449 (53.90%), Query Frame = 0
Query:   28 ASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLG---VIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNG------------FHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGD--EDIEEEVNVLK-NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQ 458
            A      +GC +GWS+P + LL   K+  +   S    +A+I   GA  G P   +LIDK GRK  +   +++ A  LG   +I+      +L  GRFL G   G   +  P Y +EIS    RG LGI FQ+++ IGIL       YC  Y                  VI + F+PESP+++++  NE  A+  ++  RG   E+I++E+ + K  V  S  ++  F   +K   LK L I+  +M  QQ SGINA++ YSE+IFK    +L PL + ++  +V VIA   AA + D++GR+VLL +S + + + L  +  ++ +   N  +A T+ WLPLLC  L+++SF +G GPIPW  M EIF  ++KG  S  A+  NW + F+VT++F  + D VG   VFF +  I  + +I  I  + ETKGKT  EI R F   E+ +
Sbjct:   24 ACMGGFSLGCGIGWSAPCVELL---KEEHMYDISAIALIAAIFPLGAACGLPIVPFLIDKIGRKWLM--LSLIPAFILGWVFIIIGVSVFALLVVGRFLTGACGGMFCVIVPMYSAEISEKQIRGTLGIFFQLLLVIGILY-----AYCCGYARNVVTTTGLCLVGPILFVIMMIFMPESPMFYMVKRNEEAAKRSMRFFRGPDYEEIDDELAIFKEQVEKSALQQVTFGAFMKKAVLKTLGIAYGLMFAQQFSGINAIIFYSETIFKLTGVDLDPLMQMVVFAVVQVIACLIAAALIDQVGRKVLLVVSFTVMCICLIGLAVFFIIKESNPPLADTLYWLPLLCACLYILSFCLGAGPIPWAYMGEIFPTKLKGTASTSAALFNWILAFIVTVSFSSVVDAVGIAPVFFFFALICALSVIFVIFLLVETKGKTFTEIQREFGTFEIEE 462          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: EDO63686.1 (AGAP005563-PC [Anopheles gambiae str. PEST])

HSP 1 Score: 255.758 bits (652), Expect = 9.529e-79
Identity = 163/461 (35.36%), Postives = 266/461 (57.70%), Query Frame = 0
Query:    3 DTNNAVNVEIRS--SNGFLYQLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHMVI----FLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            DT+ + +V I    +     Q+  A   S  ++++G S  ++SP +V +  ++   F ++     W+  I+    +AGG   G +I+  GRK  +   A  + +S  +I  A +  M+  GR L+G+  G  S+S P Y+ E      RG LG++      IGILL  +A   LD+    + G  + I     ++ IPE+P +++  N E  AR  LQ LRG + D+E E+  +          A+ S   DLL   NLKPLLIS+ +M  QQ SGINAV+ Y+  IF+SA + +     TII+ +V  IATF A ++ D+LGR++LL IS  ++I+TL T+GT++++ ++  ++++ I WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  ++  +G +  F+++GSI I+ L+  I +VPET+GK+L++I R
Sbjct:    9 DTHVSFSVPIEEPVAKCTFSQVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLAGGILGGPMIEYLGRKNTILATATPFIISWLLIGCATHVAMVLVGRALSGLCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYLDWSGLAFLGAALPIPFLLLMFLIPETPRWYVSRNREDRARKALQWLRGRKADVEPELKGISKSHQDAERHASSSAMLDLLNKANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQSAGSTIDEKLCTIIVGVVNFIATFIATVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVSE-IGWLPLAAFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTFADITASIGNHGAFWMFGSICIVGLLFVIVYVPETQGKSLEDIER 468          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: EDO63685.1 (AGAP005563-PB [Anopheles gambiae str. PEST])

HSP 1 Score: 255.758 bits (652), Expect = 9.529e-79
Identity = 163/461 (35.36%), Postives = 266/461 (57.70%), Query Frame = 0
Query:    3 DTNNAVNVEIRS--SNGFLYQLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHMVI----FLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAAFS---DLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            DT+ + +V I    +     Q+  A   S  ++++G S  ++SP +V +  ++   F ++     W+  I+    +AGG   G +I+  GRK  +   A  + +S  +I  A +  M+  GR L+G+  G  S+S P Y+ E      RG LG++      IGILL  +A   LD+    + G  + I     ++ IPE+P +++  N E  AR  LQ LRG + D+E E+  +          A+ S   DLL   NLKPLLIS+ +M  QQ SGINAV+ Y+  IF+SA + +     TII+ +V  IATF A ++ D+LGR++LL IS  ++I+TL T+GT++++ ++  ++++ I WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT TF  ++  +G +  F+++GSI I+ L+  I +VPET+GK+L++I R
Sbjct:    9 DTHVSFSVPIEEPVAKCTFSQVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLAGGILGGPMIEYLGRKNTILATATPFIISWLLIGCATHVAMVLVGRALSGLCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYLDWSGLAFLGAALPIPFLLLMFLIPETPRWYVSRNREDRARKALQWLRGRKADVEPELKGISKSHQDAERHASSSAMLDLLNKANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQSAGSTIDEKLCTIIVGVVNFIATFIATVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVSE-IGWLPLAAFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTFADITASIGNHGAFWMFGSICIVGLLFVIVYVPETQGKSLEDIER 468          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: XP_397017.3 (PREDICTED: facilitated trehalose transporter Tret1-2 homolog [Apis mellifera])

HSP 1 Score: 253.447 bits (646), Expect = 4.703e-78
Identity = 163/459 (35.51%), Postives = 261/459 (56.86%), Query Frame = 0
Query:    1 MEDTNNAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGI---LLINLALDYCFYYYNGFHMV----IFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVV-ASLNEKAAFSDLLK-SCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            ME T    +  +R  +  L+Q   +  A    + +G +L W+SPV+  L  +    V+++ E  W++S+L  GAI G   +G + DK GRK +L + AV + LS G+I+ A    +L+  RFL G+  G   +  PTYISEI+  S RG LG +FQ+ +T+GI    ++   L+Y  +      ++    I  Y++PESPV+ +  N +  A   L  LRG D D ++E+N L+    AS   K    ++ K   N K ++ S  +M  QQASG+NAV+ Y+  IFK++ +++ P   +I + LV ++ +  AA++ D+ GR+ LL IS   + ++L  +G YYF    +     ++ WLPL  L + +I+FS+G GP+PW+LM E+F+ E K   S++A   NW M F+VT  FP ++D +G  M F+I+ ++M      +   VPETKGKT  EI++
Sbjct:    8 MEGTGMINDAAVRQESRKLWQYLASISACFLVVGVGSALAWTSPVLPQLYAADSWLVITQEEGSWISSLLAVGAICGAIPSGSMADKMGRKKSLLLLAVPFLLSWGIILVATQVKLLYIARFLVGLGVGAGCVLGPTYISEIAEVSTRGTLGALFQLFLTVGIFVSFILGSVLNYTLFALVCVLIILLFLITFYWMPESPVWLVGQNRKQDATVALSALRGKDYDPKQELNELQMAADASSGRKPNIFEMAKIPVNQKAMIASFGMMFFQQASGVNAVIFYTVMIFKASGSSMPPELASIFVALVQLVMSGVAALIVDRAGRKPLLMISTGVMSVSLIALG-YYFKQKDSGNDVSSLGWLPLTSLIVFMIAFSIGLGPVPWMLMGELFSAESKAVASSVAVMLNWFMVFVVTKMFPTMNDELGTDMTFWIFAAVMAAATAFTHMLVPETKGKTYQEIYK 465          
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Match: EEB19066.1 (sugar transporter, putative [Pediculus humanus corporis])

HSP 1 Score: 250.366 bits (638), Expect = 4.927e-77
Identity = 164/448 (36.61%), Postives = 254/448 (56.70%), Query Frame = 0
Query:   19 LYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFV---LSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRK-LALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGIL---LINLALDYCFYYYNGFHMV------IFLYFIPESPVYHLINNNEPLARSVLQRLRGD-EDIEEEVNVLK-NVVASLNEKAAFSDLL-KSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRL 450
            L Q      A+  A  +G  L WSS  + +L  S        +++SE  W+ S++  GA+ G   AGYL DK GRK L L ++       + +I+S Q + + FA R L GV+ G   + AP YI EI+  S RG LG  FQ+++TIGIL   LI   ++Y   +  G   +      I L+F+PE+P Y +  N + LA   L+ LRG+  ++E E+N ++  V  +   K  F DL+ K  N+  L+IS+ +M+ QQ  GINAV+ Y+  IF+ A T+L P    II+ +  V+ T+ A ++ D+ GR++LL +S   +I+ LF +G Y+ L  ++    K+I WLPLL +++ VI FS+G+GP+PW++M E+F+  IK   SA+A   NW + F VT TF  L   +G+   F+++G I  I  +     V ETKGK+  +I ++
Sbjct:   19 LNQYLATLAAAFGAFTVGTILSWSSSALPMLQNSTTTPFDEPITESEGMWVGSLVAIGALIGAFPAGYLADKIGRKNLQLTLSVPFIISWIIIILSKQIELLYFA-RLLAGVAVGGICVVAPLYIGEIAETSIRGGLGSYFQLLLTIGILFSYLIGALVNYV--WLGGISCIAPVIFLIALFFMPETPFYLISKNKKNLAEKSLKWLRGNLVNVELELNKIEVEVTEAAQNKGTFKDLISKKSNVNALVISLGLMLFQQLCGINAVIFYAAEIFRIAGTDLDPFVCAIIVGVSQVVFTYGATLLVDRTGRKILLLLSSGVMIVCLFVLGIYFQLKENDESSVKSIGWLPLLSVNVFVICFSLGFGPLPWMMMGELFSTSIKEMASAMAVVMNWVLVFAVTKTFSDLLSALGKSGAFWLFGGISCIGFLFVCFVVKETKGKSFGDIQKM 463          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|1131309434|gb|JAV05077.1| (putative sugar transporter [Nyssomyia neivai])

HSP 1 Score: 280.026 bits (715), Expect = 1.937e-85
Identity = 166/444 (37.39%), Postives = 262/444 (59.01%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G +  ++SP +V ++ +++  F +   +  W+  I+    +AGG C G LI+  GRK  +   A+ + +S  +I  A   WM+ AGR L+G   G  S+S P Y+ E      RG LG++      IGILL  +    LD+    + G  +    +I ++ IPE+P +++  N E  AR  LQ LRG D D++ E   LK +V S  E      + A  DLLK  NLKPLLIS+ +M  QQ SGINAV+ Y+ +IFK A +++     TII+ +V   A F A I+ D+LGR+VLL IS  ++I+TL T+GT+++L ++  +++  + WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT  F  L + +GQ+  F+++GSI  + L   I +VPET+GK+L++I R
Sbjct:   28 QVLAALSVSMGSMVVGFASAYTSPALVSMMDRNQTSFDVDMDQASWVGGIMPLAGLAGGICGGPLIEYIGRKNTILGTAIPFIVSWLLIACATNVWMVLAGRALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVTGKYLDWSSLAFLGGALPVPFLILMFLIPETPRWYVSRNREDQARKALQWLRGRDADVDPE---LKGIVKSATEAERSASRNAMLDLLKRSNLKPLLISLGLMFFQQLSGINAVIFYTVTIFKDAGSSIDENLCTIIVGVVNFGAVFVATILIDRLGRKVLLYISDIAMIITLMTLGTFFYLKNNGTDVSN-VGWLPLASFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWLCTFIVTKAFVDLVETIGQHGAFWMFGSICCVGLFFIIFYVPETQGKSLEDIER 467          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|241642055|ref|XP_002411022.1| (transporter, putative [Ixodes scapularis] >gi|215503666|gb|EEC13160.1| transporter, putative, partial [Ixodes scapularis])

HSP 1 Score: 278.1 bits (710), Expect = 5.549e-85
Identity = 168/452 (37.17%), Postives = 258/452 (57.08%), Query Frame = 0
Query:   25 ASIASQAALLMGCSLGWSSPVIVLLSKS-KDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRL-RGDEDIEEEVNVLK-NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIA-KTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQNDEEGVE 465
            A+ A   ++ MG +LG+SSP I  L ++  + F LS  EE W  S+L  GA+ GG  AG+L++  GRKLA+  +++ + +   +I +A    +L  GR + G   G  S++ P Y+SEIS    RG LG   Q+ VTIGIL +     Y  +             M + + F+ ESP + L  +    A   LQ L  G  D E E N ++ N+  S  E     +L +    KP+LIS+ +M  QQ SGINAV+ Y+ +IF+SA + +      II+ +V V+AT  A ++ DK GRRVLL +S S + ++L  +G Y+++   N E A  ++ WLPL+CLSL +I FS G GPIPWL+M E+    ++GF ++I +  NW + F+VT TF  + +L+  Y  ++ +   M++  ++ + F+PETKGKTL+EI   F+  EVP+   + VE
Sbjct:    3 AASAWLGSVAMGTNLGYSSPAIPSLKRNDSNSFTLSAGEETWFGSLLTLGALTGGLVAGFLVESLGRKLAIIFSSLGFVVGWLLIATAGTVLVLCLGRVITGFFTGIISLAVPVYVSEISRPEVRGLLGTGIQLSVTIGILAVFFFGKYLNWSSLAILCMTVPAAMAVLMIFMAESPRWLLQKDKRDEALKALQFLYAGSTDHEAERNAIEANIKMSPKESFQMKELQQPFIYKPILISLFLMFAQQFSGINAVMFYAVAIFQSAGSTIPAEDCMIIIGVVQVLATLVATMIMDKGGRRVLLLVSASMLAVSLAILGGYHYVKETNGEGAVSSMGWLPLVCLSLFIIGFSFGMGPIPWLMMGELMPSRVRGFATSICTCFNWTLAFVVTKTFNDMLNLLSTYGTYWFFCGCMLLSFVVVVLFLPETKGKTLEEIELAFRGTEVPKAAGQDVE 454          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|926619811|ref|XP_013775171.1| (PREDICTED: solute carrier family 2, facilitated glucose transporter member 8-like [Limulus polyphemus])

HSP 1 Score: 276.559 bits (706), Expect = 3.461e-84
Identity = 160/461 (34.71%), Postives = 264/461 (57.27%), Query Frame = 0
Query:    5 NNAVNVEIRSSNGFLYQLFTASIASQ-AALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFH-------MVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLK-NVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNE 455
            +N +++  ++ N    + + A++A+   ++ MG  LG+SSP I  L        LS ++  W  S+L  GA+ GGP AG+ ID  GRKL L +  V++      ++ +    +L  GR + G SCG  S++ P YI+E ++  +RG LG   Q+M+T+GILL  +   Y  + +           + I + F+PE+P + L N     A   +  L G   + E E  +L+ N+    +E+ ++  LL    LKPL +S+ +M+ QQ SGIN V+ Y+ SIF+S  + + P  ETII+ +V+ +AT   +++ D  GRR+LL +S   +  +L  +GTYY+LD     +  +  WLPL  + +++ +FS+GYGPIPWL+M E+F+ +++G+ S IA+  NW   FLVT  F  + +LV +Y  ++I+GS+ ++  +     VPETKGKTL+EI   F+  +
Sbjct:    3 SNEISLVTQTDNRKFRKFYLAAVAALFGSISMGTGLGYSSPAIPSLQSVNSNVHLSDADIPWFGSLLAIGALIGGPIAGFAIDYFGRKLTLMLIPVVFIAGWLCMIFSHSTGLLLFGRIVTGFSCGLVSLAVPVYIAETAAPDSRGLLGSCVQLMITLGILLTYVVGKYIEWKWLALFSMTFPAILTILMIFVPETPRWLLSNGKRGDAIKAIDFLYGSSLNAEAECQILESNISQQTSERLSWRVLLLPHVLKPLFLSLGLMIFQQLSGINNVMFYTVSIFQSTGSAMDPNDETIIIGVVLFLATLAGSLLMDLAGRRILLLVSAFVMAFSLAVLGTYYYLDE---TVRNSYNWLPLTSMIVYIAAFSIGYGPIPWLMMGELFSVKVRGWSSGIATFVNWTFVFLVTKEFHFMIELVHEYGAYWIFGSLCLLSCVFVATVVPETKGKTLEEIENYFQAKK 460          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|815912476|ref|XP_012241643.1| (PREDICTED: facilitated trehalose transporter Tret1 [Bombus impatiens])

HSP 1 Score: 275.789 bits (704), Expect = 5.578e-84
Identity = 164/458 (35.81%), Postives = 263/458 (57.42%), Query Frame = 0
Query:    1 MEDTNNAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGI---LLINLALDYCFYYYNGFHMVIF----LYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVL-KNVVASLNEKAAFSDLLKS-CNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIH 448
            ME T    +  +R  +  L+Q   +  A    + +G +L W+SPV+  L  +    V++K +  W++S+L  GAIAG   +G + DK GRK +L + +V +  S G+I+ A    +L+  RFL G+  G   +  PTYISEIS  S RG LG +FQ+ +T+GI    ++   L+Y         +V F     Y++PESPV+ +  N +  A S +  LRG D D ++E+N + K   AS  +K +  D+ K   N K ++ S  +M  QQASG+NAV+ Y+  IF+++ +++ P   +I++ LV ++ +  AA++ D+ GR+ LL IS S + ++L  +G YYF          ++ WLPL  L + +++FS+G GP+PW+LM E+FA E K   S++A   NW + F+VT TFP+++  +G  M F+I+  +M      +   VPETKGKT  +IH
Sbjct:    1 MEGTGMINDAAVRQESRKLWQYLASISACILVVGVGTALAWTSPVLPQLYAADSWLVITKEQGSWISSLLALGAIAGALGSGSMADKMGRKKSLLLLSVPFLASWGIILVATEVKLLYIARFLVGIGVGAGCVLGPTYISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIVAFFLATFYWMPESPVWLVNQNRKQEATSAMSVLRGEDYDPKQELNEMQKEAEASAGKKPSLGDMAKDPVNKKAMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQLVMSGVAALIVDRAGRKPLLMISTSIMSVSLIALG-YYFQQKDGGNDVSSLGWLPLASLIVFMVAFSIGLGPVPWMLMGELFAAETKAVASSVAVMLNWSLVFIVTKTFPMMNKELGTDMTFWIFAVVMACATAFTHVLVPETKGKTYQQIH 457          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|1061485953|gb|ODN03069.1| (Facilitated trehalose transporter Tret1-2 [Orchesella cincta])

HSP 1 Score: 275.404 bits (703), Expect = 2.001e-83
Identity = 169/448 (37.72%), Postives = 251/448 (56.03%), Query Frame = 0
Query:   19 LYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGIL---LINLALDY------CFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRG---DEDIEEEVNVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPN 454
            L Q   A +A+  AL +G  LG++SP +  +  S     L +S+  W+ SI   GA   GP AG+L+D  GRK  +   A L+ L   +I  A+Y  M+FAGRF+ G   G  S++AP YISE + +S RG LG   Q+M+  G+L   +I   L++      C     GF +   + F+PESP Y +   ++  A + L+ LRG    + +++E+N L+  +    E   F  +     LKPL IS+ +M  QQ +G NA++ Y+  IF  A + L P   TII+  V V+A+  AAI+ DK GRRVLL +SG+ +   L  +G ++++   +  +   + WLPLLCL + +++FS+G+GPI WLL  EI  P +KG  SA+A+  NW   F+VT  F  +   +G    F+I+G    +  I  I FVPETKGK+LDEI   FK N
Sbjct:   43 LPQFLAAGVATLGALGLGTVLGYTSPALPDIKNSTMFSHLEESDHSWIGSIAPIGACVSGPVAGFLVDTFGRKKCMLFVAPLFILGWLLIAFAEYVEMIFAGRFITGFCGGTFSLAAPVYISETAESSIRGTLGSSLQLMINCGVLTTYVIGYFLEWNWLALVCASIPAGFFVA--MIFMPESPRYLMSKKDKVGASNALKWLRGASQHQQVKDELNALQASIEEC-EVPKFRAMFTGSILKPLGISLALMFFQQWNGNNAIVFYTVDIFNDAGSTLDPKIATIIVGAVQVVASIVAAILMDKAGRRVLLLLSGALMTAALSVLGGFFYMKEEDPSVKDYLGWLPLLCLMVFIVAFSLGFGPIAWLLAGEILPPNVKGRASALATSFNWLNTFVVTKVFDNIKIGLGIEWCFWIFGIAAFLGDIFVILFVPETKGKSLDEIQMHFKGN 487          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|340708574|ref|XP_003392898.1| (PREDICTED: facilitated trehalose transporter Tret1 [Bombus terrestris])

HSP 1 Score: 274.248 bits (700), Expect = 2.867e-83
Identity = 166/458 (36.24%), Postives = 267/458 (58.30%), Query Frame = 0
Query:    1 MEDTNNAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGI---LLINLALDYCFYYYNGFHMVIF----LYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVL-KNVVASLNEKAAFSDLLKS-CNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIH 448
            ME T    +  +R  +  L+Q   +  A    + +G +L W+SPV+  L  +    V++K +  W++S+L  GAIAG   +G + DK GRK +L + +V + LS G+I+ A    +L+  RFL G+  G   +  PTYISEIS  S RG LG +FQ+ +T+GI    ++   L+Y         +V+F     Y++PESPV+ +  N +  A S +  LRG D D ++E+N + K   AS  +K + SD+ K   N K ++ S  +M  QQASG+NAV+ Y+  IF+++ +++ P   +I++ LV ++ +  AA++ D+ GR+ LL IS S + ++L  +G YYF    +     ++ WLPL  L + +++FS+G GP+PW+LM E+FA E K   S++A   NW + F+VT TFP+++  +G  M F+I+  +M      +   VPETKGKT  +IH
Sbjct:    1 MEGTGMINDAAVRQESRKLWQYLASISACILVVGVGTALAWTSPVLPQLYAADSWLVITKEQGSWISSLLALGAIAGALGSGSMADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARFLVGIGVGAGCVLGPTYISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIVVFFLTTFYWMPESPVWLVNQNRKQEAMSAMSVLRGEDYDPKQELNEMQKEAEASAGKKPSLSDMAKDPVNKKAMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQLVMSGVAALIVDRAGRKPLLMISTSIMSVSLIALG-YYFQQKDDGNDVSSLGWLPLASLIVFMVAFSIGLGPVPWMLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKELGTDMTFWIFAVVMACATAFTHVLVPETKGKTYQQIH 457          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|972212205|ref|XP_015188543.1| (PREDICTED: facilitated trehalose transporter Tret1-like [Polistes dominula])

HSP 1 Score: 273.478 bits (698), Expect = 3.111e-83
Identity = 163/458 (35.59%), Postives = 262/458 (57.21%), Query Frame = 0
Query:    1 MEDTNNAVNVEIRSSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFY----YYNGFHMVIFL---YFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLN-EKAAFSDLLKSC-NLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIH 448
            ME+T       +R  +  L+Q F A+ A   AL  G  + W++PV+ LL +S    VLSK E  W+ S+   GA+ G   AG + D  GRK +L + AV + +S  +IV+A   WML+  RF+ G+S G T +  PTYISE++  S RG LG  FQ+ +T+GILL+N+   +  Y       G   V FL   +++PESP + +    +P A   ++ LRG+  +  EE+ +++      N  K++  D+ ++  + +  + S   M+ QQ SG+NAV+  +  IF++A ++L      II+ LV V+ +  AA + D+ GR+ LL +S   + + L  +G  YF   ++ +   ++ WLPL+ L+L +++FS+G GP+PW+L +E+F  E+KG  S IA   NW + F VT  FP +++ +G    F+ +  IM I  +L+  F+PETKGKT+ EI 
Sbjct:    1 MEETGMLNGAPVRQDSNKLWQYFAATSACLLALGAGTVMAWTAPVLPLLYESDSWLVLSKDEGSWVGSLCALGAMIGALPAGKMADMLGRKKSLMLLAVPFIISWLIIVAASRVWMLYLARFIVGISIGATCVLVPTYISEVAETSTRGTLGAFFQLFLTMGILLVNVLGSFVNYTTLSVICGLVEVAFLTTFFWMPESPQWLVSKERKPEAEVAMKVLRGNSYNPSEEITIIQRAKDESNSRKSSIFDIFRTAGSRRAFMCSCGGMIFQQLSGVNAVIFNTLEIFQAAGSSLPSDVAAIIVSLVQVVMSGAAAAIVDRAGRKPLLMLSSGFLAICLIALG-IYFKKQNDGDDVSSLGWLPLVSLTLFMVAFSIGLGPVPWMLTAELFTAELKGIASGIAVTLNWFLVFCVTKLFPSMTESLGMGGTFWFFAVIMGIATVLTFFFLPETKGKTIQEIQ 457          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|1131309424|gb|JAV05072.1| (putative sugar transporter [Nyssomyia neivai])

HSP 1 Score: 280.026 bits (715), Expect = 1.237e-82
Identity = 165/444 (37.16%), Postives = 259/444 (58.33%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGF-------HMVIFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G +  ++SP +V ++ +++  F +   +  W+  I+    +AGG C G LI+  GRK  +   A+ + +S  +I  A   WM+ AGR L+G   G  S+S P Y+ E      RG LG++      IGILL  +   Y  +    F         +I ++ IPE+P +++  N E  AR  LQ LRG D D++ E   LK +V S  E      + A  DLLK  NLKPLLIS+ +M  QQ SGINAV+ Y+ +IFK A +++     TII+ +V   A F A I+ D+LGR+VLL IS  ++I+TL T+GT+++L ++  +++  + WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT  F  L + +GQ+  F+++GSI  + L   I +VPET+GK+L++I R
Sbjct:  307 QVLAALSVSMGSMVVGFASAYTSPALVSMMDRNQTSFDVDMDQASWVGGIMPLAGLAGGICGGPLIEYIGRKNTILGTAIPFIVSWLLIACATNVWMVLAGRALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVTGKYLDWSSLAFLGGALPVPFLILMFLIPETPRWYVSRNREDQARKALQWLRGRDADVDPE---LKGIVKSATEAERSASRNAMLDLLKRSNLKPLLISLGLMFFQQLSGINAVIFYTVTIFKDAGSSIDENLCTIIVGVVNFGAVFVATILIDRLGRKVLLYISDIAMIITLMTLGTFFYLKNNGTDVS-NVGWLPLASFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWLCTFIVTKAFVDLVETIGQHGAFWMFGSICCVGLFFIIFYVPETQGKSLEDIER 746          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|1131309422|gb|JAV05071.1| (putative sugar transporter [Nyssomyia neivai])

HSP 1 Score: 280.026 bits (715), Expect = 1.317e-82
Identity = 166/444 (37.39%), Postives = 262/444 (59.01%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIV-LLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFYYYNGFHM----VIFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVASLNE------KAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHR 449
            Q+  A   S  ++++G +  ++SP +V ++ +++  F +   +  W+  I+    +AGG C G LI+  GRK  +   A+ + +S  +I  A   WM+ AGR L+G   G  S+S P Y+ E      RG LG++      IGILL  +    LD+    + G  +    +I ++ IPE+P +++  N E  AR  LQ LRG D D++ E   LK +V S  E      + A  DLLK  NLKPLLIS+ +M  QQ SGINAV+ Y+ +IFK A +++     TII+ +V   A F A I+ D+LGR+VLL IS  ++I+TL T+GT+++L ++  +++  + WLPL    + V+ FS+G+GPIPWL+M EI   +I+G  +++A+  NW   F+VT  F  L + +GQ+  F+++GSI  + L   I +VPET+GK+L++I R
Sbjct:  307 QVLAALSVSMGSMVVGFASAYTSPALVSMMDRNQTSFDVDMDQASWVGGIMPLAGLAGGICGGPLIEYIGRKNTILGTAIPFIVSWLLIACATNVWMVLAGRALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVTGKYLDWSSLAFLGGALPVPFLILMFLIPETPRWYVSRNREDQARKALQWLRGRDADVDPE---LKGIVKSATEAERSASRNAMLDLLKRSNLKPLLISLGLMFFQQLSGINAVIFYTVTIFKDAGSSIDENLCTIIVGVVNFGAVFVATILIDRLGRKVLLYISDIAMIITLMTLGTFFYLKNNGTDVS-NVGWLPLASFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWLCTFIVTKAFVDLVETIGQHGAFWMFGSICCVGLFFIIFYVPETQGKSLEDIER 746          
BLAST of EMLSAG00000006214 vs. nr
Match: gi|933499310|gb|ALG65274.1| (glucose transporter 2 [Litopenaeus vannamei])

HSP 1 Score: 272.707 bits (696), Expect = 1.368e-82
Identity = 172/471 (36.52%), Postives = 266/471 (56.48%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPV-IVLLSKSKDG-FVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCF-YYYNGFHMV------------IFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNVVA-SLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLF-----KPNEVPQNDEEGVEEERE 469
            Q   A  A+  AL  G +LG+SSP  I+L S S D    L+  E  W +S +  GA+ GGP  G  I+  GR+  L      +  S  +IV AQ   ML  GR + G+  G   ISAPTYI E +SA  RG LG  FQ+MV IGIL       Y F  + N + ++            + + F  ESP Y L    +  A+  +Q   G D +I+ E+ +LK ++  S   KA+FSDL ++  LKPLLI++ +M+ QQ SGINAV+   ++IF  + T+L     +II+ LV V+AT FA+++ DK GR+ LL IS +++I++L ++G +++L  +       + WLP+  L +++ SFS+GYGPIPW++MSE+F+  ++    ++++ +NW + F+VT  F  + + + +Y V++++G I  + L   +  VPETKGKTL EI  LF      P     +    V E+++
Sbjct:   22 QYIAALSATMGALCFGTALGYSSPAGILLTSNSTDSSLQLTTVENSWFSSSVNLGALVGGPIGGLCINAIGRRGTLLAVFPFFFGSWTIIVFAQNFAMLLVGRIIAGLCTGVMCISAPTYIGEFASADIRGMLGSGFQLMVVIGILY-----AYVFGAFINSWQILAVVCAVPTLIFCVLMVFSKESPSYLLSKGKDKEAQEAMQYFGGPDYNIQPEMQMLKQILEDSKANKASFSDLKQAYILKPLLIALALMLFQQLSGINAVIFNLKTIFADSGTDLSDDVSSIIVGLVQVLATAFASVLMDKAGRKFLLIISAAAMIVSLVSLGVFFYLKDNGG--VSALGWLPITSLIIYIASFSIGYGPIPWIMMSELFSANVREAAGSLSTMTNWTLAFIVTYFFESIQEAIHEYGVYWLFGGICAVNLAFCVLVVPETKGKTLQEITALFGGPTTSPTPARHSSPSSVSEKQK 485          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold510_size151595-snap-gene-0.31 (protein:Tk04750 transcript:maker-scaffold510_size151595-snap-gene-0.31-mRNA-1 annotation:"sugar transporter ")

HSP 1 Score: 316.62 bits (810), Expect = 6.677e-103
Identity = 191/480 (39.79%), Postives = 281/480 (58.54%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDG------FVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHMV-------IFLYFIPESPVYHLINNNEPLARSVLQRLRGDEDIEEEV-NVLKNVVASLNEKAAFSDLL-KSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFKPNEVPQNDEEGVEEEREE-----------LNED 474
            Q +  + A+  + +MG  +GWS P + LLS  +D       F LS +++ W+AS++  GA+ GG  AGYLI   GR   +   A+ +AL+   + +AQ   ML+ GRFL GV+ G TSI+ P YI+E SS   RG LG  FQ+MVT+G+L I++   +  + +     V       I L F+PESP Y L       AR  LQ LRG E +E E+ ++ +   +S N   +   LL +   +KPL+IS+++M GQQ SG+NAVL +S SIF++A T L    E +I+     +AT  AA+  D+LGRR L   S   + ++L+ +G Y+++ SH+ + AK I +LPL+ L L + SFS+G+GPIPWL+M E+F PE K   SAI++  NW + F VT  +  L++ VG    F+ + S +++LLI SI FVPETKG+TL+EI  LF+ N+ P +    +E   E            LNED
Sbjct:   29 QYWACAAATLGSFVMGTCIGWSGPALALLSAPRDPWDGAAPFALSVAQKSWIASLMPLGALFGGLMAGYLIGVIGRHGTMLGTALAFALAYLSLAAAQSVLMLWVGRFLTGVATGLTSIAVPVYIAETSSPQVRGLLGSCFQVMVTLGVLFIDVVGAFGSWRWLSVACVAASLVWLICLCFVPESPTYLLAQRRFNEARLALQFLRGHEYVETELADLQERQESSANNVVSLRSLLSEGPYVKPLMISMMLMAGQQLSGVNAVLFFSVSIFEAAGTTLNSFLENVIVASAQFVATILAALFIDRLGRRPLAIFSALVMTISLYALGAYFWILSHDPDGAKAIGFLPLVSLCLFMFSFSVGFGPIPWLMMGELFGPETKEKASAISASFNWSLAFCVTQFYSPLANEVGTATTFWGFASFLVVLLIFSILFVPETKGRTLEEIQDLFRSNQDPSSRSRPLEPTDESPSAPLVLNADFLNED 508          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold368_size193847-snap-gene-0.37 (protein:Tk10007 transcript:maker-scaffold368_size193847-snap-gene-0.37-mRNA-1 annotation:"sugar transporter 8")

HSP 1 Score: 239.58 bits (610), Expect = 1.716e-72
Identity = 152/451 (33.70%), Postives = 254/451 (56.32%), Query Frame = 0
Query:   14 SSNGFLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHM-----VIFLYF------IPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNV-VASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLF 451
            +SN    QL  +   S  ++++G S  WSSP I  L +   G  +++ E  W+ S++   A+AGG   G L++  GRK  +   A+ + ++   +  A+   M++ GR + G   G  S+S P Y++E      RG LG++   +   G+++  +    C ++ N   +     VI L F      IPE+P + L    +   ++ LQ LRG++ DI  E++ ++   +     K   S+L    ++KPL+IS+ +M  QQ SGINAV+ YS SIF+ A +++     TII+ +V + AT F+    D+LGR++LL IS   +I++L   G Y+++       A    W+PLL L ++V+SFS+G+GPIPWL+M EIF   I+G  +++++  NW   F+VT TF  L  ++G + VF+++  I++  L   I FVPET+G+TL++I RL+
Sbjct:   21 ASNMTRTQLLASLAVSLGSMIVGYSSAWSSPAIASLMEPGSGIHVTQQEASWIGSLMPLAALAGGFTGGPLLEAVGRKKTILSTAIPFIVASLCVSYARNVSMIYVGRAITGFCIGMISLSLPVYLAESIHPDVRGTLGLLPTSLGNGGVMVCYI----CGFFLNWSQLALVGAVIPLPFLLLTCMIPETPRFLLNKGKDRECQAALQWLRGEKTDITRELHDMERANILMKKTKLKASELFTPGHVKPLMISMGLMFFQQFSGINAVMFYSVSIFELAGSSINSNIATIILGVVNIGATIFSNAFIDRLGRKILLYISDVGMIISLVVFGGYFYVKDVLEMDAPG--WIPLLALMVYVVSFSVGFGPIPWLMMGEIFPSRIRGAAASLSTAFNWSCTFIVTKTFMDLQAILGPHGVFWMFAVILVFCLGFIIFFVPETRGQTLEDIERLY 465          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold342_size201858-processed-gene-1.5 (protein:Tk00011 transcript:snap_masked-scaffold342_size201858-processed-gene-1.5-mRNA-1 annotation:"nad-dependent protein deacetylase sirtuin-2")

HSP 1 Score: 203.756 bits (517), Expect = 3.468e-57
Identity = 139/482 (28.84%), Postives = 249/482 (51.66%), Query Frame = 0
Query:   19 LYQLFTASIASQAALLMGCSLGWSSPVIVLLSKS---------KDGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQY-----KWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLIN---LALDY------CFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRG-DEDIEEEVNVLKNV------VASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSH------------------------------NYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETK 440
            L+Q+  A  A+  A  +G  L W+SP +  +++          +D   L K    W++S+L  GA+      G LI K G K  + + A+   +   ++   +       W+ + GR L G   G  S+++P YISEI+  S RG LG + Q+ VT G+L  N   +AL +      C  +     M + ++F+PESP ++L +  E  A + L+R RG + +I+ E+  ++ V      + +++ KA F+   ++  +KP LI + +M  QQ SGINAVL     IF  +H+++ P     ++ +V  +AT  A ++ ++ GR++LL IS + + +++  +G +++LD +                              + E+ KT+ +LPL+ L ++V +FS+G+GP+PW+L  E+F  E +G GS++A+  NW   F+V+   P + DL+     +F+Y +I  +  +  +  VPET+
Sbjct:    9 LWQIIAALSATFGAFSLGLGLSWTSPALPHIAECEAIGECDFPQD---LGKDVGSWISSLLTIGALVSSFVTGILIAKIGPKWTMIIMAIPSIIGWVILTITEPLQLGDPWLFYVGRILTGFGGGAFSLASPMYISEIAEISIRGALGSLMQLQVTFGVLFNNAVGIALPWPILTGICIVF--PVIMAVLMFFMPESPSFYLSHGKEAEAEASLRRFRGPNYNIKAEMAEIRAVQEEQKRIGTVSMKAFFT---QAIYVKPTLIMLGLMFFQQFSGINAVLFNLTEIFIKSHSSMDPGVAATLVAVVQFVATGIAVLIVERFGRKILLIISDALMCVSILALGVFFYLDENKTVECPGEGPGFTDSSTWAPEECVPYPDGFDPELIKTLGFLPLVSLMIYVFAFSIGFGPLPWMLNGEMFEVEARGLGSSLATAFNWLCAFIVSKFTPNIQDLIMPSGSYFMYAAICAVGTVFIVFLVPETR 482          

HSP 2 Score: 153.68 bits (387), Expect = 3.220e-40
Identity = 133/505 (26.34%), Postives = 220/505 (43.56%), Query Frame = 0
Query:   18 FLYQLFTASIASQAALLMGCSLGWSSPVIVLLSKSKDG-------FVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNG----FHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKA--AFSDLL-KSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNL-KPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDS---------------------HNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRL------FKPNE----VPQNDEEGVEEEREELNEDD 475
            F+  L   + A+  A  +G  + W+SP +  L+  +            +K E  W+ S    GA+  G   G+L+ K GRK  + + AV +             W+L                                              L + L LD  F++Y G      M I + F+PE+P + L+   +  ++  LQ LRG   DI  E N+LK  V    E    +F D+L +   LKP LI + +   QQ  GIN ++ Y   IF +A  N+   LA   ++    VIAT  A  V ++LGR++LL  S + + + +  +G Y++L S                      N E+A+T+ WLPL+ L ++  +FS+G+GP+PW++  E FA E K   S  A+  NW   FLV+     +   +G   ++F++  + ++  +     VPET+GK+ +++  +       +P E     P +   G   E+  L+E+D
Sbjct:  473 FIVFLVPETRATIGAFGLGSGMAWTSPTLPSLTNCEGRNNTCTFEHEFTKEEGSWIGSSYTLGAMVSGIVTGFLLAKIGRKWTMVLMAVPFIAG----------WLLLC--------------------------------------------LTVPLNLDQAFWFYIGRVLAVTMGILMLFMPETPYFLLMKGKDESSQKSLQWLRGKHYDIGSESNLLKKSVKEQQESTIVSFRDVLTRPVYLKPFLIMLALHFFQQFCGINVIVFYLADIFIAAGLNVDNSLAAAAVVSCTQVIATGAAIFVVERLGRKILLIFSATVMAVAIMALGVYFYLKSGIGPIEECNDLDDTLCDPSSGANEELAQTLGWLPLVSLIVYKFAFSVGFGPLPWMMNGEFFALEAKPVSSTSATVFNWLCAFLVSKFSVNIEYGIGTSGMYFMFSGVCLVAAVFVFFVVPETRGKSPEDMRMISHLVSQSQPMEGRATTPGDHGNG---EKPNLHEED 920          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1023_size69924-snap-gene-0.14 (protein:Tk02660 transcript:maker-scaffold1023_size69924-snap-gene-0.14-mRNA-1 annotation:"hypothetical protein L798_15742 partial")

HSP 1 Score: 172.17 bits (435), Expect = 2.074e-48
Identity = 133/429 (31.00%), Postives = 219/429 (51.05%), Query Frame = 0
Query:   35 MGCSLGWSSPVIV-LLSKSKDGFV-LSKSEE--GWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGIL---LINLALDY----CFYYYNGFHMVIFLYFIPESPVYHLINNNEPLARSVLQRLRGDE-DIEEEVNVLKNVVASLNEKAA-FSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGS--SIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIH 448
            +G S G++SP +  + +K++     LS SEE   W+AS+   GA+ GG  A  LI K GRK  L    V +A S  + + A    M++   FL G       ++   YISEI+  S R  L    +++  +G+L    +   LD+    C        + I   FIPE+P + L N+ E  A   LQ LRG+  D+  E+  +   +  + E+ +   ++L    ++PL+I+  +M   + SG+ A   Y+ +IF+ +  +  P    ++   V ++A+  + I+ D +GR  LL +S +  S  L  F   +YYF   H       + W+PL+C+ L V +FS+G  PI WLL+ E+F  E +  G +IA+  ++   F+   TF  +   +G +  F+ Y  I +I L+  + FVPETKG+TLDE+ 
Sbjct:   34 VGLSKGYTSPALASMQAKNQTSLTSLSVSEEQGSWIASLSLLGALFGGLFAA-LIIKHGRKRTLSCITVPFASSWILTIFASCVEMVYLTAFLVGFFSAIIQLATQVYISEIADPSIRASLCSATKVLSHVGLLSSFALGAFLDWRQLACVCAGAPLMLFITSRFIPETPSFLLYNDQEAKAEKALQWLRGNNVDVSAELATIHCNIKRMKEQGSNCKNVLVPQLVRPLIITCGLMFFHRFSGVAAFNFYAVTIFQDSFGSFNPHLAAVVTGSVQLLASCASGILCDTIGRLPLLIVSTALMSSALAGFGCYSYYF---HANLSETHMDWIPLMCVILFVCAFSLGMNPISWLLIGEVFPLEYRNIGPSIATTFSYICAFVGVKTFTDMKSGLGLHGTFWAYSVISVIGLLFCLIFVPETKGRTLDEMQ 458          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold205_size259573-snap-gene-1.37 (protein:Tk01385 transcript:maker-scaffold205_size259573-snap-gene-1.37-mRNA-1 annotation:"hypothetical protein DAPPUDRAFT_304267")

HSP 1 Score: 171.014 bits (432), Expect = 3.908e-48
Identity = 132/453 (29.14%), Postives = 221/453 (48.79%), Query Frame = 0
Query:   21 QLFTASIASQAALLMGCSLGWSSPVIVLLSKSK----------DGFVLSKSEEGWLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQYKWML---FAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLALDYCFYYYNGFHMVIF-LYF------IPESPVYHLINNNEPLARSVLQRLRGDEDIEEEV-NVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFK 452
            Q+  A IAS      G +  W+SP I  L  +               LS     W++ +   GA+  G  A   + K GR+  + +  ++Y++   V+ +A     L   +  R + G+  GF+  +A  YISE++ +  RG L  +  + + +G L+  +   Y  + Y  +   IF L F      + ESP + L    E +A   LQ  R  +D++E++ N+  N+  S +             L PL +S+ +M  QQ  G+NAV+ Y+ +IFK A +N++    T+I+ LV   AT  +  + DK GR++LL  SG+ + ++   +G +++L S   +  + + WLPL+ L   +I +S G+  +P+++M E+F    +    AI+SG N    FLV   F  L   +G Y VF+IY  +     I     +PETKGK+L EI   F+
Sbjct:    7 QILAAIIASLGFFTAGMARAWASPAIPSLQGTNVFPNMTDYSLSYAPLSNEHISWISGLTPLGALFAGLSATVPLGKVGRRWTMALAGLMYSVGFIVLGTASIHEELISIYITRAVIGLGIGFSIPAAQIYISELAESHVRGLLSSLPAVFMALGTLVTYIVGAYLPWNYLSYFCAIFPLIFMVTVLSLHESPFWLLEKGKEEMATKALQWFRAGKDVKEDILNMKMNLDESRHNSEDEVSWFSRPVLFPLFLSMSLMFFQQWCGVNAVIYYTVTIFKHAGSNVEQNLATVIVGLVQFFATLASIFLVDKAGRKILLIASGAIMSVSTAAVGAFFYLQSVGQD--EGLSWLPLVGLITFMIGYSTGFASVPYVMMGELFPSSKRNTLGAISSGFNLLHTFLVIKLFLNLEVALGYYGVFWIYSGVAFCSCIFVPILLPETKGKSLQEIEAHFR 457          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold491_size156641-snap-gene-0.27 (protein:Tk05478 transcript:maker-scaffold491_size156641-snap-gene-0.27-mRNA-1 annotation:"glucose transporter isoform x")

HSP 1 Score: 172.94 bits (437), Expect = 3.873e-47
Identity = 129/391 (32.99%), Postives = 203/391 (51.92%), Query Frame = 0
Query:   84 LIDKXGRKLALGVNAVLY---ALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLIN-LALDYCFYYYNGFH------------MVIFLYFIPESPVYHLI-NNNEPLARSVLQRLRGDEDIEEEVNVLKN--VVASLNEKAAFSDLLKSCNLK-PLLISILVMMGQQASGINAVLSYSESIF-KSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVL-LQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFK 452
            + +K GRK  L +N VL    AL++G+   A+   +L  GRF+ G++CG  +   P YISEIS  + RG LG + Q+ VT+G+L+   L ++      NG+              ++ L F PESP Y LI    E  AR  L++LR   DI++++  ++   +      K    +LL+S +L+ PLLI++++ + QQ SGINAV  YS ++F  +  +       TI +  VMV+ T  +  + D+ GRR L L   G   I ++F   T  FL     E+   I WL ++    +V+ F++G G IPW++ +E+F+   +    ++A   NW   F V + FP +   +  Y  F  +   + I  I +   VPETK KT DEI  LF+
Sbjct:  264 IANKCGRKGGLLINNVLGIGGALAMGMAKYAESYELLIVGRFVIGMNCGLNTSLVPMYISEISPITLRGGLGTINQLAVTVGLLISQILGIESLLGTNNGWPFLLGIAIFPSLLQMVLLPFCPESPRYLLITKQRENQAREALKKLRNSTDIDDDIEEMRTEELAQRAEAKINICELLRSPSLRLPLLIAVVMQLSQQLSGINAVFYYSTNLFITTGLSESSAKLATIGIGGVMVLMTLISIPLMDRSGRRTLHLYGLGGMFIFSIFI--TISFLVK---ELVAWIWWLSVVSTLFYVVFFAVGPGSIPWMITAELFSQGPRPAAMSVAVLINWSANFCVGIGFPTMQTALENY-TFLPFSVFLAIFWIFTYKKVPETKNKTFDEIATLFR 648          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold5_size1054832-snap-gene-3.8 (protein:Tk04031 transcript:maker-scaffold5_size1054832-snap-gene-3.8-mRNA-1 annotation:"solute carrier family facilitated glucose transporter member 1-like")

HSP 1 Score: 163.696 bits (413), Expect = 9.059e-45
Identity = 131/412 (31.80%), Postives = 219/412 (53.16%), Query Frame = 0
Query:   65 WLASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIVSAQY---KWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILL------INLALDYCFYYY-------NGFHMVIFLYFIPESPVYHLIN-NNEPLARSVLQRLRGDEDIEEEVNVLKNVVASLN--EKAAFSDLLKSCNLK-PLLISILVMMGQQASGINAVLSYSESIFKSAHTN-LKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIAKTIRWLPLLCLSL---HVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFK 452
            W+ ++   G + GG   G +  K GRK  L +N VL  L+   ++SA+Y     M+  GR L G++ G  +  AP Y+SEIS  + RG +G ++Q+++TI ILL       N+  +   + +        G   VI L F PESP + L++ +++  + S L  LRG  D+ +E++ ++    S+    K    +++K+  L+ PL+I++++M+ QQ SGINA + +S SIF SA  +     + T+ M  + V  T  + I+ +K GR+ L+ I+G  +I+ L T      L +      KT+ WL  + + +    V+ F+ G G IPW  ++E+F    +   ++IA  +NW   FLV L F  +   VG Y VF I+  + +  ++     VPETK KT++EI   F+
Sbjct:  154 WIVAVFCVGGMIGGSIVGVVAGKFGRKGGLLLNNVLVLLAGVCMISAKYLNSYEMIILGRLLIGINSGLNAGLAPMYLSEISPTAFRGAVGTVYQLIITISILLSQILGMKNILGNEAGWPWLLGLTVIPGLIQVIILPFCPESPKFLLLDRDDQERSNSALVWLRGKVDVHDEMDEMRTEQESMKLVPKITLLEMVKNSALRQPLIIAMMMMLAQQLSGINAAMFFSTSIFMSAGLDEAASQSATLGMGGMNVAMTVLSLIMIEKAGRKTLM-ITG-LVIMCLTTTCLLICLAA-----VKTVPWLSYVAIVMVIGFVVGFATGPGSIPWFFVTELFNQSGRPIATSIAVATNWAANFLVGLGFAPIHLAVGPY-VFIIFIIVQVFFIVYVWFKVPETKNKTIEEITAQFR 557          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold405_size181423-processed-gene-0.1 (protein:Tk08179 transcript:snap_masked-scaffold405_size181423-processed-gene-0.1-mRNA-1 annotation:"facilitated trehalose transporter tret1-like isoform x2")

HSP 1 Score: 155.221 bits (391), Expect = 1.160e-42
Identity = 117/408 (28.68%), Postives = 210/408 (51.47%), Query Frame = 0
Query:   71 FFGAIAGGPCAGYLIDKXGRK--LALGVNAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILL---INLALDYCFYYYNGFHMV----IFLYFIPESPVYHLINNNEPLARSVLQRLRG---DEDIEEEVNVLKNVVA-SLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGT-YYFLDSHNYE--IAKTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLF-KPNEVPQNDE 461
            FFG I  GP    +++K GRK  L L  N + + L   +I  A  + ML  GRF  G   GF       Y+ EI+S   R  LG   Q+  T+G+L    +   LD+ F        V    I + F+PESP + ++   E  AR  L+ LRG   DE I+ E++ +K  VA     +    DL ++   +P  +S+ +M   Q  G++ ++ Y+ SIF  A +++ P   +I++ L +V+++ FA ++  +L RR+++  S   + + +  +GT  YF++    E  +A  + WLP++ + L +   + G+  + W+L +E+  P+++   +++A    + +GF+V+ TF  L   +     F++Y +I +    L   F+PETK ++++EI + F +   V  N +
Sbjct:    6 FFGCIVCGP----VMEKLGRKPTLMLVTNGI-FILGYMLIFLALNEGMLLTGRFFTGSGLGFAIAVCTVYVIEITSTDMRSSLGCFVQLFGTLGVLYTFSLGAFLDWYFLALANLAFVPPLAIGMLFVPESPRWLILQGREVGARESLEWLRGRGNDEWIQAEIDKIKRDVALDRKNRITLRDLQQA--WRPFALSLGLMFLAQFCGLSVLIYYTVSIFNVARSSVDPRMASILVGLTLVLSSGFAVLIVPRLNRRLIVLTSLMCMTMCMVVLGTCLYFIEQTPPEEDLAPPLGWLPVVTVLLFLFVGNGGFETLIWILTAELLPPKVRSVANSLAICFAFLVGFVVSKTFVDLVTAIRNSGAFWLYAAINLAGFFLLAYFLPETKDRSIEEIQKKFTRITRVSTNPD 406          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold405_size181423-processed-gene-0.0 (protein:Tk08180 transcript:snap_masked-scaffold405_size181423-processed-gene-0.0-mRNA-1 annotation:"facilitated trehalose transporter tret1-like isoform x2")

HSP 1 Score: 150.214 bits (378), Expect = 3.120e-40
Identity = 131/471 (27.81%), Postives = 225/471 (47.77%), Query Frame = 0
Query:   35 MGC-----SLGWSSPV--IVLLSKSKDGFVLSKSEE----GWLASILFFGAIAGGPCAGYLIDKXGRKLALGV-NAVLYALSLGVIVSAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINLA---LDYCFY-YYNGFHMVIF---LYFIPESPVYHLINNNEPLARSVLQRLRGDED---IEEEVNVLKNVVASLNEKAAFSDLLKSCNLKPLLISILVMMGQQASGINAVLSYSESIFKSAHTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYF------------------LDSHNYEIAKT--------------IRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLF 451
            MGC      LG++ P    ++   S D F  S S +     W+   L  G+  GG  AG +++K GR+  + V  +V + L   +I  A  K+ML+AGR +NG+  GF   +   YI EI++   RG LG + Q M ++GI+    A   LD+ +    N   ++ F   +YF PESP + ++   E  A+  L+ LRG  +   I+EE+  +K  +A    +      LK    KP L++I +M   Q SG N ++ Y+ +IF+ A +++ P   +II+   ++I+   A I+  KL R+++L  S   + L+   +G   +                   D   + + KT              + W+PL  +   +   + GYG + W++ +EI  P+++   +++     +  GF+V+ TF  L + V Q   F+IY  + +  L  ++  VPET+   +DEI   F
Sbjct:    1 MGCFLNGGVLGYTGPANPSMMSPDSVDAFGNSFSVDLQAVSWITGFLSLGSFFGGLVAGPIMEKIGRRRMMIVPTSVAFTLGYILIACAMNKYMLYAGRVVNGIGLGFELSAVTVYIVEIATTDMRGFLGCLVQGMGSLGIVFTFCAGAVLDWKWLAIANALWVIPFAIGMYFAPESPRWLVLKGKEYSAKKSLEWLRGRSNPKAIDEEIEAIKRDIAIKKTQRVSITQLKDV-WKPFLVAITMMFIVQFSGFNVLIYYTVNIFQMARSSVNPKFASIIVGFTLLISCIIAIIIVSKLNRKIMLITSILVMCLSQTVLGYCMYHNEQLQANFDRKLARENITDLQAFLVNKTEAEVLEYTLENPEWLGWVPLAAVLSFLFFGNGGYGTLIWVVTAEILPPKVRSVANSVIICFTFLGGFVVSKTFVDLIEAVNQSGTFWIYAGVCLFGLFFTVICVPETRNVPIDEIQDAF 470          
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold168_size293125-snap-gene-1.69 (protein:Tk04461 transcript:maker-scaffold168_size293125-snap-gene-1.69-mRNA-1 annotation:"solute carrier family facilitated glucose transporter member 1-like")

HSP 1 Score: 140.969 bits (354), Expect = 6.485e-37
Identity = 127/424 (29.95%), Postives = 208/424 (49.06%), Query Frame = 0
Query:   66 LASILFFGAIAGGPCAGYLIDKXGRKLALGVNAVLYALSLGVIV----SAQYKWMLFAGRFLNGVSCGFTSISAPTYISEISSASNRGKLGIMFQIMVTIGILLINL-----------ALDYCFY--YYNGFHMVIFLYFIPESPVYHLINN-NEPLARSVLQRLRGDEDIEEEVNVLKNVVASLNEKAAFS----------DLLKSCNLK-PLLISILVMMGQQASGINAVLSYSESIFKSA---HTNLKPLAETIIMDLVMVIATFFAAIVSDKLGRRVLLQISGSSIILTLFTIGTYYFLDSHNYEIA-----KTIRWLPLLCLSLHVISFSMGYGPIPWLLMSEIFAPEIKGFGSAIASGSNWGMGFLVTLTFPILSDLVGQYMVFFIYGSIMIILLILSIAFVPETKGKTLDEIHRLFK 452
            + S    G + GG   G +    GRK +L  N + +    G ++    S+Q   ML  GRF+ G++ G  +  AP Y+SEIS  S RG +G ++Q+ +T+ ILL  +           + +Y        G   V+ L   P+SP Y  I   +   A   L  LR   D+ E+   L+      +E+ A S          DL +  +L+ PL+IS+++M+ QQ SGINA++ YS ++F  A   H + +    T+IM    VI T  A  V ++ GR+ L  I G  + + + T+G +  L  +   +       T  ++ +L +   V SF++G GPIPW  +SE++    +   +++A G NW   FL++ +F  L+ ++G Y VF  + ++ +  L      VPETK +T+ EI   FK
Sbjct:   78 IVSTFCLGGMLGGLSVGMVSYTFGRKYSLIANNI-FVFGGGALMFWAKSSQSYGMLIGGRFVIGIAAGLAAGIAPMYLSEISPKSMRGAIGAVYQLAITLTILLSQILGLTSVLGTAESWEYLLLITVIPGLVQVVLLVRNPDSPKYLFIEKADHEAATRALVWLRERRDVTED---LREYAREQDEERAGSESELGPSTLEDLFRIPSLRRPLIISVMLMLAQQLSGINAIVFYSTNVFMGAGLSHDHAQ--YATLIMGGANVIMTLVAIAVVERFGRKTL--ILGGLLGMAICTLGLFVCLKINQDAVDLDDQNTTAAFISVLMVMGFVASFAIGPGPIPWFFVSELYTQRARPAANSVAVGVNWAANFLISWSFQPLTAVMGSY-VFVGFLALQLAFLSYVWFCVPETKDRTVVEILADFK 492          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000006214 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-4.193e-7834.91symbol:Tret1 "Facilitated trehalose transporter Tr... [more]
-1.132e-7735.15symbol:Tret1-2 "Trehalose transporter 1-2" species... [more]
-8.933e-7734.51symbol:Tret1-2 "Facilitated trehalose transporter ... [more]
-2.508e-7634.51symbol:Tret1-2 "Facilitated trehalose transporter ... [more]
-2.678e-7635.91symbol:Tret1 "Facilitated trehalose transporter Tr... [more]
-1.070e-7436.05symbol:Tret1 "Facilitated trehalose transporter Tr... [more]
-3.883e-7435.80symbol:CG10960 species:7227 "Drosophila melanogast... [more]
-2.300e-7335.83symbol:Tret1 "Facilitated trehalose transporter Tr... [more]
-2.324e-7335.83symbol:Tret1 "Facilitated trehalose transporter Tr... [more]
-1.223e-7134.92symbol:Tret1 "Facilitated trehalose transporter Tr... [more]

Pages

back to top
BLAST of EMLSAG00000006214 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 25
Match NameE-valueIdentityDescription
gi|592914092|gb|GAXK01044283.1|3.799e-9139.42TSA: Calanus finmarchicus comp130728_c1_seq2 trans... [more]
gi|592914093|gb|GAXK01044282.1|2.002e-9039.15TSA: Calanus finmarchicus comp130728_c1_seq1 trans... [more]
gi|592781903|gb|GAXK01172665.1|2.550e-8538.62TSA: Calanus finmarchicus comp1812412_c0_seq1 tran... [more]
gi|592879872|gb|GAXK01078029.1|2.522e-7437.18TSA: Calanus finmarchicus comp3136550_c0_seq1 tran... [more]
gi|592767747|gb|GAXK01186821.1|4.454e-6534.38TSA: Calanus finmarchicus comp1504958_c0_seq1 tran... [more]
gi|592954787|gb|GAXK01003766.1|5.594e-6031.87TSA: Calanus finmarchicus comp455036_c3_seq2 trans... [more]
gi|592954788|gb|GAXK01003765.1|7.515e-6031.87TSA: Calanus finmarchicus comp455036_c3_seq1 trans... [more]
gi|592913837|gb|GAXK01044538.1|1.963e-5830.41TSA: Calanus finmarchicus comp242096_c2_seq3 trans... [more]
gi|592913838|gb|GAXK01044537.1|9.553e-5529.55TSA: Calanus finmarchicus comp242096_c2_seq2 trans... [more]
gi|592761324|gb|GAXK01193089.1|5.551e-5430.91TSA: Calanus finmarchicus comp729906_c0_seq2 trans... [more]

Pages

back to top
BLAST of EMLSAG00000006214 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 25
Match NameE-valueIdentityDescription
EMLSAP000000062140.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s33:164805... [more]
EMLSAP000000019767.645e-5741.44pep:novel supercontig:LSalAtl2s:LSalAtl2s1350:3299... [more]
EMLSAP000000112695.963e-4329.18pep:novel supercontig:LSalAtl2s:LSalAtl2s772:25866... [more]
EMLSAP000000123472.434e-4030.73pep:novel supercontig:LSalAtl2s:LSalAtl2s901:31947... [more]
EMLSAP000000118032.230e-3928.93pep:novel supercontig:LSalAtl2s:LSalAtl2s824:28707... [more]
EMLSAP000000065188.157e-3926.34pep:novel supercontig:LSalAtl2s:LSalAtl2s357:25499... [more]
EMLSAP000000109135.855e-3830.40pep:novel supercontig:LSalAtl2s:LSalAtl2s72:122407... [more]
EMLSAP000000041871.446e-2927.82pep:novel supercontig:LSalAtl2s:LSalAtl2s221:10532... [more]
EMLSAP000000092943.087e-2628.51pep:novel supercontig:LSalAtl2s:LSalAtl2s595:12653... [more]
EMLSAP000000018255.699e-2625.67pep:novel supercontig:LSalAtl2s:LSalAtl2s1314:1551... [more]

Pages

back to top
BLAST of EMLSAG00000006214 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|300681185|sp|B0WC46.1|TRET1_CULQU1.624e-7934.91RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|75016605|sp|Q8MKK4.1|TRE12_DROME4.292e-7935.15RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|300681181|sp|B4HNS1.1|TRE12_DROSE3.459e-7834.51RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|300681182|sp|B4QBN3.1|TRE12_DROSI9.816e-7834.51RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|300681126|sp|A5LGM7.1|TRET1_POLVA1.068e-7735.91RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|300681253|sp|Q7PIR5.3|TRET1_ANOGA6.872e-7636.05RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|300681254|sp|Q291H8.3|TRET1_DROPS1.910e-7435.83RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|300681218|sp|B4GAP7.2|TRET1_DROPE1.937e-7435.83RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|300681219|sp|B3MG58.2|TRET1_DROAN1.110e-7234.92RecName: Full=Facilitated trehalose transporter Tr... [more]
gi|122069442|sp|Q17NV8.1|TRET1_AEDAE1.278e-7235.14RecName: Full=Facilitated trehalose transporter Tr... [more]

Pages

back to top
BLAST of EMLSAG00000006214 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
gb|EEC13160.1|1.134e-8737.17transporter, putative, partial [Ixodes scapularis][more]
AAM68715.12.080e-7935.15trehalose transporter 1-2 [Drosophila melanogaster... [more]
XP_624342.14.431e-7935.86PREDICTED: facilitated trehalose transporter Tret1... [more]
XP_016771989.14.431e-7935.86PREDICTED: facilitated trehalose transporter Tret1... [more]
XP_006562664.14.431e-7935.86PREDICTED: facilitated trehalose transporter Tret1... [more]
XP_006562663.14.431e-7935.86PREDICTED: facilitated trehalose transporter Tret1... [more]
EDO63686.19.529e-7935.36AGAP005563-PC [Anopheles gambiae str. PEST][more]
EDO63685.19.529e-7935.36AGAP005563-PB [Anopheles gambiae str. PEST][more]
XP_397017.34.703e-7835.51PREDICTED: facilitated trehalose transporter Tret1... [more]
EEB19066.14.927e-7736.61sugar transporter, putative [Pediculus humanus cor... [more]

Pages

back to top
BLAST of EMLSAG00000006214 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|1131309434|gb|JAV05077.1|1.937e-8537.39putative sugar transporter [Nyssomyia neivai][more]
gi|241642055|ref|XP_002411022.1|5.549e-8537.17transporter, putative [Ixodes scapularis] >gi|2155... [more]
gi|926619811|ref|XP_013775171.1|3.461e-8434.71PREDICTED: solute carrier family 2, facilitated gl... [more]
gi|815912476|ref|XP_012241643.1|5.578e-8435.81PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|1061485953|gb|ODN03069.1|2.001e-8337.72Facilitated trehalose transporter Tret1-2 [Orchese... [more]
gi|340708574|ref|XP_003392898.1|2.867e-8336.24PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|972212205|ref|XP_015188543.1|3.111e-8335.59PREDICTED: facilitated trehalose transporter Tret1... [more]
gi|1131309424|gb|JAV05072.1|1.237e-8237.16putative sugar transporter [Nyssomyia neivai][more]
gi|1131309422|gb|JAV05071.1|1.317e-8237.39putative sugar transporter [Nyssomyia neivai][more]
gi|933499310|gb|ALG65274.1|1.368e-8236.52glucose transporter 2 [Litopenaeus vannamei][more]

Pages

back to top
BLAST of EMLSAG00000006214 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 25
Match NameE-valueIdentityDescription
maker-scaffold510_size151595-snap-gene-0.316.677e-10339.79protein:Tk04750 transcript:maker-scaffold510_size1... [more]
maker-scaffold368_size193847-snap-gene-0.371.716e-7233.70protein:Tk10007 transcript:maker-scaffold368_size1... [more]
snap_masked-scaffold342_size201858-processed-gene-1.53.468e-5728.84protein:Tk00011 transcript:snap_masked-scaffold342... [more]
maker-scaffold1023_size69924-snap-gene-0.142.074e-4831.00protein:Tk02660 transcript:maker-scaffold1023_size... [more]
maker-scaffold205_size259573-snap-gene-1.373.908e-4829.14protein:Tk01385 transcript:maker-scaffold205_size2... [more]
maker-scaffold491_size156641-snap-gene-0.273.873e-4732.99protein:Tk05478 transcript:maker-scaffold491_size1... [more]
maker-scaffold5_size1054832-snap-gene-3.89.059e-4531.80protein:Tk04031 transcript:maker-scaffold5_size105... [more]
snap_masked-scaffold405_size181423-processed-gene-0.11.160e-4228.68protein:Tk08179 transcript:snap_masked-scaffold405... [more]
snap_masked-scaffold405_size181423-processed-gene-0.03.120e-4027.81protein:Tk08180 transcript:snap_masked-scaffold405... [more]
maker-scaffold168_size293125-snap-gene-1.696.485e-3729.95protein:Tk04461 transcript:maker-scaffold168_size2... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s33supercontigLSalAtl2s33:164805..166416 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
Logic nameensemblgenomes
Descriptionmaker-LSalAtl2s33-snap-gene-1.28
Biotypeprotein_coding
EvidenceIEA
NoteFacilitated trehalose transporter Tret1
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000006214 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000006214EMLSAT00000006214-702061Lepeophtheirus salmonismRNA


Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s33:164805..166416-

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000006214-688980 ID=EMLSAG00000006214-688980|Name=EMLSAG00000006214|organism=Lepeophtheirus salmonis|type=gene|length=1612bp|location=Sequence derived from alignment at LSalAtl2s33:164805..166416- (Lepeophtheirus salmonis)
ATGGAGGATACAAACAATGCTGTAAATGTTGAAATTCGTTCATCGAACGG ATTTCTATACCAACTTTTTACTGCTTCAATTGCATCACAAGCTGCGCTTC TCATGGGCTGTAGTTTGGGTTGGTCAAGCCCCGTAATCGTATTATTAAGT AAATCAAAGGATGGATTTGTTCTCAGCAAGTCAGAAGAGGGATGGTTGGC CTCCATATTATTCTTTGGTGCCATAGCAGGAGGTAAATATCTATTCACTT TTGAACAGGATTAAATCATCCTCATTTTCCTTAGGTCCTTGCGCTGGATA CCTGATTGACAAAKCTGGTCGAAAATTGGCGTTAGGAGTCAATGCTGTAT TGTATGCATTGTCTCTTGGAGTTATTGTATCTGCGCAATATAAGTGGATG CTATTTGCAGGACGTTTTTTAAATGGTGTGTCATGTGGGTTTACTTCTAT TAGTGCCCCAACTTATATCTCAGAAATTTCTTCAGCGAGTAATCGAGGGA AACTAGGAATAATGTTTCAAATTATGGTTACCATTGGAATTCTTCTAATA AATGTTATAGGATTGATTGAAAGTTGGCGTTGGATTACTGTTTCTATTAT TATAATGGATTCCATATGGTTATTTTTCTCTATTTTATTCCGGAATCCCC AGTTTATCATCTGATAAATAACAACGAACCTTTAGCAAGGAGCGTTCTTC AGGTATTATACTTTTTTAGTATAATGGATCTTATTTTTGTTGAAACTATA CTTGATTCTTTTTTAGAGATTAAGAGGTGATGAAGATATTGAAGAAGAAG TTAATGTGCTGAAGAATGTGGTTGCATCATTAAATGAAAAGGCAGCCTTT TCTGATTTGCTTAAATCTTGTAACTTGAAGCCACTTCTTATAAGTATATT GGTGATGATGGGTCAACAGGCTTCTGGAATAAATGCTGTTCTATCCTACA GCGAATCCATATTTAAATCTGCTCATACCAATTTAAAGCCTTTGGCGGAA ACAATTATAATGGATTTAGTCATGGTTATAGCTACTTTTTTTGCTGCAAT CGTTAGTGATAAGTTAGGGAGAAGGGTATTGCTACAAATATCTGGTTCTT CCATTATATTAACATTATTTACTATCGGAACCTATTATTTTTTGGATTCT CATAACTACGAAATTGCTAAAACAATTCGTTGGTTGCCTTTGTTATGTTT GAGTCTTCACGTTATCTCATTTTCAATGGGATATGGTCCAATTCCTTGGC TTCTTATGTCTGAAATATTTGCACCTGAAATTAAAGGGTTTGGGAGTGCC ATTGCTAGTAAGACTTATTTTTTCTCTTATAAGCTCCTGTTTTAACCGAT ATTTATAGGTGGCTCGAATTGGGGTATGGGGTTTCTTGTCACTTTGACAT TTCCTATTTTATCTGATCTAGTTGGACAGTACATGGTCTTCTTTATTTAT GGATCTATTATGATCATTTTATTAATTCTGTCAATTGCATTCGTACCGGA AACCAAAGGGAAAACATTGGATGAGATTCATAGATTATTCAAGCCAAATG AAGTGCCTCAAAATGACGAAGAAGGAGTTGAAGAGGAGAGGGAGGAACTG AACGAGGACGAT
back to top
Add to Basket