EMLSAT00000000504, EMLSAT00000000504-696351 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000000504
Unique NameEMLSAT00000000504-696351
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
AC F230 female
  1. Adult
  2. Adult
No phenotype
-Missing-
14.12.2015 - 10:26
25.01.2016 - 10:27
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: no visible phenotype
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
AG F230 female
  1. PreAdult2
  2. Adult
No phenotype
no visible phenotype
16.08.2016 - 10:26
23.09.2016 - 10:27
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s1079supercontigLSalAtl2s1079:74856..75141 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000000504 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000000504EMLSAG00000000504-683270Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000002199EMLSAE00000002199-711127Lepeophtheirus salmonisexon
EMLSAE00000002200EMLSAE00000002200-711128Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto771446auto771446Lepeophtheirus salmonispolypeptide
EMLSAP00000000504EMLSAP00000000504Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000000504

>EMLSAP00000000504 ID=EMLSAP00000000504|Name=EMLSAP00000000504|organism=Lepeophtheirus salmonis|type=polypeptide|length=73bp
MGNPMVGTTQSGQVKKRCFGRRPRPRPSANLSVKDLMDLIKMIMELAKKK
GAEKRNIVSSPTMTHVKVLSESD
back to top

mRNA from alignment at LSalAtl2s1079:74856..75141-

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000000504-696351 ID=EMLSAT00000000504-696351|Name=EMLSAT00000000504|organism=Lepeophtheirus salmonis|type=mRNA|length=286bp|location=Sequence derived from alignment at LSalAtl2s1079:74856..75141- (Lepeophtheirus salmonis)
ATGGGGAATCCAATGGTCGGAGTATGTTTAAGCTTATTGTTGTAAATAAA TCTTTAATGTGTTTTTTTTTCATCTTTATTTGTAGACAACGCAATCTGGA CAAGTGAAAAAGAGATGTTTCGGACGTAGACCAAGACCAAGACCATCAGC AAATCTTAGTGTTAAGGACTTGATGGATTTAATAAAAATGATTATGGAAC TTGCAAAAAAGAAAGGTGCTGAGAAAAGAAATATTGTTTCAAGTCCAACT ATGACTCATGTTAAAGTACTCTCCGAGAGTGATTAA
back to top
Add to Basket