EMLSAT00000005090, EMLSAT00000005090-700937 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000005090
Unique NameEMLSAT00000005090-700937
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: -Missing-
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending Publication
F18 unknown
  1. Nauplius
-Missing-
-Missing-
11.07.2014 (All day)
16.07.2014 (All day)
F18/F84 EcR, USP unknown
  1. Nauplius
No molting
-Missing-
11.07.2014 - 13:11
16.07.2014 (All day)
The Ecdysone Receptor (EcR) is a Major Regulator... more
F18/F84 EcR, UsP unknown
  1. Nauplius
No molting
-Missing-
19.11.2014 - 13:33
26.11.2014 (All day)
The Ecdysone Receptor (EcR) is a Major Regulator... more
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s269supercontigLSalAtl2s269:306853..308464 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000005090 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000005090EMLSAG00000005090-687856Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000022252EMLSAE00000022252-731180Lepeophtheirus salmonisexon
EMLSAE00000022253EMLSAE00000022253-731181Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto776152auto776152Lepeophtheirus salmonispolypeptide
EMLSAP00000005090EMLSAP00000005090Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000005090

>EMLSAP00000005090 ID=EMLSAP00000005090|Name=EMLSAP00000005090|organism=Lepeophtheirus salmonis|type=polypeptide|length=514bp
MSTTQYTAIIQPRPXHDSVVPAVKRFRPNPPDNSSPTVIGLPPPPSSSPI
FASASSSPLIHQQHQQSLFIETMSNNGSYSTPSPILSEIKXXPHPXXPPP
PPTTTTLHQQHSQQNTHYYLNNSGESPSSPLENGLRHPNAPLTPTGAVQQ
YSQMVENERKKKGSSSRPAEELCLVCGDRASGYHYNALACEGCKGFFRRS
ITKNSNYTCKWNGDCEIDMYMRRKCQACRLKKCYATGMRAECVVPERTCI
QKRQAKAAAAAAAXXDTTVDPKSNNNGKNGSISIDMASFPKRLSSTKPLK
PEEEELINRLVYFQEEYEHPSEADLNRVYHVPMHSTNSSESESDRLFRHM
TEMTILTVQLIVEFSKHLPGFQNLCRDDQINLLKGCSSEVMMLRGARRYD
AESDSIVYATNYPFTKENYAKAGLGNDELFRFCRAMSRMKEPKRVEKIQE
IYVDALQAYVMANRKKNQMVTFAKLLYVLTELRSLGINNSELCFSLKLKN
RKLPPFLMEIWDIE
back to top

mRNA from alignment at LSalAtl2s269:306853..308464-

Legend: polypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000005090-700937 ID=EMLSAT00000005090-700937|Name=EMLSAT00000005090|organism=Lepeophtheirus salmonis|type=mRNA|length=1612bp|location=Sequence derived from alignment at LSalAtl2s269:306853..308464- (Lepeophtheirus salmonis)
ATGTCAACAACTCAATATACGGCTATAATTCAGCCTCGCCCAMCTCACGA TTCRGTGGTYCCTGCCGTTAAACGATTTCGTCCTAATCCTCCAGATAATT CTTCGCCAACTGTTATTGGACTTCCTCCACCGCCTTCCAGTTCGCCAATA TTCGCTAGTGCCTCGTCTTCTCCTTTGATTCACCAACAGCACCAACAATC TCTTTTCATAGAAACTATGAGTAACAATGGGTCTTACTCGACCCCTTCTC CTATACTCTCCGAAATTAAGMCTGAMCCCCATCCTTMCYCCCCGCCMCCT CCGCCAACAACGACGACCCTCCACCAACAGCACTCCCAACAAAATACACA CTATTACCTGAATAACTCGGGAGAAAGTCCCTCTTCTCCATTGGAGAATG GACTGCGACATCCTAATGCTCCTTTAACACCTACTGGAGCTGTTCAGCAG TACTCTCAGATGGTGGAAAATGAGAGGAAAAAGAAAGGATCTTCCTCTCG CCCTGCCGAAGAGTTATGTCTTGTCTGTGGAGATCGAGCATCGGGTTATC ATTATAATGCATTGGCATGTGAGGGATGCAAAGGGTTCTTTCGACGTTCT ATTACCAAAAACTCTAACTATACTTGCAAATGGAATGGGGATTGTGAAAT TGATATGTATATGAGGCGAAAATGTCAGGCGTGTAGACTAAAAAAATGTT ATGCCACGGGTATGAGGGCAGAGTGTGTTGTGCCAGAAAGGACTTGCATT CAGAAAAGACAAGCTAAAGCTGCAGCCGCTGCCGCAGCTSCASCCGACAC AACTGTAGATCCTAAGTCCAATAACAACGGTAAAAATGGAAGCATATCCA TAGATATGGCTTCTTTTCCTAAAAGACTTTCATCCACCAAACCTTTAAAG CCAGAAGAAGAGGAGCTAATTAATCGTTTGGTATATTTTCAAGAAGAATA CGAGCATCCATCTGAAGCGGACCTTAACCGTGTTTACCATGTTCCTATGC ACAGTACTAATTCATCCGAATCCGAGTCTGACCGTTTATTCCGTCATATG ACAGAGATGACTATTCTTACAGTTCAATTAATAGTTGAGTTCTCCAAGCA CCTGCCGGGCTTCCAGAATCTTTGCAGAGACGATCAAATTAATTTACTTA AAGGCTGTTCCTCAGAAGTGATGATGCTGAGGGGAGCCCGTCGTTATGAT GCCGAGTCAGACTCTATTGTTTATGCAACGAACTATCCTTTTACGAAAGA AAATTACGCTAAGGCGGGGCTTGGCAATGACGAGCTCTTTCGTTTCTGCA GGGCCATGTCTCGAATGAAAGTACGATAACGCAGAATACGCTCTCATAAC AGCTATTGTCATTTTTAGTGATAGAAACTCCTTAAAGGAACCTAAAAGAG TTGAAAAGATTCAAGAGATTTATGTAGATGCTCTACAAGCCTACGTAATG GCAAATCGGAAAAAGAATCAAATGGTTACCTTTGCGAAGTTGTTATATGT CCTTACTGAGCTTCGATCCTTAGGGATCAACAACTCAGAACTTTGCTTCT CTCTTAAGCTTAAAAACCGAAAATTGCCCCCATTTCTCATGGAAATTTGG GACATCGAATGA
back to top
Add to Basket