EMLSAT00000010071, EMLSAT00000010071-705918 (mRNA) Lepeophtheirus salmonis

Overview
NameEMLSAT00000010071
Unique NameEMLSAT00000010071-705918
TypemRNA
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments
Table of all RNA interference experiments conducted using this feature, grouped by Phenotype CV: female reproduction, abnormal egg strings
Gallery Image Title Gene or target symbol Sex/Stage Phenotype Datesort descending
T F166 UN50_10071 female
  1. PreAdult2
  2. Adult
Abnormal
female reproduction, abnormal egg strings
30.10.2014 - 13:20
09.12.2014 (All day)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s663supercontigLSalAtl2s663:61652..63876 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Properties
Property NameValue
Logic nameensemblgenomes
Biotypeprotein_coding
EvidenceIEA
Cross References
External references for this mRNA
DatabaseAccession
Ensembl Metazoa (transcript)EMLSAT00000010071 (primary cross-reference)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
EMLSAG00000010071EMLSAG00000010071-692837Lepeophtheirus salmonisgene


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesType
EMLSAE00000044769EMLSAE00000044769-753697Lepeophtheirus salmonisexon
EMLSAE00000044770EMLSAE00000044770-753698Lepeophtheirus salmonisexon
EMLSAE00000044771EMLSAE00000044771-753699Lepeophtheirus salmonisexon
EMLSAE00000044772EMLSAE00000044772-753700Lepeophtheirus salmonisexon
EMLSAE00000044773EMLSAE00000044773-753701Lepeophtheirus salmonisexon
EMLSAE00000044774EMLSAE00000044774-753702Lepeophtheirus salmonisexon
EMLSAE00000044775EMLSAE00000044775-753703Lepeophtheirus salmonisexon
EMLSAE00000044776EMLSAE00000044776-753704Lepeophtheirus salmonisexon


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
polypeptide-auto771042auto771042Lepeophtheirus salmonispolypeptide
EMLSAP00000010071EMLSAP00000010071Lepeophtheirus salmonispolypeptide


Sequences
The following sequences are available for this feature:

protein sequence of EMLSAP00000010071

>EMLSAP00000010071 ID=EMLSAP00000010071|Name=EMLSAP00000010071|organism=Lepeophtheirus salmonis|type=polypeptide|length=342bp
MWSKLTCLTLLFALANCNYIGYKVFQTEDIHSQAKAIELIKFIESADEGV
YDFWVSPRVGSYAKVMVAPGYVSTFEQFLKEQXIASTLLIEDVEITNQRF
SIIENALRKIKTSSRSIDFENYYSSDDLXADNGFVEVETYGKSYEGRDLK
VIKIMKAGPNAPNIFIEAGIHAQDPENARYLDQFNFHIMPSVNPDGYEFS
REHRRFWRKTRSINQGSRCRGVDPNRNWAFHWNESSVSDDPCTNIFPGLK
PFSEPETDAIRQYVEKLQPTPLMSLSLHNPASGASDDWYLGVLGSTYAYT
VELRQGGLFGFDLDPSQIKESGEELWAGMKVIFDRLHEVSSQ
back to top

mRNA from alignment at LSalAtl2s663:61652..63876+

Legend: exonpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAT00000010071-705918 ID=EMLSAT00000010071-705918|Name=EMLSAT00000010071|organism=Lepeophtheirus salmonis|type=mRNA|length=2225bp|location=Sequence derived from alignment at LSalAtl2s663:61652..63876+ (Lepeophtheirus salmonis)
CAAATGCTTATCAGGAATTAATAATAGTTTGGAGACCTTTATAAAGGACG ATGTAATTCAGTTAGAGCATCAGTCTCCATTATGTGGTCTAAACTAACTT GTTTAACACTTTTATTTGCTCTTGCAAATTGTAACTATATTGGGTAAGAA ACTATATTATTTCATTTACTCTGGCTATAATTAATCATTATCATGGAATA GATACAAAGTGTTTCAAACCGAAGATATTCATTCTCAAGCAAAAGCTATT GAATTGATCAAATTCATCGAATCCGCAGATGAAGGAGTCTATGACTTCTG GGTGTCTCCACGTGTGGGCTCTTATGCTAAGGTAATGGTTGCTCCTGGAT ACGTTTCTACATTCGAACAATTCTTGAAGGAGCAAYCCATTGCCTCTACT CTTTTGATTGAGGATGTGGAAATGTAAGTTTATAGCTTTTAACATATTTA TGCAGAGATGAAAGTCTCAGGAGGACAAATCTCCCTCACAATTCCTGCGA CTGTGCTTATGTGTATCATTACTCGGTCCATGATTAATTGTCAAATCCTT CTTATAGTACTAATCAAAGATTTTCCATCATTGAAAATGCTTTAAGAAAA ATCAAAACTTCATCCAGATCAATTGACTTTGAAAACTACTACAGTTCAGA CGATGTAAAAGACACAAATGAGTTTGATTTTCCCCACTAMCTCWCTTTCT CTTGCTCCAGWTYTTTTCTTATTTGCATGAGCTTRAAGCCGATAATGGCT TTGTCGAAGTTGAAACCTATGGAAAATCCTACGAAGGTAGAGACTTAAAG GTCATCAAGATTATGAAGGCTGGACCTAATGCTCCCAATATCTTCATTGA GGCTGGAATTCATGCACGTGAATGGATTGCACCTGCAANNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCACATACATTATTCA TAGTCTTCTAGAAGATCCTGAAAATGCTCGTTACCTTGACCAATTCAATT TCCACATCATGCCTTCCGTTAACCCCGATGGCTATGAATTTAGCAGAGAA CATGTGAGATATAAAGTTTCCACTTAGGATTGATCTAGAATATAACTTTA TATATATATTTTTTTAAATAGAGACGTTTTTGGAGAAAGACAAGAAGCAT AAATCAAGGATCTAGATGCAGAGGTGTTGATCCCAACAGAAATTGGGCCT TCCATTGGAATGGTAGTTATATTTTTAGCTTGTATTATAATATATGTACA TAATATTTTTGATATAATGTGTAGAATCTAGTGTGAGTGATGATCCATGC ACTAACATCTTCCCTGGATTAAAACCATTCTCTGAACCTGAAACCGACGC TATTCGTCAATATGTTGAAAAGTTACAACCTACTCCATTAATGAGCTTGT CTCTTCATAGTGCTGCAAATTTGTGGTTGGTGCCCTACGGATACGCCTAC AATGTGTATCCTGAGAATTACGATGAGCTTGTAAGCTTCATATTTATATT GAAAATAATAATTTTCATTGTATATGTATTATAGATGGGACTCGCAAAGA AGGCAGTCAATGCATTGAACGCAGTTCATGATGCTGGATTTGAAGCTATC AACTCAGCTAATTTATGTATGTACAGGGGCGTCCGCAAGGCGGTGGGCTG GAGGAGCAAAATTAAGCAATATTTGCTTTTTACTATAAAATTTAGTTTTT GAATTTTTTTTCCAAAAAAATTAATTTCTTGAGAATTTTTCAAATTTTTT AAAAAAGATTACCCCCCCCCAAAAAAAAAATGACCCTGGKCCACCCTCTT TTATCTCTAAAATATTTGAACGAGTCATAGTATATCCTGATTATTTTCTT AGATCCTGCTTCTGGAGCATCAGATGATTGGTATCTTGGTGTATTGGGAT CAACTTATGCTTACACTGTTGAATTGAGACAAGGNGGATTATTTGGCTTC GATTTGGATCCAAGCCAGATTAAAGAAAGTGGTGAAGAATTGTGGGCAGG AATGAAGGTCATCTTTGATAGATTGCATGAAGTATCATCACAATAAATAA ATTTTTAATTGATATCCTGTATATCATTTATTATAAATGTTTTAATATTT CTTTTTTTAATAAATAGAACGAAAA
back to top
Add to Basket