EMLSAG00000002949, EMLSAG00000002949-685715 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000002949 vs. C. finmarchicus
Match: gi|592803452|gb|GAXK01151116.1| (TSA: Calanus finmarchicus comp5465164_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 1.055e+0 Identity = 17/31 (54.84%), Postives = 18/31 (58.06%), Query Frame = 0 Query: 21 GIQTFAYIPRHLSIFFPLSQGSRNF--FLAL 49 IQ P H SIF PL GSR+F FLAL Sbjct: 175 SIQLVFQDPYHASIFLPLQSGSRHFH*FLAL 267
BLAST of EMLSAG00000002949 vs. C. finmarchicus
Match: gi|592776410|gb|GAXK01178158.1| (TSA: Calanus finmarchicus comp14689_c4_seq13 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.079e+0 Identity = 10/31 (32.26%), Postives = 17/31 (54.84%), Query Frame = 0 Query: 1 MMSSNQPSKYYGCFGECFSLGIQTFAYIPRH 31 + +S P+ Y C +C+SLG+ + I H Sbjct: 731 LSNSKVPNTMYSCKSDCWSLGVVLYMLISGH 823
BLAST of EMLSAG00000002949 vs. C. finmarchicus
Match: gi|592776411|gb|GAXK01178157.1| (TSA: Calanus finmarchicus comp14689_c4_seq12 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.080e+0 Identity = 10/31 (32.26%), Postives = 17/31 (54.84%), Query Frame = 0 Query: 1 MMSSNQPSKYYGCFGECFSLGIQTFAYIPRH 31 + +S P+ Y C +C+SLG+ + I H Sbjct: 731 LSNSKVPNTMYSCKSDCWSLGVVLYMLISGH 823
BLAST of EMLSAG00000002949 vs. C. finmarchicus
Match: gi|592776412|gb|GAXK01178156.1| (TSA: Calanus finmarchicus comp14689_c4_seq11 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 4.119e+0 Identity = 10/31 (32.26%), Postives = 17/31 (54.84%), Query Frame = 0 Query: 1 MMSSNQPSKYYGCFGECFSLGIQTFAYIPRH 31 + +S P+ Y C +C+SLG+ + I H Sbjct: 731 LSNSKVPNTMYSCKSDCWSLGVVLYMLISGH 823
BLAST of EMLSAG00000002949 vs. C. finmarchicus
Match: gi|592850768|gb|GAXK01106776.1| (TSA: Calanus finmarchicus comp37852_c1_seq1 transcribed RNA sequence) HSP 1 Score: 25.7942 bits (55), Expect = 8.265e+0 Identity = 11/22 (50.00%), Postives = 15/22 (68.18%), Query Frame = 0 Query: 21 GIQTFAYIPRHLSIFFPLSQGS 42 GI TF + P L +FFP+S G+ Sbjct: 363 GILTFPFSPICLKVFFPISSGA 428
BLAST of EMLSAG00000002949 vs. C. finmarchicus
Match: gi|592833003|gb|GAXK01124541.1| (TSA: Calanus finmarchicus comp25007_c6_seq1 transcribed RNA sequence) HSP 1 Score: 26.1794 bits (56), Expect = 8.492e+0 Identity = 12/17 (70.59%), Postives = 14/17 (82.35%), Query Frame = 0 Query: 32 LSIFFPLSQGSRNFFLA 48 LS PL+QGSRNFFL+ Sbjct: 481 LSTSQPLNQGSRNFFLS 531
BLAST of EMLSAG00000002949 vs. L. salmonis peptides
Match: EMLSAP00000002949 (pep:novel supercontig:LSalAtl2s:LSalAtl2s16976:2:735:1 gene:EMLSAG00000002949 transcript:EMLSAT00000002949 description:"maker-LSalAtl2s16976-augustus-gene-0.0") HSP 1 Score: 115.931 bits (289), Expect = 1.374e-35 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0 Query: 1 MMSSNQPSKYYGCFGECFSLGIQTFAYIPRHLSIFFPLSQGSRNFFLALLQKNLMM 56 MMSSNQPSKYYGCFGECFSLGIQTFAYIPRHLSIFFPLSQGSRNFFLALLQKNLMM Sbjct: 1 MMSSNQPSKYYGCFGECFSLGIQTFAYIPRHLSIFFPLSQGSRNFFLALLQKNLMM 56 The following BLAST results are available for this feature:
BLAST of EMLSAG00000002949 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000002949 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 6
BLAST of EMLSAG00000002949 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000002949 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000002949 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000002949 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000002949 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s16976:2..735+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000002949-685715 ID=EMLSAG00000002949-685715|Name=EMLSAG00000002949|organism=Lepeophtheirus salmonis|type=gene|length=734bp|location=Sequence derived from alignment at LSalAtl2s16976:2..735+ (Lepeophtheirus salmonis)back to top Add to Basket
|