EMLSAG00000000142, EMLSAG00000000142-682908 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592776582|gb|GAXK01177986.1| (TSA: Calanus finmarchicus comp14511_c2_seq14 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 1.380e+0 Identity = 14/52 (26.92%), Postives = 21/52 (40.38%), Query Frame = 0 Query: 5 FCAPGCGTGYDN----EPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLK 52 P Y N EPQ+ + + WP NP D +W +A+ +K Sbjct: 94 LLTPLASLKYPNSPQYEPQEFLMTQYFWPFSSPNPITDMSWFKALALVRSVK 249
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592776590|gb|GAXK01177978.1| (TSA: Calanus finmarchicus comp14511_c2_seq6 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 1.635e+0 Identity = 14/52 (26.92%), Postives = 21/52 (40.38%), Query Frame = 0 Query: 5 FCAPGCGTGYDN----EPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLK 52 P Y N EPQ+ + + WP NP D +W +A+ +K Sbjct: 373 LLTPLASLKYPNSPQYEPQEFLMTQYFWPFSSPNPITDMSWFKALALVRSVK 528
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592776576|gb|GAXK01177992.1| (TSA: Calanus finmarchicus comp14511_c5_seq5 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.027e+0 Identity = 14/52 (26.92%), Postives = 21/52 (40.38%), Query Frame = 0 Query: 5 FCAPGCGTGYDN----EPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLK 52 P Y N EPQ+ + + WP NP D +W +A+ +K Sbjct: 235 LLTPLASLKYPNSPQYEPQEFLMTQYFWPFSSPNPITDMSWFKALALVRSVK 390
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592776577|gb|GAXK01177991.1| (TSA: Calanus finmarchicus comp14511_c5_seq4 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.040e+0 Identity = 14/52 (26.92%), Postives = 21/52 (40.38%), Query Frame = 0 Query: 5 FCAPGCGTGYDN----EPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLK 52 P Y N EPQ+ + + WP NP D +W +A+ +K Sbjct: 235 LLTPLASLKYPNSPQYEPQEFLMTQYFWPFSSPNPITDMSWFKALALVRSVK 390
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592776587|gb|GAXK01177981.1| (TSA: Calanus finmarchicus comp14511_c2_seq9 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 2.220e+0 Identity = 11/36 (30.56%), Postives = 18/36 (50.00%), Query Frame = 0 Query: 17 EPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLK 52 EPQ+ + + WP NP D +W +A+ +K Sbjct: 373 EPQEFLMTQYFWPFSSPNPITDMSWFKALALVRSVK 480
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592750899|gb|GAXK01203514.1| (TSA: Calanus finmarchicus comp3072168_c0_seq2 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 4.459e+0 Identity = 22/69 (31.88%), Postives = 27/69 (39.13%), Query Frame = 0 Query: 25 IHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICESKRSQTLGKALKKRCD 93 +HLW L W R R TD MD S+HF F+C S SQ+ K L + D Sbjct: 957 LHLW--------LAPDWGRTGGRGTDHSMMD*GEDFLNLKHSVHFVHESFLCVSS-SQSFDKILSDKYD 1136
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592750900|gb|GAXK01203513.1| (TSA: Calanus finmarchicus comp3072168_c0_seq1 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 4.461e+0 Identity = 22/69 (31.88%), Postives = 27/69 (39.13%), Query Frame = 0 Query: 25 IHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICESKRSQTLGKALKKRCD 93 +HLW L W R R TD MD S+HF F+C S SQ+ K L + D Sbjct: 957 LHLW--------LAPDWGRTGGRGTDHSMMD*GEDFLNLKHSVHFVHESFLCVSS-SQSFDKILSDKYD 1136
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592908187|gb|GAXK01050188.1| (TSA: Calanus finmarchicus comp30162_c3_seq7 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 4.600e+0 Identity = 16/45 (35.56%), Postives = 25/45 (55.56%), Query Frame = 0 Query: 18 PQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKST 62 P +G+KIH R+P + + R++ DLK+ DQ+PS S Sbjct: 127 PSVNGLKIH------RHPA*NRVFDRSLISGNDLKQ*DQSPSFSN 243
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592908191|gb|GAXK01050184.1| (TSA: Calanus finmarchicus comp30162_c3_seq3 transcribed RNA sequence) HSP 1 Score: 28.1054 bits (61), Expect = 4.805e+0 Identity = 16/45 (35.56%), Postives = 25/45 (55.56%), Query Frame = 0 Query: 18 PQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKST 62 P +G+KIH R+P + + R++ DLK+ DQ+PS S Sbjct: 127 PSVNGLKIH------RHPA*NRVFDRSLISGNDLKQ*DQSPSFSN 243
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Match: gi|592908196|gb|GAXK01050179.1| (TSA: Calanus finmarchicus comp30162_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 6.415e+0 Identity = 16/44 (36.36%), Postives = 25/44 (56.82%), Query Frame = 0 Query: 18 PQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKS 61 P +G+KIH R+P + + R++ DLK+ DQ+PS S Sbjct: 1384 PSVNGLKIH------RHPA*NRVFDRSLISGNDLKQWDQSPSFS 1497
BLAST of EMLSAG00000000142 vs. L. salmonis peptides
Match: EMLSAP00000000142 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1021:140193:141338:-1 gene:EMLSAG00000000142 transcript:EMLSAT00000000142 description:"snap-LSalAtl2s1021-processed-gene-0.80") HSP 1 Score: 205.682 bits (522), Expect = 1.164e-69 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0 Query: 1 MATKFCAPGCGTGYDNEPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICESKRSQTLGKALKKRCDYFRS 97 MATKFCAPGCGTGYDNEPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICESKRSQTLGKALKKRCDYFRS Sbjct: 1 MATKFCAPGCGTGYDNEPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICESKRSQTLGKALKKRCDYFRS 97
BLAST of EMLSAG00000000142 vs. L. salmonis peptides
Match: EMLSAP00000002611 (pep:novel supercontig:LSalAtl2s:LSalAtl2s151:424347:426407:1 gene:EMLSAG00000002611 transcript:EMLSAT00000002611 description:"augustus-LSalAtl2s151-processed-gene-4.1") HSP 1 Score: 59.3066 bits (142), Expect = 1.434e-11 Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 0 Query: 1 MATKFCAPGCGTGYDNEPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICES 78 M K C P C +GYD +P + + +H +P + + G AWLRAI R+++ APSK +++ SLHF++ DF+ ES Sbjct: 138 MPNKCCVPKCTSGYDGKPSIARLSLHSFPLDKSSKG---AWLRAIPRDSN---GTWAPSKYSRVCSLHFHEDDFVYES 209
BLAST of EMLSAG00000000142 vs. L. salmonis peptides
Match: EMLSAP00000010046 (pep:novel supercontig:LSalAtl2s:LSalAtl2s661:385852:386678:-1 gene:EMLSAG00000010046 transcript:EMLSAT00000010046 description:"augustus-LSalAtl2s661-processed-gene-2.10") HSP 1 Score: 52.373 bits (124), Expect = 9.892e-10 Identity = 30/80 (37.50%), Postives = 44/80 (55.00%), Query Frame = 0 Query: 1 MATKFCAPGCGTGYDNEPQQSGVKIHLWP--NKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICES 78 M K APGC GYD+ P+ + V H++P N N L++ W AI R+ +K+++L SLHF +SD+I S Sbjct: 1 MGWKCSAPGCRQGYDDTPKNTTVLFHIFPRFNVPPNLELESRWESAIPRQKTF-------TKNSRLCSLHFTESDYITHS 73
BLAST of EMLSAG00000000142 vs. L. salmonis peptides
Match: EMLSAP00000012721 (pep:novel supercontig:LSalAtl2s:LSalAtl2s965:308987:310501:-1 gene:EMLSAG00000012721 transcript:EMLSAT00000012721 description:"augustus-LSalAtl2s965-processed-gene-3.12") HSP 1 Score: 47.7506 bits (112), Expect = 1.129e-7 Identity = 30/96 (31.25%), Postives = 49/96 (51.04%), Query Frame = 0 Query: 1 MATKFCAPGCGTGYDNEPQQSGVKIHLWPNKERNPGLDTAWLRAITRETDLKKMDQAPSKSTKLRSLHFNDSDFICES-----KRSQTLGKALKKR 91 M C P C + Y ++ GV +H++P ++ + AWL A++ + K + PS +++ SLHF+D F+ ES K QT K L +R Sbjct: 1 MPNNCCIPHCKSRYKGYLKRYGVTLHVFP---KDASIKDAWLHAVSSQM---KGEYEPSIYSRVCSLHFDDQSFVNESSDERRKYRQTSSKQLVRR 90
BLAST of EMLSAG00000000142 vs. L. salmonis peptides
Match: EMLSAP00000012818 (pep:novel supercontig:LSalAtl2s:LSalAtl2s977:162868:163832:-1 gene:EMLSAG00000012818 transcript:EMLSAT00000012818 description:"snap-LSalAtl2s977-processed-gene-1.30") HSP 1 Score: 42.743 bits (99), Expect = 5.167e-7 Identity = 19/50 (38.00%), Postives = 30/50 (60.00%), Query Frame = 0 Query: 1 MATKFCAPGCGTGYDNEPQQSGVKIHLWPNKERNPGLDTAWLRAITRETD 50 M K C P C +GYD +P + + +H +P E + G+ WLRAI R+++ Sbjct: 12 MPNKCCVPKCSSGYDGKPAIARLSLHSFPLDESSKGV---WLRAIPRDSN 58 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000142 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000142 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 12
Pagesback to top
BLAST of EMLSAG00000000142 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 5
BLAST of EMLSAG00000000142 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000142 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000142 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000142 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1021:140193..141338- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000142-682908 ID=EMLSAG00000000142-682908|Name=EMLSAG00000000142|organism=Lepeophtheirus salmonis|type=gene|length=1146bp|location=Sequence derived from alignment at LSalAtl2s1021:140193..141338- (Lepeophtheirus salmonis)back to top Add to Basket
|