EMLSAG00000000377, EMLSAG00000000377-683143 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592805116|gb|GAXK01149452.1| (TSA: Calanus finmarchicus comp97819_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 5.528e-1 Identity = 13/30 (43.33%), Postives = 20/30 (66.67%), Query Frame = 0 Query: 26 TYSKSFYRQKRSAKRLFENLKEHFDMSLEF 55 T SK Y+Q +A ++NLK++FD + EF Sbjct: 1990 TSSKITYKQLHAADNGYQNLKQYFDEAFEF 2079
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592875517|gb|GAXK01082060.1| (TSA: Calanus finmarchicus comp113185_c1_seq3 transcribed RNA sequence) HSP 1 Score: 29.6462 bits (65), Expect = 5.680e-1 Identity = 13/28 (46.43%), Postives = 19/28 (67.86%), Query Frame = 0 Query: 39 KRLFENLKEHFDMSLEFQLRRIGLSSTT 66 RLF +LK HF +LEF+L + L++ T Sbjct: 213 ARLFCSLKLHFCCALEFKLVAVHLTTAT 296
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592860721|gb|GAXK01096841.1| (TSA: Calanus finmarchicus comp54344_c33_seq1 transcribed RNA sequence) HSP 1 Score: 29.261 bits (64), Expect = 1.197e+0 Identity = 23/77 (29.87%), Postives = 43/77 (55.84%), Query Frame = 0 Query: 1 MLLKRRISKSRHFKSALLFLFLLQTTYSKS-----FYRQKRSAKRLFENLKEHFDMSLEFQLRRIGLSSTTLKITSE 72 M + ++KS+H + L+F+ L+T + ++ +Y Q A+ ENLKE D++ EF+++ GL S ++ E Sbjct: 160 MFFRVMLNKSKH-QHPLIFMKGLKTKHLQNILDFIYYGQVSVAQ---ENLKEFIDIAKEFEIQ--GLQSLMQGVSDE 372
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592901877|gb|GAXK01056498.1| (TSA: Calanus finmarchicus comp304502_c0_seq4 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.850e+0 Identity = 14/30 (46.67%), Postives = 16/30 (53.33%), Query Frame = 0 Query: 23 LQTTYSKSFYRQKRSAKRLFENLKEHFDMS 52 LQ KSFY RS +R F + KEH S Sbjct: 633 LQVVLDKSFYDVNRSFERWFYSKKEHLAKS 722
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592901878|gb|GAXK01056497.1| (TSA: Calanus finmarchicus comp304502_c0_seq3 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.854e+0 Identity = 14/30 (46.67%), Postives = 16/30 (53.33%), Query Frame = 0 Query: 23 LQTTYSKSFYRQKRSAKRLFENLKEHFDMS 52 LQ KSFY RS +R F + KEH S Sbjct: 650 LQVVLDKSFYDVNRSFERWFYSKKEHLAKS 739
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592901879|gb|GAXK01056496.1| (TSA: Calanus finmarchicus comp304502_c0_seq2 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.888e+0 Identity = 14/30 (46.67%), Postives = 16/30 (53.33%), Query Frame = 0 Query: 23 LQTTYSKSFYRQKRSAKRLFENLKEHFDMS 52 LQ KSFY RS +R F + KEH S Sbjct: 633 LQVVLDKSFYDVNRSFERWFYSKKEHLAKS 722
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592901880|gb|GAXK01056495.1| (TSA: Calanus finmarchicus comp304502_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.892e+0 Identity = 14/30 (46.67%), Postives = 16/30 (53.33%), Query Frame = 0 Query: 23 LQTTYSKSFYRQKRSAKRLFENLKEHFDMS 52 LQ KSFY RS +R F + KEH S Sbjct: 650 LQVVLDKSFYDVNRSFERWFYSKKEHLAKS 739
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592860765|gb|GAXK01096797.1| (TSA: Calanus finmarchicus comp54344_c15_seq4 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 4.043e+0 Identity = 22/69 (31.88%), Postives = 40/69 (57.97%), Query Frame = 0 Query: 1 MLLKRRISKSRHFKSALLFLFLLQTTYSKS-----FYRQKRSAKRLFENLKEHFDMSLEFQLRRIGLSS 64 M + ++KS+H + L+F+ L+T + ++ +Y Q A+ ENLKE D++ EF+++ GL S Sbjct: 237 MFFRVMLNKSKH-QHPLIFMKGLKTKHLQNILDFIYYGQVSVAQ---ENLKEFIDIAKEFEIQ--GLQS 425
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Match: gi|592878692|gb|GAXK01079209.1| (TSA: Calanus finmarchicus comp267685_c0_seq1 transcribed RNA sequence) HSP 1 Score: 26.9498 bits (58), Expect = 9.211e+0 Identity = 17/49 (34.69%), Postives = 25/49 (51.02%), Query Frame = 0 Query: 9 KSRHFKSALLFLFLLQTTYSKSFYRQKRSAKRLFENLKEHFDMSLEFQL 57 K++ + LL+ + TT SKSFYR ++ HF SL FQ+ Sbjct: 205 KTKTMTA*LLWE*VPDTTSSKSFYRTTKTTMMELVVTSRHFLNSLSFQV 351
BLAST of EMLSAG00000000377 vs. L. salmonis peptides
Match: EMLSAP00000000377 (pep:novel supercontig:LSalAtl2s:LSalAtl2s1058:110779:111072:-1 gene:EMLSAG00000000377 transcript:EMLSAT00000000377 description:"snap_masked-LSalAtl2s1058-processed-gene-0.2") HSP 1 Score: 162.925 bits (411), Expect = 2.876e-53 Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 0 Query: 1 MLLKRRISKSRHFKSALLFLFLLQTTYSKSFYRQKRSAKRLFENLKEHFDMSLEFQLRRIGLSSTTLKITSEFFVIEEMNYDT 83 MLLKRRISKSRHFKSALLFLFLLQTTYSKSFYRQKRSAKRLFENLKEHFDMSLEFQLRRIGLSSTTLKITSEFFVIEEMNYDT Sbjct: 1 MLLKRRISKSRHFKSALLFLFLLQTTYSKSFYRQKRSAKRLFENLKEHFDMSLEFQLRRIGLSSTTLKITSEFFVIEEMNYDT 83 The following BLAST results are available for this feature:
BLAST of EMLSAG00000000377 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000000377 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 9
BLAST of EMLSAG00000000377 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 1
BLAST of EMLSAG00000000377 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000000377 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000000377 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 0
BLAST of EMLSAG00000000377 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 0
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s1058:110779..111072- Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000000377-683143 ID=EMLSAG00000000377-683143|Name=EMLSAG00000000377|organism=Lepeophtheirus salmonis|type=gene|length=294bp|location=Sequence derived from alignment at LSalAtl2s1058:110779..111072- (Lepeophtheirus salmonis)back to top Add to Basket
|