EMLSAG00000007801, EMLSAG00000007801-690567 (gene) Lepeophtheirus salmonis

Overview
NameEMLSAG00000007801
Unique NameEMLSAG00000007801-690567
Typegene
OrganismLepeophtheirus salmonis (salmon louse)
Associated RNAi Experiments

Nothing found

Homology
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:ACO1 "Uncharacterized protein" species:9823 "Sus scrofa" [GO:0003994 "aconitate hydratase activity" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=IEA] [GO:0006417 "regulation of translation" evidence=IEA] [GO:0006879 "cellular iron ion homeostasis" evidence=IEA] [GO:0009791 "post-embryonic development" evidence=IEA] [GO:0010040 "response to iron(II) ion" evidence=IEA] [GO:0030350 "iron-responsive element binding" evidence=IEA] [GO:0050892 "intestinal absorption" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005739 GO:GO:0005794 GO:GO:0006417 GO:GO:0051539 GO:GO:0006879 GO:GO:0009791 GO:GO:0006101 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 GO:GO:0030350 GO:GO:0010040 GeneTree:ENSGT00730000110874 OMA:SVMMAAG OrthoDB:EOG7CG6Z7 TreeFam:TF313476 GO:GO:0050892 EMBL:FP340205 Ensembl:ENSSSCT00000023699 ArrayExpress:I3LJW4 Uniprot:I3LJW4)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 451/904 (49.89%), Postives = 635/904 (70.24%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R     Q  V KD  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF+N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRD+  ++ ++KY++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   D   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+++V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L  P+    + W+  STYIK P + +++  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PR++NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I + + P+  + V +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   29 KFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCD--QFLVKKDDVENILNWNVLQHENIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFRNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDEDKVKHIKKYLQAVGMFRDFSDSSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQIAPDHHNDHKTFIYDNSEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEAVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGMNAK-GQQVFLKDIWPTRDEIQAVERQFVIPGMFKEVYQKIETVNESWNALEAPSDT-LYSWNPKSTYIKSPPFFEDLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGEVLDVFDAAERYQQAGLPLIILAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIPETLKPQMKVQVKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 895          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:ACO1 "Cytoplasmic aconitate hydratase" species:9606 "Homo sapiens" [GO:0003723 "RNA binding" evidence=IDA;NAS] [GO:0003994 "aconitate hydratase activity" evidence=IDA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005737 "cytoplasm" evidence=NAS;IDA] [GO:0005739 "mitochondrion" evidence=IDA] [GO:0005783 "endoplasmic reticulum" evidence=IDA] [GO:0005794 "Golgi apparatus" evidence=IDA] [GO:0005829 "cytosol" evidence=IDA] [GO:0006099 "tricarboxylic acid cycle" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=IDA] [GO:0006417 "regulation of translation" evidence=IEA] [GO:0006879 "cellular iron ion homeostasis" evidence=IEA] [GO:0009791 "post-embryonic development" evidence=IEA] [GO:0010040 "response to iron(II) ion" evidence=IDA] [GO:0030350 "iron-responsive element binding" evidence=IDA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0050892 "intestinal absorption" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IDA] [GO:0070062 "extracellular vesicular exosome" evidence=IDA] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005739 GO:GO:0005794 GO:GO:0070062 GO:GO:0006417 GO:GO:0046872 GO:GO:0006099 GO:GO:0051539 GO:GO:0006879 GO:GO:0009791 GO:GO:0006101 eggNOG:COG1048 HOGENOM:HOG000025704 KO:K01681 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 CTD:48 HOVERGEN:HBG052147 GO:GO:0030350 GO:GO:0010040 OMA:SVMMAAG EMBL:Z11559 EMBL:DQ496106 EMBL:AL161783 EMBL:CH471071 EMBL:BC018103 EMBL:M58510 PIR:S26403 RefSeq:NP_001265281.1 RefSeq:NP_002188.1 RefSeq:XP_005251533.1 RefSeq:XP_005251534.1 UniGene:Hs.567229 PDB:2B3X PDB:2B3Y PDBsum:2B3X PDBsum:2B3Y ProteinModelPortal:P21399 SMR:P21399 BioGrid:106564 IntAct:P21399 STRING:9606.ENSP00000309477 PhosphoSite:P21399 DMDM:3123225 REPRODUCTION-2DPAGE:IPI00008485 UCD-2DPAGE:P21399 PaxDb:P21399 PeptideAtlas:P21399 PRIDE:P21399 Ensembl:ENST00000309951 Ensembl:ENST00000379923 GeneID:48 KEGG:hsa:48 UCSC:uc003zqw.4 GeneCards:GC09P032374 HGNC:HGNC:117 HPA:HPA019371 HPA:HPA024157 MIM:100880 neXtProt:NX_P21399 PharmGKB:PA24442 InParanoid:P21399 OrthoDB:EOG7CG6Z7 PhylomeDB:P21399 TreeFam:TF313476 BioCyc:MetaCyc:HS04597-MONOMER EvolutionaryTrace:P21399 GenomeRNAi:48 NextBio:187 PRO:PR:P21399 ArrayExpress:P21399 Bgee:P21399 CleanEx:HS_ACO1 Genevestigator:P21399 GO:GO:0050892 Uniprot:P21399)

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 456/905 (50.39%), Postives = 633/905 (69.94%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R   E    V K   E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I YL Q+GRD+  ++ ++KY++ V MFR  +D +++  F  ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   D   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YLQESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P+  DK F W+S STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  VM RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I +N+ P+  + V +    ++F+AV+R D D E   F  GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFL--VKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS--DKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTG-KTFQAVMRFDTDVELTYFLNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:ACO1 "Cytoplasmic aconitate hydratase" species:9913 "Bos taurus" [GO:0003994 "aconitate hydratase activity" evidence=ISS] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006099 "tricarboxylic acid cycle" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=ISS] [GO:0010040 "response to iron(II) ion" evidence=ISS] [GO:0030350 "iron-responsive element binding" evidence=ISS] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=ISS] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 Prosite:PS00450 GO:GO:0005737 GO:GO:0046872 GO:GO:0006099 GO:GO:0051539 GO:GO:0006101 eggNOG:COG1048 HOGENOM:HOG000025704 KO:K01681 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 EMBL:BC120006 RefSeq:NP_001069059.1 UniGene:Bt.53789 ProteinModelPortal:Q0VCU1 SMR:Q0VCU1 STRING:9913.ENSBTAP00000000731 PaxDb:Q0VCU1 PRIDE:Q0VCU1 GeneID:512995 KEGG:bta:512995 CTD:48 HOVERGEN:HBG052147 InParanoid:Q0VCU1 NextBio:20870650 GO:GO:0030350 GO:GO:0010040 Uniprot:Q0VCU1)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 456/905 (50.39%), Postives = 641/905 (70.83%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R       K+++ +  + WK +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERNKERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRDK  ++ +++Y++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++      H  F  N     FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GLSV   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+++V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P+  DK + W+  STYIK P + +++  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG+RA+LA S++  +RSNLV  G++PL+     +     L G E  +I I + + P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGSLPFSIRVLLEAAIRNCDQFLVKKNDVENILNWKVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPICPADLVIDHSIQVDFNR-------------------------------RADSLKKNQDLEFERNKERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYRLVGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDKEKVKHIKQYLQAVGMFRDFSDSSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN--NSKFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLSVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEAVVEAIVQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALAAPS--DKLYCWNPKSTYIKSPPFFEDLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIRAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIPETLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:ACO1 "Cytoplasmic aconitate hydratase" species:9913 "Bos taurus" [GO:0003994 "aconitate hydratase activity" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=IEA] [GO:0006417 "regulation of translation" evidence=IEA] [GO:0006879 "cellular iron ion homeostasis" evidence=IEA] [GO:0009791 "post-embryonic development" evidence=IEA] [GO:0010040 "response to iron(II) ion" evidence=IEA] [GO:0030350 "iron-responsive element binding" evidence=IEA] [GO:0050892 "intestinal absorption" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005739 GO:GO:0005794 GO:GO:0006417 GO:GO:0051539 GO:GO:0006879 GO:GO:0009791 GO:GO:0006101 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 GO:GO:0030350 GO:GO:0010040 GeneTree:ENSGT00730000110874 OMA:SVMMAAG OrthoDB:EOG7CG6Z7 TreeFam:TF313476 GO:GO:0050892 EMBL:DAAA02021991 Ensembl:ENSBTAT00000000731 Uniprot:F1MS05)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 456/905 (50.39%), Postives = 641/905 (70.83%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R       K+++ +  + WK +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERNKERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRDK  ++ +++Y++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++      H  F  N     FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GLSV   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+++V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P+  DK + W+  STYIK P + +++  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG+RA+LA S++  +RSNLV  G++PL+     +     L G E  +I I + + P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGSLPFSIRVLLEAAIRNCDQFLVKKNDVENILNWKVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPICPADLVIDHSIQVDFNR-------------------------------RADSLKKNQDLEFERNKERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYRLVGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDKEKVKHIKQYLQVVGMFRDFSDSSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN--NSKFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLSVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEAVVEAIVQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALAAPS--DKLYCWNPKSTYIKSPPFFEDLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIRAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIPETLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:Aco1 "Cytoplasmic aconitate hydratase" species:10116 "Rattus norvegicus" [GO:0003994 "aconitate hydratase activity" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=IEA] [GO:0006417 "regulation of translation" evidence=IEA] [GO:0006879 "cellular iron ion homeostasis" evidence=IEA] [GO:0009791 "post-embryonic development" evidence=IEA] [GO:0010040 "response to iron(II) ion" evidence=IEA] [GO:0030350 "iron-responsive element binding" evidence=IEA] [GO:0050892 "intestinal absorption" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 RGD:2019 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005739 GO:GO:0005794 GO:GO:0006417 GO:GO:0051539 GO:GO:0006879 GO:GO:0009791 GO:GO:0006101 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 GO:GO:0030350 GO:GO:0010040 GeneTree:ENSGT00730000110874 OMA:SVMMAAG OrthoDB:EOG7CG6Z7 GO:GO:0050892 EMBL:CH473962 EMBL:AABR06036674 EMBL:AABR06036675 EMBL:AABR06036676 Ensembl:ENSRNOT00000008337 NextBio:35583786 Uniprot:G3V6S2)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 458/906 (50.55%), Postives = 635/906 (70.09%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+D ++I YL Q+GR++  ++ +++Y++ V MFR  SD +++  F  ++E+DL  ++PC SGPKR +DKV+++E+  DF+S L  K+G KG+ ++      H  F  N D E FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   VKTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG N+  G+ +FLK+IWP+R EIQE+ERK VIPG++++VY K+   NK W++L+ P S   + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PR++NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I +++ P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDIENILNWSIMQHKSIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDNVSIAYLVQTGREEDKVKHIKRYLQAVGMFRDFSDSSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSEMKRDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN-DSE-FTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLNVKPYVKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQ-GQQVFLKDIWPTRDEIQEVERKYVIPGMFKEVYQKIETVNKSWNALAAP-SEKLYAWNPKSTYIKSPPFFESLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTVHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGETADSLGLTGRERYTIHIPEDLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:Aco1 "aconitase 1" species:10090 "Mus musculus" [GO:0003723 "RNA binding" evidence=ISO] [GO:0003994 "aconitate hydratase activity" evidence=ISO;IDA] [GO:0005737 "cytoplasm" evidence=ISO;IDA] [GO:0005739 "mitochondrion" evidence=ISO;IDA] [GO:0005783 "endoplasmic reticulum" evidence=ISO] [GO:0005794 "Golgi apparatus" evidence=ISO] [GO:0005829 "cytosol" evidence=ISO;IDA] [GO:0006099 "tricarboxylic acid cycle" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=ISO] [GO:0006417 "regulation of translation" evidence=IMP] [GO:0006879 "cellular iron ion homeostasis" evidence=ISO;IGI;IMP] [GO:0008152 "metabolic process" evidence=IEA] [GO:0009791 "post-embryonic development" evidence=IGI] [GO:0010040 "response to iron(II) ion" evidence=ISO] [GO:0010468 "regulation of gene expression" evidence=IGI] [GO:0016829 "lyase activity" evidence=IEA] [GO:0030350 "iron-responsive element binding" evidence=ISO;IDA] [GO:0043231 "intracellular membrane-bounded organelle" evidence=ISO] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048027 "mRNA 5'-UTR binding" evidence=ISO] [GO:0050892 "intestinal absorption" evidence=IGI] [GO:0051536 "iron-sulfur cluster binding" evidence=ISO] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=ISO] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 MGI:MGI:87879 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005739 GO:GO:0005794 GO:GO:0006417 GO:GO:0046872 GO:GO:0006099 GO:GO:0051539 GO:GO:0006879 GO:GO:0009791 GO:GO:0006101 eggNOG:COG1048 HOGENOM:HOG000025704 KO:K01681 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 CTD:48 HOVERGEN:HBG052147 GO:GO:0030350 GO:GO:0010040 GeneTree:ENSGT00730000110874 OMA:SVMMAAG OrthoDB:EOG7CG6Z7 TreeFam:TF313476 GO:GO:0050892 EMBL:X61147 EMBL:AK163985 EMBL:AL831793 EMBL:CH466538 EMBL:BC005454 PIR:S18720 RefSeq:NP_031412.2 UniGene:Mm.331547 ProteinModelPortal:P28271 SMR:P28271 BioGrid:197924 PhosphoSite:P28271 REPRODUCTION-2DPAGE:P28271 SWISS-2DPAGE:P28271 PaxDb:P28271 PRIDE:P28271 Ensembl:ENSMUST00000102973 GeneID:11428 KEGG:mmu:11428 UCSC:uc008shd.1 ChiTaRS:ACO1 NextBio:278700 PRO:PR:P28271 ArrayExpress:P28271 Bgee:P28271 CleanEx:MM_ACO1 Genevestigator:P28271 Uniprot:P28271)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 454/916 (49.56%), Postives = 636/916 (69.43%), Query Frame = 0
Query:   15 LLKDFQVGERSYKYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            L +     +   +++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERNKERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I YL Q+GR++  ++ ++KY++ V MFR  +D +++  F  ++E+DL  ++PC SGPKR +DKV+++E+  DF+S L  K+G KG+ ++  + +   +       FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GLSV   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG N+  G  +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   NK W++L+ P S   + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I+I +++ P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:    8 LAEPLDAAQPGKRFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDIENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNKERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIAYLLQTGREEDKVKHIQKYLQAVGMFRDFNDTSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSEMKKDFESCLGAKQGFKGFQVAPDRHNDRKTFLYSNSEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLSVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQ-GRQVFLKDIWPTRDEIQAVERQHVIPGMFKEVYQKIETVNKSWNALAAP-SEKLYAWNPKSTYIKSPPFFESLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTVHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGETADSLGLTGRERYTINIPEDLKPRMTVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:Aco1 "Cytoplasmic aconitate hydratase" species:10116 "Rattus norvegicus" [GO:0003994 "aconitate hydratase activity" evidence=ISS] [GO:0005794 "Golgi apparatus" evidence=IDA] [GO:0006099 "tricarboxylic acid cycle" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=ISS] [GO:0010040 "response to iron(II) ion" evidence=ISS] [GO:0030350 "iron-responsive element binding" evidence=ISS] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=ISS] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 RGD:2019 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005794 GO:GO:0006417 GO:GO:0046872 GO:GO:0006099 GO:GO:0051539 GO:GO:0006879 GO:GO:0006101 eggNOG:COG1048 HOGENOM:HOG000025704 KO:K01681 GO:GO:0003994 GO:GO:0048027 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 CTD:48 HOVERGEN:HBG052147 GO:GO:0030350 GO:GO:0010040 EMBL:L23874 PIR:A44154 RefSeq:NP_059017.1 UniGene:Rn.35934 ProteinModelPortal:Q63270 SMR:Q63270 BioGrid:248407 MINT:MINT-4569119 STRING:10116.ENSRNOP00000057501 PhosphoSite:Q63270 PaxDb:Q63270 PRIDE:Q63270 GeneID:50655 KEGG:rno:50655 UCSC:RGD:2019 NextBio:610466 PRO:PR:Q63270 Genevestigator:Q63270 Uniprot:Q63270)

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 458/906 (50.55%), Postives = 635/906 (70.09%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QV +N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+D+++I YL Q+GR++  ++ +++Y++ V MFR  SD +++  F  ++E+DL  ++PC SGPKR +DKV+++EI  DF+S L  K+G KG+ ++      H  F  N D E FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   VKTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG N+  G+ +FLK+IWP+R EIQE+ERK VIPG++++VY K+   NK W++L+ P S   + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PR++NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++ T+ SNLV  G++PL+     +     L G E  +I I +++ P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDIENILNWSIMQHKSIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVHFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDDVSIAYLVQTGREEDKVKHIKRYLQAVGMFRDFSDSSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSEIEKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN-DSE-FTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLNVKPYVKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQ-GQQVFLKDIWPTRDEIQEVERKYVIPGMFKEVYQKIETVNKSWNALAAP-SEKLYAWNPKSTYIKSPPFFESLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTVHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERTHCSNLVGMGVIPLEYLPGETADSLGLTGRERYTIHIPEHLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:Aco1 "aconitase 1, soluble" species:10116 "Rattus norvegicus" [GO:0003723 "RNA binding" evidence=ISO] [GO:0003729 "mRNA binding" evidence=TAS] [GO:0003994 "aconitate hydratase activity" evidence=IEA;ISO;ISS;IDA] [GO:0005737 "cytoplasm" evidence=ISO;TAS] [GO:0005739 "mitochondrion" evidence=IEA;ISO] [GO:0005783 "endoplasmic reticulum" evidence=IEA;ISO;IDA] [GO:0005794 "Golgi apparatus" evidence=IEA;ISO;IDA] [GO:0005829 "cytosol" evidence=IEA;ISO;IDA] [GO:0006099 "tricarboxylic acid cycle" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=IEA;ISO;ISS] [GO:0006417 "regulation of translation" evidence=IEA;ISO;TAS] [GO:0006879 "cellular iron ion homeostasis" evidence=IEA;ISO;IDA] [GO:0009791 "post-embryonic development" evidence=IEA;ISO] [GO:0010040 "response to iron(II) ion" evidence=IEA;ISO;ISS] [GO:0010468 "regulation of gene expression" evidence=ISO] [GO:0030350 "iron-responsive element binding" evidence=IEA;ISO;ISS;IDA;TAS] [GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048027 "mRNA 5'-UTR binding" evidence=IDA] [GO:0050892 "intestinal absorption" evidence=IEA;ISO] [GO:0051536 "iron-sulfur cluster binding" evidence=IDA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA;ISO;ISS] [GO:0070062 "extracellular vesicular exosome" evidence=ISO] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 RGD:2019 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005794 GO:GO:0006417 GO:GO:0046872 GO:GO:0006099 GO:GO:0051539 GO:GO:0006879 GO:GO:0006101 eggNOG:COG1048 HOGENOM:HOG000025704 KO:K01681 GO:GO:0003994 GO:GO:0048027 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 CTD:48 HOVERGEN:HBG052147 GO:GO:0030350 GO:GO:0010040 EMBL:L23874 PIR:A44154 RefSeq:NP_059017.1 UniGene:Rn.35934 ProteinModelPortal:Q63270 SMR:Q63270 BioGrid:248407 MINT:MINT-4569119 STRING:10116.ENSRNOP00000057501 PhosphoSite:Q63270 PaxDb:Q63270 PRIDE:Q63270 GeneID:50655 KEGG:rno:50655 UCSC:RGD:2019 NextBio:610466 PRO:PR:Q63270 Genevestigator:Q63270 Uniprot:Q63270)

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 458/906 (50.55%), Postives = 635/906 (70.09%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QV +N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+D+++I YL Q+GR++  ++ +++Y++ V MFR  SD +++  F  ++E+DL  ++PC SGPKR +DKV+++EI  DF+S L  K+G KG+ ++      H  F  N D E FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   VKTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG N+  G+ +FLK+IWP+R EIQE+ERK VIPG++++VY K+   NK W++L+ P S   + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PR++NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++ T+ SNLV  G++PL+     +     L G E  +I I +++ P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDIENILNWSIMQHKSIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVHFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDDVSIAYLVQTGREEDKVKHIKRYLQAVGMFRDFSDSSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSEIEKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN-DSE-FTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLNVKPYVKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQ-GQQVFLKDIWPTRDEIQEVERKYVIPGMFKEVYQKIETVNKSWNALAAP-SEKLYAWNPKSTYIKSPPFFESLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTVHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERTHCSNLVGMGVIPLEYLPGETADSLGLTGRERYTIHIPEHLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:ACO1 "Cytoplasmic aconitate hydratase" species:9031 "Gallus gallus" [GO:0003723 "RNA binding" evidence=IEA] [GO:0003994 "aconitate hydratase activity" evidence=IEA] [GO:0005737 "cytoplasm" evidence=IEA] [GO:0006099 "tricarboxylic acid cycle" evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 Prosite:PS00450 GO:GO:0005737 GO:GO:0046872 GO:GO:0006099 GO:GO:0051539 GO:GO:0003723 eggNOG:COG1048 HOGENOM:HOG000025704 KO:K01681 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 CTD:48 HOVERGEN:HBG052147 EMBL:D16150 RefSeq:NP_001025707.1 UniGene:Gga.4139 ProteinModelPortal:Q90875 SMR:Q90875 STRING:9031.ENSGALP00000003381 PaxDb:Q90875 PRIDE:Q90875 GeneID:373916 KEGG:gga:373916 InParanoid:Q90875 NextBio:20813448 PRO:PR:Q90875 Uniprot:Q90875)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 452/903 (50.06%), Postives = 628/903 (69.55%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIG---SNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++++++   Y  LP+S+RVLLE A+R       K+ + +  + WK +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                +D+L+ NQ  EFERNKERF FLKW + AFKN+ +IPPG+G++HQVNLEYLARVV  Q G  +PDSVVGTD+HTTM++GLGVLGWGVG ++A+AVM G P+++  P VVG ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   +FP+D+I+I YL Q+GRDK  +   +KY++ V M R   + +++  F  ++E+DL  ++PC SGPKR +DKV+++++  DF++ L  K+G KG+ ++  + +     N +G  F + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   +KTSL+PGSGVVT YL+ESGVM YL  LGF++VGYGC TC  NSGP LPDS+V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG  S +G+ IFLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L  P+  DK + W+  STYIK P +   +       +  ++   LL  GD++T+DHISPAG+I R+SPAA YL+S GL PRE+NSYG+RRGN  VM RGTF+N+RL N  ++K GP T+H PS  T  +F+A+ERYK  G  L  + GK +G G+SRDWA +GPFLLGV+A+LA S++  +RSNLV  G++PLQ           L G E  +I I +N+ P+  I + +    ++F A++R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLSKLEDVRYARLPFSIRVLLEAAIRNCDEFLVKKQDVENILNWKVMQHKNVEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPICPADLVIDHSIQVDFNR-------------------------------RSDSLQKNQDLEFERNKERFEFLKWGSQAFKNMRIIPPGSGIIHQVNLEYLARVVMDQDGYYYPDSVVGTDSHTTMVDGLGVLGWGVGGIEAEAVMLGQPISMVLPEVVGYKLLGNPQPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAYFPVDDISIGYLVQTGRDKEKVLCTKKYLEAVGMLRDFKNSSQDPDFTQVVELDLHTVVPCCSGPKRPQDKVAVSDMKKDFETCLGAKQGFKGFQIAPDRHNSVIKFNFEGCDFELAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLTVKPYIKTSLSPGSGVVTYYLRESGVMSYLSQLGFDVVGYGCMTCIGNSGP-LPDSVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGI-SASGKKIFLKDIWPTRNEIQAVERQYVIPGMFKEVYQKIETVNEAWNALDAPS--DKLYTWNPKSTYIKSPPFFDGLTLALQTPKTIEDAYVLLNFGDSVTTDHISPAGNIARNSPAARYLTSRGLTPREFNSYGSRRGNDAVMARGTFANIRLVNKFIDKQGPQTIHFPSGETLDVFDAAERYKQAGHPLIVLAGKEYGAGSSRDWAAKGPFLLGVKAVLAESYERIHRSNLVGMGVIPLQYLPGEDARTLGLTGRERYTIIIPENLKPQMNIQIKLDTG-KTFHAIMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. GO
Match: - (symbol:ACO1 "Cytoplasmic aconitate hydratase" species:9031 "Gallus gallus" [GO:0003994 "aconitate hydratase activity" evidence=IEA] [GO:0005739 "mitochondrion" evidence=IEA] [GO:0005783 "endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus" evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0006101 "citrate metabolic process" evidence=IEA] [GO:0006417 "regulation of translation" evidence=IEA] [GO:0006879 "cellular iron ion homeostasis" evidence=IEA] [GO:0009791 "post-embryonic development" evidence=IEA] [GO:0010040 "response to iron(II) ion" evidence=IEA] [GO:0030350 "iron-responsive element binding" evidence=IEA] [GO:0050892 "intestinal absorption" evidence=IEA] [GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA] InterPro:IPR000573 InterPro:IPR001030 InterPro:IPR006249 InterPro:IPR015928 InterPro:IPR015931 InterPro:IPR015932 InterPro:IPR015934 InterPro:IPR015937 Pfam:PF00330 Pfam:PF00694 PRINTS:PR00415 Prosite:PS00450 GO:GO:0005783 GO:GO:0005829 GO:GO:0005739 GO:GO:0005794 GO:GO:0006417 GO:GO:0051539 GO:GO:0006879 GO:GO:0009791 GO:GO:0006101 GO:GO:0003994 Gene3D:3.20.19.10 Gene3D:3.30.499.10 Gene3D:3.40.1060.10 InterPro:IPR018136 PANTHER:PTHR11670 PANTHER:PTHR11670:SF1 SUPFAM:SSF52016 SUPFAM:SSF53732 TIGRFAMs:TIGR01341 PROSITE:PS01244 GO:GO:0030350 GO:GO:0010040 GeneTree:ENSGT00730000110874 OMA:SVMMAAG OrthoDB:EOG7CG6Z7 TreeFam:TF313476 GO:GO:0050892 EMBL:AC187766 Ensembl:ENSGALT00000003386 ArrayExpress:F1NY25 Uniprot:F1NY25)

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 452/903 (50.06%), Postives = 628/903 (69.55%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIG---SNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++++++   Y  LP+S+RVLLE A+R       K+ + +  + WK +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                +D+L+ NQ  EFERNKERF FLKW + AFKN+ +IPPG+G++HQVNLEYLARVV  Q G  +PDSVVGTD+HTTM++GLGVLGWGVG ++A+AVM G P+++  P VVG ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   +FP+D+I+I YL Q+GRDK  +   +KY++ V M R   + +++  F  ++E+DL  ++PC SGPKR +DKV+++++  DF++ L  K+G KG+ ++  + +     N +G  F + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   +KTSL+PGSGVVT YL+ESGVM YL  LGF++VGYGC TC  NSGP LPDS+V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG  S +G+ IFLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L  P+  DK + W+  STYIK P +   +       +  ++   LL  GD++T+DHISPAG+I R+SPAA YL+S GL PRE+NSYG+RRGN  VM RGTF+N+RL N  ++K GP T+H PS  T  +F+A+ERYK  G  L  + GK +G G+SRDWA +GPFLLGV+A+LA S++  +RSNLV  G++PLQ           L G E  +I I +N+ P+  I + +    ++F A++R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLSKLEDVRYARLPFSIRVLLEAAIRNCDEFLVKKQDVENILNWKVMQHKNVEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPICPADLVIDHSIQVDFNR-------------------------------RSDSLQKNQDLEFERNKERFEFLKWGSQAFKNMRIIPPGSGIIHQVNLEYLARVVMDQDGYYYPDSVVGTDSHTTMVDGLGVLGWGVGGIEAEAVMLGQPISMVLPEVVGYKLLGNPQPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAYFPVDDISIGYLVQTGRDKEKVLCTKKYLEAVGMLRDFKNSSQDPDFTQVVELDLHTVVPCCSGPKRPQDKVAVSDMKKDFETCLGAKQGFKGFQIAPDRHNSVIKFNFEGCDFELAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLTVKPYIKTSLSPGSGVVTYYLRESGVMSYLSQLGFDVVGYGCMTCIGNSGP-LPDSVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGI-SASGKKIFLKDIWPTRNEIQAVERQYVIPGMFKEVYQKIETVNEAWNALDAPS--DKLYTWNPKSTYIKSPPFFDGLTLALQTPKTIEDAYVLLNFGDSVTTDHISPAGNIARNSPAARYLTSRGLTPREFNSYGSRRGNDAVMARGTFANIRLVNKFIDKQGPQTIHFPSGETLDVFDAAERYKQAGHPLIVLAGKEYGAGSSRDWAAKGPFLLGVKAVLAESYERIHRSNLVGMGVIPLQYLPGEDARTLGLTGRERYTIIIPENLKPQMNIQIKLDTG-KTFHAIMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592766715|gb|GAXK01187853.1| (TSA: Calanus finmarchicus comp11210_c2_seq1 transcribed RNA sequence)

HSP 1 Score: 868.996 bits (2244), Expect = 0.000e+0
Identity = 455/922 (49.35%), Postives = 617/922 (66.92%), Query Frame = 0
Query:   15 LLKDFQVGERSYKYYDVTQIQG-YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINXXXXXXXXXXTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFR--SSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSN---ARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDK 909
            L +  ++   ++ +Y++  +   Y +LP+S+RVLLE AVR     Q Q  K   E+IL                   RV+LQDFTGVPA++D AA+R++V   GG P+ ++  CP+DLV+DH VQVD                               +S  +D+   N+  EF+RN ERF+FLKW   AF+N+ ++PPG+G++HQVNLEYLARV   + G+L+PDSVVGTD+HTTMINGLGV+GWGVG ++A+AVM G P+++  P+VVG +I G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA VGFFP+D  +I YL Q+ RD+  I  V+KYM+TV M R  SS E + I F+S+ E+DLS ++P +SGPKR  D+V+ +++  DF++ L    G KGY L   +         D + + + HG+VL+AAI+SCTNTSNPSVMLGAG+LAKKAVE GL+V   +KTSL+PGSGVVT YLQESGV+PYL  LGF +VGYGC TC  NSGP LP+ +V+A+++G LVCCG+LSGNRNFEGR+ P  +ANYLASPL VIAYAIAGR+DI+ + EPL      G+ +FL++IWPSR EIQ +E K VIP ++++VY+K++ GN +W+ LS P+S+  +PW + STYIK P +   +  +    R  ++ + LL LGD++T+DHISPAGSI R+SPAA YL+S GL+PR++NS+G+RRGN  VM RGTF N+RL N  + K  P T+H+PS  T  +F+A++ Y      L  + GK++G G+SRDWA +GPFLLG++A++A S++  +RSNLV  GI+PLQ     +     L G E   IDI D +TP   I V      + F  V R D D E   +  GG++  +V K   K
Sbjct:  250 LKEPLEINGTAHTFYNLPALGAKYNKLPFSIRVLLESAVRNCDNFQIQ--KADVEKILNWAETQAAGVTVEIPFRPSRVVLQDFTGVPAVVDFAAMRDAVKALGGNPEDINPQCPSDLVIDHSVQVD-------------------------------VSRTSDSQAQNEALEFQRNHERFLFLKWGAQAFQNMLIVPPGSGIVHQVNLEYLARVCFNKDGLLYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQPISMVLPQVVGYKITGSPGPQVTSTDVVLTITKHLRQVGVVGKFVEFFGPGVTKLSIADRATIANMCPEYGATVGFFPVDSRSIDYLRQTSRDEKVITYVQKYMETVGMLRDFSSSEQDPI-FSSVHELDLSTVVPSLSGPKRPHDRVAASDMKTDFRACLSNPVGFKGYALPGDKMDTTMPFTFDNKEYILKHGSVLIAAITSCTNTSNPSVMLGAGMLAKKAVELGLTVAPYIKTSLSPGSGVVTYYLQESGVIPYLETLGFGVVGYGCMTCIGNSGP-LPEPVVEAVEKGELVCCGVLSGNRNFEGRIHPHTQANYLASPLFVIAYAIAGRVDIDFETEPLA-TLDNGKEVFLRDIWPSRDEIQAVETKYVIPAMFQEVYAKITTGNPNWNKLSAPSSI-LYPWDTSSTYIKHPPFFAGMTPDLPTKRPIRSAQVLLNLGDSVTTDHISPAGSIPRNSPAARYLASRGLSPRDFNSFGSRRGNDAVMARGTFGNIRLVNKFIGKATPKTVHIPSGTTLDVFDAAQEYSTTDTDLIILAGKDYGCGSSRDWAAKGPFLLGIKAVIAESYERIHRSNLVGMGIVPLQYEEGQTAEGLGLTGKEKYDIDIPDTLTPGMKITVSTDTG-KQFSVVSRFDTDLELTYYKHGGILNYMVRKLAAK 2901          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592778709|gb|GAXK01175859.1| (TSA: Calanus finmarchicus comp2443_c8_seq1 transcribed RNA sequence)

HSP 1 Score: 162.54 bits (410), Expect = 4.625e-40
Identity = 189/742 (25.47%), Postives = 323/742 (43.53%), Query Frame = 0
Query:  172 NKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSV-VGTDTHTTMINXXXXXXXXXXTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRAN-YLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPG--IYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNK-VGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITS-ISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVV--RVDNDYETDVFHAGGVIAQIVSK 905
            N E + FL   + A   +    PG+G++HQ+ LE  A          FP  + VGTD+HT    GLG L  GVG  DA  VM   P  L  PRV+G+++ G +S +++  D++L +   L   G   + VE+FG  +  +S     TI NM  E GA    FP ++  + YLA + R +   +   KY +++        + + ++  ++EIDL+ + P V+GP        I+++AA  K+         G+ L    G                        I SCTN+S   +   A L+ K+A+  G+         + PGS  + + ++  G+   +   G  ++   C       GP +       +K+G      + S NRNF GR D +   + ++ SP M +A  +AG +D N  ++ L   +  G  + L + +         +     PG   Y+   +  S  N           VD  P +SD   +  P + + IGS   +   MR L+K+    T+DHIS AG   +     E +S+                  ++++    S  +  N + N+  G Y           + + + +Y++ G +    G +N+G G+SR+ A   P  LG RAI+  SF   + +NL K G+LPL   +   YE ++ T+ ++I   ++  P   ++ V+  A+ S   +V     N+ + + F AG  + ++  K
Sbjct:  243 NAEVYNFLA-TSGAKYGVGFWKPGSGIIHQIILENYA----------FPGLLMVGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPRVIGVKLTGKLSGWTSPKDVILKVAGILTVKGGTMSIVEYFGDGVDSISATGMGTICNMGAELGATTSVFPFNQRMVDYLAATER-QGIADEASKYKESLL-----SPDPDCKYDQVVEIDLNTLEPHVNGPFTPDLATPISDLAAAAKA--------NGWPLEVKDG-----------------------LIGSCTNSSYEDMSRVASLM-KQALAKGMKSKG--NFYITPGSEQIRATIERDGLADTMREFGGVVLANAC-------GPCIGQWDRTNVKKGEKNTI-VTSYNRNFTGRNDANPATHCFVTSPEMTVALTMAGSLDFNPLKDTL--TAEDGSELSLSDPFGDGLPANGFD-----PGEDTYQAPPADGSAVN-----------VDVAP-TSDRLQLLTP-FDRWIGS---DLTGMRILIKVEGKCTTDHISAAGPWLKYRGHLENISN------------------NLLITAINSENKEMNTVKNQETGAY---------GGVPDVARQYRDAGTNWVVFGDENYGEGSSREHAALEPRFLGGRAIIVKSFARIHETNLKKQGMLPLTFNNKADYELVQPTDKVAITGLEDFLPGKALNCVLSHADGSSDTIVLDHTFNEQQIEWFKAGSALNRMKEK 2141          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592778707|gb|GAXK01175861.1| (TSA: Calanus finmarchicus comp2443_c9_seq2 transcribed RNA sequence)

HSP 1 Score: 115.931 bits (289), Expect = 8.758e-26
Identity = 117/424 (27.59%), Postives = 191/424 (45.05%), Query Frame = 0
Query:  172 NKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSV-VGTDTHTTMINXXXXXXXXXXTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQG--NLVCCGLLSGNRNFEGRLDPDIRAN-YLASPLMVIAYAIAGRIDIN 591
            N E + FL   + A   +    PG+G++HQ+ LE  A          FP  + VGTD+HT    GLG L  GVG  DA  VM   P  L  PRV+G+++ G +S +++  D++L +   L   G   + VE+FG  +  +S     TI NM  E GA    FP ++  + YLA + R +   +   KY +++        + + ++  ++EIDL+ + P V+GP        I+++AA  K+         G+ L    G                        I SCTN+S   +   A L+ K+A+  G+         + PGS  + + ++  G+   +   G  ++   C       GP +       +K+G  N +   + S NRNF GR D +   + ++ SP M +A  +AG +D N
Sbjct:  688 NAEVYNFLA-TSGAKYGVGFWKPGSGIIHQIILENYA----------FPGLLMVGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPRVIGVKLTGKLSGWTSPKDVILKVAGILTVKGGTMSIVEYFGDGVDSISATGMGTICNMGAELGATTSVFPFNQRMVDYLAATER-QGIADEASKYKESLL-----SPDPDCKYDQVVEIDLNTLEPHVNGPFTPDLATPISDLAAAAKA--------NGWPLEVKDG-----------------------LIGSCTNSSYEDMSRVASLM-KQALAKGMKSKG--NFYITPGSEQIRATIERDGLADTMREFGGVVLANAC-------GPCIGQWDRTNVKKGEKNTI---VTSYNRNFTGRNDANPATHCFVTSPEMTVALTMAGSLDFN 1776          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592778708|gb|GAXK01175860.1| (TSA: Calanus finmarchicus comp2443_c9_seq1 transcribed RNA sequence)

HSP 1 Score: 115.931 bits (289), Expect = 8.797e-26
Identity = 117/424 (27.59%), Postives = 191/424 (45.05%), Query Frame = 0
Query:  172 NKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSV-VGTDTHTTMINXXXXXXXXXXTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQG--NLVCCGLLSGNRNFEGRLDPDIRAN-YLASPLMVIAYAIAGRIDIN 591
            N E + FL   + A   +    PG+G++HQ+ LE  A          FP  + VGTD+HT    GLG L  GVG  DA  VM   P  L  PRV+G+++ G +S +++  D++L +   L   G   + VE+FG  +  +S     TI NM  E GA    FP ++  + YLA + R +   +   KY +++        + + ++  ++EIDL+ + P V+GP        I+++AA  K+         G+ L    G                        I SCTN+S   +   A L+ K+A+  G+         + PGS  + + ++  G+   +   G  ++   C       GP +       +K+G  N +   + S NRNF GR D +   + ++ SP M +A  +AG +D N
Sbjct:  688 NAEVYNFLA-TSGAKYGVGFWKPGSGIIHQIILENYA----------FPGLLMVGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPRVIGVKLTGKLSGWTSPKDVILKVAGILTVKGGTMSIVEYFGDGVDSISATGMGTICNMGAELGATTSVFPFNQRMVDYLAATER-QGIADEASKYKESLL-----SPDPDCKYDQVVEIDLNTLEPHVNGPFTPDLATPISDLAAAAKA--------NGWPLEVKDG-----------------------LIGSCTNSSYEDMSRVASLM-KQALAKGMKSKG--NFYITPGSEQIRATIERDGLADTMREFGGVVLANAC-------GPCIGQWDRTNVKKGEKNTI---VTSYNRNFTGRNDANPATHCFVTSPEMTVALTMAGSLDFN 1776          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592778705|gb|GAXK01175863.1| (TSA: Calanus finmarchicus comp2443_c9_seq4 transcribed RNA sequence)

HSP 1 Score: 73.559 bits (179), Expect = 5.197e-13
Identity = 67/256 (26.17%), Postives = 119/256 (46.48%), Query Frame = 0
Query:  654 SVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNK-VGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITS-ISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVV--RVDNDYETDVFHAGGVIAQIVSK 905
            +VD  P +SD   +  P + K IGS+     NMR L+K+    T+DHIS AG   +     E +S+                  ++++    S  +  N + N+  G Y           + + + +Y++ G +    G +N+G G+SR+ A   P  LG RAI+  SF   + +NL K G+LPL   +   YE ++ T+ ++I   ++  P   ++ V+  A+ S   +V     N+ + + F AG  + ++  K
Sbjct:   91 NVDVAP-TSDRLQLLTP-FDKWIGSDL---TNMRILIKVEGKCTTDHISAAGPWLKYRGHLENISN------------------NLLITAINSENKEMNTVKNQETGAYG---------GVPDVARQYRDAGTNWVVFGDENYGEGSSREHAALEPRFLGGRAIIVKSFARIHETNLKKQGMLPLTFNNKADYELVQPTDKVAITGLEDFLPGKALNCVLSHADGSSDTIVLDHTFNEQQIEWFKAGSALNRMKEK 762          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592778706|gb|GAXK01175862.1| (TSA: Calanus finmarchicus comp2443_c9_seq3 transcribed RNA sequence)

HSP 1 Score: 73.1738 bits (178), Expect = 9.196e-13
Identity = 67/256 (26.17%), Postives = 119/256 (46.48%), Query Frame = 0
Query:  654 SVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNK-VGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITS-ISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVV--RVDNDYETDVFHAGGVIAQIVSK 905
            +VD  P +SD   +  P + K IGS+     NMR L+K+    T+DHIS AG   +     E +S+                  ++++    S  +  N + N+  G Y           + + + +Y++ G +    G +N+G G+SR+ A   P  LG RAI+  SF   + +NL K G+LPL   +   YE ++ T+ ++I   ++  P   ++ V+  A+ S   +V     N+ + + F AG  + ++  K
Sbjct:  154 NVDVAP-TSDRLQLLTP-FDKWIGSDL---TNMRILIKVEGKCTTDHISAAGPWLKYRGHLENISN------------------NLLITAINSENKEMNTVKNQETGAYG---------GVPDVARQYRDAGTNWVVFGDENYGEGSSREHAALEPRFLGGRAIIVKSFARIHETNLKKQGMLPLTFNNKADYELVQPTDKVAITGLEDFLPGKALNCVLSHADGSSDTIVLDHTFNEQQIEWFKAGSALNRMKEK 825          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592778704|gb|GAXK01175864.1| (TSA: Calanus finmarchicus comp2443_c9_seq5 transcribed RNA sequence)

HSP 1 Score: 63.929 bits (154), Expect = 3.312e-10
Identity = 38/134 (28.36%), Postives = 72/134 (53.73%), Query Frame = 0
Query:  775 EASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSIS-YESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVV--RVDNDYETDVFHAGGVIAQIVSK 905
            + + +Y++ G +    G +N+G G+SR+ A   P  LG RAI+  SF   + +NL K G+LPL   + + YE ++ T+ ++I   ++  P   ++ V+  A+ S   +V     N+ + + F AG  + ++  K
Sbjct:  127 DVARQYRDAGTNWVVFGDENYGEGSSREHAALEPRFLGGRAIIVKSFARIHETNLKKQGMLPLTFNNKADYELVQPTDKVAITGLEDFLPGKALNCVLSHADGSSDTIVLDHTFNEQQIEWFKAGSALNRMKEK 528          
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Match: gi|592935787|gb|GAXK01022766.1| (TSA: Calanus finmarchicus comp1075233_c0_seq1 transcribed RNA sequence)

HSP 1 Score: 34.2686 bits (77), Expect = 1.896e+0
Identity = 14/34 (41.18%), Postives = 20/34 (58.82%), Query Frame = 0
Query:  131 SSPPDPSPKTPVLGDDICPFHQKMSYWADALRSN 164
            S PP   PK    G DICP   K  Y+A+A++++
Sbjct:  585 SGPPSAKPKPKFGGGDICPKCNKTVYFAEAMKAD 686          
BLAST of EMLSAG00000007801 vs. L. salmonis peptides
Match: EMLSAP00000007801 (pep:novel supercontig:LSalAtl2s:LSalAtl2s457:64181:67196:1 gene:EMLSAG00000007801 transcript:EMLSAT00000007801 description:"maker-LSalAtl2s457-snap-gene-0.30")

HSP 1 Score: 1889.77 bits (4894), Expect = 0.000e+0
Identity = 915/915 (100.00%), Postives = 915/915 (100.00%), Query Frame = 0
Query:    1 MKEGPSSGTMEDEDLLKDFQVGERSYKYYDVTQIQGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILRRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDKTTCETA 915
            MKEGPSSGTMEDEDLLKDFQVGERSYKYYDVTQIQGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILRRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDKTTCETA
Sbjct:    1 MKEGPSSGTMEDEDLLKDFQVGERSYKYYDVTQIQGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILRRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDKTTCETA 915          
BLAST of EMLSAG00000007801 vs. L. salmonis peptides
Match: EMLSAP00000000118 (pep:novel supercontig:LSalAtl2s:LSalAtl2s101:496791:499884:-1 gene:EMLSAG00000000118 transcript:EMLSAT00000000118 description:"augustus_masked-LSalAtl2s101-processed-gene-5.8")

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 444/922 (48.16%), Postives = 615/922 (66.70%), Query Frame = 0
Query:   13 EDLLKDFQVGERSYKYYDVTQIQ-GYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFS-VNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGS---NARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLL-NKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITS-ISYESL--KGTECLSIDIRDNITPKCLIDVVVGKAE---RSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            + +LK+F++G ++YKYYDV+ +   Y +LPYS+R+LLE AVR     Q  V++   E IL                 RV+LQDFTGVPA++D AA+R++V K GG P  ++  CP DLV+DH +QVD+ +                                + AL  N+  EF+RNKERF FLKW  S+F+N+ +IPPG+G++HQVNLEYLARV      ++FPDSVVGTD+HTTMINGLGV+GWGVG ++A+AVM G P+++  P VVG RI G       STD+VL ITK LRQ GV G FVEF+GP +K LS+ADRATISNMCPEYGA +G FP+D ++I+YL  + R+ S ++ +++Y+    + R   D++ +  F+ I+ +DL  ++   SGPKR +D+V++ ++  DF   L  K G KG+ +   + ++    +  D + + + HG+VL+AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+VP  +KTSL+PGSGVVT YL+ SGV+PYL  LGF IVGYG  TC  NSGP L D +V    +G+LVC G+LSGNRNFEGR++P  RANYLASP +VIAYAIAGR+DI+ + E LGF+++  E I+L++IWP+R EIQ +E+K ++P ++  VYSKV+ GN+ W+SL  P  +  +PW  +STYIK P +   +       +  KN   LL LG + T DHISPAG I R+ PAA YL+S  ++PRE+NSYG+RRGN  +M RGTF+N+RL N  L  K GP T+HL S     +F+A+  YK +   L  + GK++G G+SRDWA +GPFLLGVRA++A S++  +RSNLV  GI+PLQ +   S ESL   G E  S+++  N+ P+ ++D+ V   +   +SFKA VR D + E   +  GG++  ++ K
Sbjct:    6 DKILKNFEIGGKTYKYYDVSSLDPSYHKLPYSIRILLESAVRNCDNFQ--VYEKDVETILNWEGNRGKNAEIPFRPGRVILQDFTGVPAIVDFAAMRDAVKKLGGDPSKINPTCPTDLVIDHSIQVDFAR-------------------------------ESKALMKNEDLEFQRNKERFTFLKWGASSFQNMLIIPPGSGIVHQVNLEYLARVCFTDTDLVFPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQPISMVLPEVVGYRISGSPQPLVNSTDIVLTITKHLRQVGVVGRFVEFYGPGIKHLSIADRATISNMCPEYGATIGXFPVDLVSIEYLRLTNRESSKVKCIQEYLHLTNLLRDYEDKSTDPTFSQIVVLDLGTVVTSCSGPKRPQDRVAVTDMKNDFLQCLSNKIGFKGFAIPDNKKNITVPIIAPDNKEYILRHGSVLIAAITSCTNTSNPSVMLGAGLLAKKAVDKGLTVPPYIKTSLSPGSGVVTYYLKNSGVIPYLDALGFSIVGYGXMTCIGNSGP-LEDYVVXGXNKGDLVCAGVLSGNRNFEGRINPHTRANYLASPPLVIAYAIAGRVDIDFEVEALGFDANN-EPIYLRDIWPTRDEIQIVEKKYIVPSMFEDVYSKVTTGNERWNSLEAPKGI-LYPWDIESTYIKSPPFFDNMSEELPEPKKIKNALALLNLGXSFTXDHISPAGXIARNXPAARYLASKNISPREFNSYGSRRGNDAIMARGTFANIRLVNKFLGGKPGPKTIHLISGDIMDVFDAAMEYKKENQHLIVLAGKDYGCGSSRDWAAKGPFLLGVRAVIAESYERIHRSNLVGMGIVPLQYSEGESSESLGFSGKEKFSVELPTNLIPQQVLDIKVECLDGSIKSFKATVRFDTELELTYYRHGGILNYMIRK 891          
BLAST of EMLSAG00000007801 vs. L. salmonis peptides
Match: EMLSAP00000008083 (pep:novel supercontig:LSalAtl2s:LSalAtl2s481:171581:178388:-1 gene:EMLSAG00000008083 transcript:EMLSAT00000008083 description:"maker-LSalAtl2s481-augustus-gene-1.18")

HSP 1 Score: 108.612 bits (270), Expect = 3.375e-24
Identity = 114/422 (27.01%), Postives = 181/422 (42.89%), Query Frame = 0
Query:  172 NKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSV-VGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRAN-YLASPLMVIAYAIAGRIDIN 591
            N E + FL   + A   +    PG+G++HQ+ LE  A          FP  + VGTD+HT    GLG L  GVG  DA  VM   P  L  P+V+G+++ G +S +++  D++L +   L   G  GA VE+FG  +  +S     TI NM  E GA    FP +     YL  + R  S I  +    + V +      +   ++  ++EIDL+ + P V+GP        I E+          K    G+ L    G                        I SCTN+S   +     ++ K+A+  G+         + PGS  + + ++  G+   +   G  ++   C       GP +     Q I +G      + S NRNF GR D +   + ++ SP M +A ++AG +D +
Sbjct:  730 NAEVYNFLS-TSGAKYGVGFWKPGSGIIHQIILENYA----------FPGLLMVGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGILTVKGGTGAIVEYFGEGVDSISCTGMGTICNMGAEIGATTSVFPYNHRMKAYLDSTNR--SDIANLADKYREVLL----SPDGGCKYDQVVEIDLNTLEPHVNGPFTPDLATPIGELGE--------KAKKNGWPLEVKDG-----------------------LIGSCTNSSYEDMARXTAII-KQALAKGMKSKS--NFYITPGSEQIRATIERDGLADTMREFGGVVLANAC-------GPCIGQWDRQNITKGEKNTI-VTSYNRNFTGRNDANPATHGFVTSPEMTVALSLAGSLDFD 1092          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|3123225|sp|P21399.3|ACOC_HUMAN (RecName: Full=Cytoplasmic aconitate hydratase; Short=Aconitase; AltName: Full=Citrate hydro-lyase; AltName: Full=Ferritin repressor protein; AltName: Full=Iron regulatory protein 1; Short=IRP1; AltName: Full=Iron-responsive element-binding protein 1; Short=IRE-BP 1)

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 456/905 (50.39%), Postives = 633/905 (69.94%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R   E    V K   E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I YL Q+GRD+  ++ ++KY++ V MFR  +D +++  F  ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   D   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YLQESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P+  DK F W+S STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  VM RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I +N+ P+  + V +    ++F+AV+R D D E   F  GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFL--VKKQDIENILHWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS--DKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTG-KTFQAVMRFDTDVELTYFLNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|122145596|sp|Q0VCU1.1|ACOC_BOVIN (RecName: Full=Cytoplasmic aconitate hydratase; Short=Aconitase; AltName: Full=Citrate hydro-lyase; AltName: Full=Iron-responsive element-binding protein 1; Short=IRE-BP 1)

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 456/905 (50.39%), Postives = 641/905 (70.83%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R       K+++ +  + WK +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERNKERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRDK  ++ +++Y++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++      H  F  N     FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GLSV   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+++V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P+  DK + W+  STYIK P + +++  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG+RA+LA S++  +RSNLV  G++PL+     +     L G E  +I I + + P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGSLPFSIRVLLEAAIRNCDQFLVKKNDVENILNWKVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPICPADLVIDHSIQVDFNR-------------------------------RADSLKKNQDLEFERNKERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYRLVGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDKEKVKHIKQYLQAVGMFRDFSDSSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN--NSKFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLSVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEAVVEAIVQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALAAPS--DKLYCWNPKSTYIKSPPFFEDLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIRAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIPETLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|341940613|sp|P28271.3|ACOC_MOUSE (RecName: Full=Cytoplasmic aconitate hydratase; Short=Aconitase; AltName: Full=Citrate hydro-lyase; AltName: Full=Iron regulatory protein 1; Short=IRP1; AltName: Full=Iron-responsive element-binding protein 1; Short=IRE-BP 1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 454/916 (49.56%), Postives = 636/916 (69.43%), Query Frame = 0
Query:   15 LLKDFQVGERSYKYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            L +     +   +++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERNKERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I YL Q+GR++  ++ ++KY++ V MFR  +D +++  F  ++E+DL  ++PC SGPKR +DKV+++E+  DF+S L  K+G KG+ ++  + +   +       FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GLSV   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG N+  G  +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   NK W++L+ P S   + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I+I +++ P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:    8 LAEPLDAAQPGKRFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDIENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNKERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIAYLLQTGREEDKVKHIQKYLQAVGMFRDFNDTSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSEMKKDFESCLGAKQGFKGFQVAPDRHNDRKTFLYSNSEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLSVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQ-GRQVFLKDIWPTRDEIQAVERQHVIPGMFKEVYQKIETVNKSWNALAAP-SEKLYAWNPKSTYIKSPPFFESLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTVHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGETADSLGLTGRERYTINIPEDLKPRMTVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|2492645|sp|Q63270.1|ACOC_RAT (RecName: Full=Cytoplasmic aconitate hydratase; Short=Aconitase; AltName: Full=Citrate hydro-lyase; AltName: Full=Iron regulatory protein 1; Short=IRP1; AltName: Full=Iron-responsive element-binding protein 1; Short=IRE-BP 1)

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 458/906 (50.55%), Postives = 635/906 (70.09%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QV +N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+D+++I YL Q+GR++  ++ +++Y++ V MFR  SD +++  F  ++E+DL  ++PC SGPKR +DKV+++EI  DF+S L  K+G KG+ ++      H  F  N D E FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   VKTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG N+  G+ +FLK+IWP+R EIQE+ERK VIPG++++VY K+   NK W++L+ P S   + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PR++NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++ T+ SNLV  G++PL+     +     L G E  +I I +++ P+  + + +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDIENILNWSIMQHKSIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVHFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGCYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDDVSIAYLVQTGREEDKVKHIKRYLQAVGMFRDFSDSSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSEIEKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN-DSE-FTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLNVKPYVKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQ-GQQVFLKDIWPTRDEIQEVERKYVIPGMFKEVYQKIETVNKSWNALAAP-SEKLYAWNPKSTYIKSPPFFESLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTVHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERTHCSNLVGMGVIPLEYLPGETADSLGLTGRERYTIHIPEHLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|2492644|sp|Q90875.1|ACOC_CHICK (RecName: Full=Cytoplasmic aconitate hydratase; Short=Aconitase; AltName: Full=Citrate hydro-lyase; AltName: Full=Iron-responsive element-binding protein 1; Short=IRE-BP 1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 452/903 (50.06%), Postives = 628/903 (69.55%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIG---SNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++++++   Y  LP+S+RVLLE A+R       K+ + +  + WK +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                +D+L+ NQ  EFERNKERF FLKW + AFKN+ +IPPG+G++HQVNLEYLARVV  Q G  +PDSVVGTD+HTTM++GLGVLGWGVG ++A+AVM G P+++  P VVG ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   +FP+D+I+I YL Q+GRDK  +   +KY++ V M R   + +++  F  ++E+DL  ++PC SGPKR +DKV+++++  DF++ L  K+G KG+ ++  + +     N +G  F + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   +KTSL+PGSGVVT YL+ESGVM YL  LGF++VGYGC TC  NSGP LPDS+V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG  S +G+ IFLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L  P+  DK + W+  STYIK P +   +       +  ++   LL  GD++T+DHISPAG+I R+SPAA YL+S GL PRE+NSYG+RRGN  VM RGTF+N+RL N  ++K GP T+H PS  T  +F+A+ERYK  G  L  + GK +G G+SRDWA +GPFLLGV+A+LA S++  +RSNLV  G++PLQ           L G E  +I I +N+ P+  I + +    ++F A++R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLSKLEDVRYARLPFSIRVLLEAAIRNCDEFLVKKQDVENILNWKVMQHKNVEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPICPADLVIDHSIQVDFNR-------------------------------RSDSLQKNQDLEFERNKERFEFLKWGSQAFKNMRIIPPGSGIIHQVNLEYLARVVMDQDGYYYPDSVVGTDSHTTMVDGLGVLGWGVGGIEAEAVMLGQPISMVLPEVVGYKLLGNPQPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAYFPVDDISIGYLVQTGRDKEKVLCTKKYLEAVGMLRDFKNSSQDPDFTQVVELDLHTVVPCCSGPKRPQDKVAVSDMKKDFETCLGAKQGFKGFQIAPDRHNSVIKFNFEGCDFELAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLTVKPYIKTSLSPGSGVVTYYLRESGVMSYLSQLGFDVVGYGCMTCIGNSGP-LPDSVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGI-SASGKKIFLKDIWPTRNEIQAVERQYVIPGMFKEVYQKIETVNEAWNALDAPS--DKLYTWNPKSTYIKSPPFFDGLTLALQTPKTIEDAYVLLNFGDSVTTDHISPAGNIARNSPAARYLTSRGLTPREFNSYGSRRGNDAVMARGTFANIRLVNKFIDKQGPQTIHFPSGETLDVFDAAERYKQAGHPLIVLAGKEYGAGSSRDWAAKGPFLLGVKAVLAESYERIHRSNLVGMGVIPLQYLPGEDARTLGLTGRERYTIIIPENLKPQMNIQIKLDTG-KTFHAIMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|266391|sp|Q01059.1|ACOC_RABIT (RecName: Full=Cytoplasmic aconitate hydratase; Short=Aconitase; AltName: Full=Citrate hydro-lyase; AltName: Full=Ferritin repressor protein; AltName: Full=Iron regulatory protein 1; Short=IRP1; AltName: Full=Iron-responsive element-binding protein 1; Short=IRE-BP 1)

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 458/907 (50.50%), Postives = 635/907 (70.01%), Query Frame = 0
Query:   27 KYYDVTQIQ--GYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS--QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ ++    Y  LP+S+RVLLE AVR   +    V K+  E IL                 RV+LQDFTGVP+++D AA+R++V K GG P+ ++ +CP DLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF+N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLGVLGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFG  + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRD+S ++ + KY++ V MFR  SD +++  F  ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++      H  F  N D E FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   VKTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FL++IWP+R+EIQ +ER+ VIPG++ +VY K+   N  W++L+ P+  DK + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+ +G  L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I +N+TP+  + V +    ++F+AV+R D D E    H GG++  ++ K
Sbjct:   20 KFFNLNKLDYSRYGRLPFSIRVLLEAAVRNCDKFL--VKKEDIENILNWNVTQHMNIEVPFKPARVILQDFTGVPSVVDFAAMRDAVKKLGGDPEKINPICPVDLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSKAFRNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGLGVAQLSIADRATIANMCPEYGATATFFPVDEVSIKYLVQTGRDESKVKQIRKYLQAVGMFRDYSDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYN-DSE-FTLSHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYVKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGTNAK-GQQVFLRDIWPTREEIQAVERQYVIPGMFTEVYQKIETVNASWNALAAPS--DKLYLWNPKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNRFLNKQAPQTIHLPSGETLDVFDAAERYQQEGHPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADSLGLTGRERYTIIIPENLTPRMHVQVKLDTG-KTFQAVIRFDTDVELTYLHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|60392492|sp|Q62751.2|IREB2_RAT (RecName: Full=Iron-responsive element-binding protein 2; Short=IRE-BP 2; AltName: Full=Iron regulatory protein 2; Short=IRP2)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 433/949 (45.63%), Postives = 617/949 (65.02%), Query Frame = 0
Query:   22 GERSYKYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERIL-----RRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDP-----------SP------KTPVLGDD---------------------------ICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIG---SNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            G    K+++V ++ G  Y+ LPYS+RVLLE AVR       K+ +    + WK     +       RV+LQDFTG+PA++D AA+RE+V   GG P  V   CP DL VDH +Q+D++  K  + + P+P           SP      K P  G                             +CPFH +     + +  NQ  EF RN+ER  F KW + AFKN+ VIPPGTG+ HQVNLE+L+RVV  +  +LFPDSV+GTD+H TM+NGLG+LGWGVG ++ +AVM G PVTL+ P VVG  + G  + + TS D+VL ITK LRQ GV G FVEFFG  + +LS+ DR TI+NMCPEYGA++ FFP+D +T+++L  +G DK+ +E++E+Y+K VK+FR+ + +    ++ +I+I+L+ I+  VSGPKR +D+V++ ++ +DF++ L+ K G KG+ ++  +     SV  DG  + + HG+V++AA+ SCTN  NPSVML AGLLAKKAVE GL V   ++TSL+PGSG+VT YL  SGV+PYL  LGFEIVGYGCSTC  N+ P L ++I+ A+KQG+LV CG+LSGN+NFEGRL   +RANYLASP +V+AYAIAG ++I+   EPLG +S TG+ I+L +IWPSR+E+ +IE + VI  +++ +  KV +GNK W+SL  P+SV  FPW   STYI+CP +  ++    + ++  +N   LL LGD++T+DHISPAGSI RSS AA+YL++ GL PRE+NSYGARRGN  VM RGTF+N++L N  + K  P T+H PS  T  +FEA+E Y+ +G+ L  + GK +G G SRDWA +GP+LLGV+A+LA S++  ++ +L+  GI PL+     +     L G E  S+   + + P   +++      + F  +   +ND E  ++  GG++  +  K
Sbjct:   19 GSSQKKFFNVPKLGGTKYDILPYSIRVLLEAAVRNCDGFLMKKEDVINILDWKTKQSNVEVPFFPARVVLQDFTGIPAMVDFAAMREAVKTLGGDPKKVHPACPTDLTVDHSLQIDFS--KCAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELSRNSGTFSSQIENTPVLCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSGAFKNVAVIPPGTGMAHQVNLEHLSRVVFEEADLLFPDSVIGTDSHITMVNGLGILGWGVGGIETEAVMLGLPVTLTLPEVVGCELTGSSNAFVTSIDIVLGITKHLRQVGVAGKFVEFFGSGVSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLRHLEHTGFDKTKLESMEEYLKAVKLFRNDENSSEPEYSQVIQINLNSIVASVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQVAAEKQSDTVSVRYDGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVETGLRVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSTCVGNTAP-LSEAILNAVKQGDLVTCGVLSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDS-TGKNIYLHDIWPSREEVHQIEEEHVILSMFKALKEKVEMGNKRWNSLDAPDSV-LFPWDVKSTYIRCPSFFDKLTKEPAASQPIENAHVLLYLGDSVTTDHISPAGSIARSSAAAKYLTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIPLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLEFLPGENADSLGLSGREVFSLSFPEELFPGITLNIKTSTG-KEFSVIAAFENDVEITLYKHGGLLNFVARK 961          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|341940838|sp|Q811J3.2|IREB2_MOUSE (RecName: Full=Iron-responsive element-binding protein 2; Short=IRE-BP 2; AltName: Full=Iron regulatory protein 2; Short=IRP2)

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 431/949 (45.42%), Postives = 615/949 (64.81%), Query Frame = 0
Query:   22 GERSYKYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERIL-----RRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDP-----------------SPKTPVLGDD---------------------------ICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIG---SNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            G    K+++V ++ G  Y+ LPYS+RVLLE AVR       K+ +    + WK     +       RV+LQDFTG+PA++D AA+RE+V   GG P  V   CP DL VDH +Q+D++  K  + + P+P                 S K P  G                             +CPFH +     + +  NQ  EF RN+ER  F KW + AFKN+ VIPPGTG+ HQVNLEYL+RVV  +  +LFPDSVVGTD+H TM+NGLG+LGWGVG ++ +AVM G PVTL+ P VVG  + G  + + TS D+VL ITK LRQ GV G FVEFFG  + +LS+ DR TI+NMCPEYGA++ FFP+D +T+++L  +G DK+ +E++EKY+K VK+FR+ + +    ++ +I+I+L+ I+  VSGPKR +D+V++ ++ +DF++ L+ K G KG+ ++  +     SV  DG  + + HG+V++AA+ SCTN  NPSVML AGLLAKKAVE GL V   ++TSL+PGSG+VT YL  SGV+PYL  LGF+IVGYGCSTC  N+ P L ++++ A+KQG+LV CG+LSGN++FEGRL   +RANYLASP +V+AYAIAG ++I+   EPLG +S TG+ I+L +IWPSR+E+ ++E + VI  +++ +  KV +GNK W+SL  P+SV  FPW   STYI+CP +  ++    + ++  +N   LL LGD++T+DHISPAGSI RSS AA+YL++ GL PRE+NSYGARRGN  VM RGTF+N++L N  + K  P T+H PS  T  +FEA+E Y+ +G+ L  + GK +G G SRDWA +GP+LLGV+A+LA S++  ++ +L+  GI PL+     +     L G E  S+   + + P   +++      + F  +    ND E  ++  GG++  +  K
Sbjct:   19 GNSQKKFFNVPKLGGTKYDILPYSIRVLLEAAVRNCDGFLMKKEDVMNILDWKTKQSNVEVPFFPARVVLQDFTGIPAMVDFAAMREAVKTLGGDPKKVHPACPTDLTVDHSLQIDFS--KCAIQNAPNPGGGDLQKAGKLSPLKVQSKKLPCRGQTTCRGSCDSGELSRNSGTFSSQIENTPVLCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSGAFKNVAVIPPGTGMAHQVNLEYLSRVVFEETDLLFPDSVVGTDSHITMVNGLGILGWGVGGIETEAVMLGLPVTLTLPEVVGCELTGSSNAFVTSIDIVLGITKHLRQVGVAGKFVEFFGSGVSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLRHLEHTGFDKTKLESMEKYLKAVKLFRNDENSSEPEYSQVIQINLNSIVASVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQVAAEKQSDTVSVRYDGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEIGLRVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFDIVGYGCSTCVGNTAP-LSEAVLNAVKQGDLVTCGVLSGNKHFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFQTEPLGTDS-TGKEIYLHDIWPSREEVHQMEEEHVILSMFKTLKEKVEMGNKRWNSLEAPDSV-LFPWDVKSTYIRCPSFFDKLTKEPAASQPIENAHVLLYLGDSVTTDHISPAGSIARSSAAAKYLTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIPLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLEFLPGENADSLGLSGREVFSLSFPEELFPGITLNIKTSTG-KEFSVIASFANDVEITLYKHGGLLNFVARK 961          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|254806047|sp|B3VKQ2.1|IREB2_PIG (RecName: Full=Iron-responsive element-binding protein 2; Short=IRE-BP 2)

HSP 1 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 429/945 (45.40%), Postives = 615/945 (65.08%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERIL-----RRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDP-----------SP------KTPVLGDD---------------------------ICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENE-NIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNA---RNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K+++V ++ G  Y+ LPYS+RVLLE AVR       K+ +    + WK     +       RVLLQDFTG+PA++D AA+RE+V   GG P  V   CP DL VDH +Q+D+N  K  + + P+P           SP      K P  G                             +CPFH +     + +  NQ  EF RN+ER  F KW +  FKN+ VIPPGTG+ HQVNLEYL+RVV  +  +LFPDSVVGTD+H TM+NGLG+LGWGVG ++ +AVM G PV+L+ P VVG  + G  + + TS D+VL ITK LRQ GV G FVEFFG  + +LS+ DR TI+NMCPEYGA++ FFP+D +T+++L  +G +K+ ++++E Y+K VK+FR+  +N     ++ +I+I+L+ I+P VSGPKR +D+V++ ++ +DF++ L+ K G KG+ ++  + +   S++ +G  + + HG+V++AA+ SCTN  NPSVML AGLLAKKAVE GL V   ++TSL+PGSG+VT YL  SGV+PYL  LGFEIVGYGCSTC  N+ P L ++++ A+KQG+LV CG+LSGN+NFEGRL   +RANYLASP +V+AYAIAG ++I+   EPLG +  TG+ I+L +IWPSR+E+ +IE + V+  +++ +  K+ +GNK W+SL  P+SV  FPW   STYI+CP +  ++       +  +N   LL LGD++T+DHISPAGSI RSS AA+YL++ GL PRE+NSYGARRGN  VM RGTF+N++L N  + K  P T+H PS  T  +FEA+E Y+ +G+ L  + GK +G G SRDWA +GP+LLGV+A+LA S++  ++ +L+  GI PLQ     +     L G E  S+   + ++P   +++      + F  +   +ND E  ++  GG++  +  K
Sbjct:   24 KFFNVPRLGGTKYDVLPYSIRVLLEAAVRNCDGFLMKKEDVMNILDWKTKQSNVEVPFFPGRVLLQDFTGIPAMVDFAAMREAVKTLGGDPKKVHPACPTDLTVDHSLQIDFN--KCAIQNAPNPGGGDLQKAGKLSPLRVQPKKLPCRGQTACRGSCDSGDLGRNSGKFSSQIENTPILCPFHLQPVPEPETVLKNQEVEFGRNRERLQFFKWSSRVFKNVAVIPPGTGMAHQVNLEYLSRVVFEEKDLLFPDSVVGTDSHITMVNGLGILGWGVGGIETEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQIGVAGKFVEFFGSGVSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEYTGFNKAKLKSMETYLKAVKLFRNDQDNSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEKQNDTVSIHYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLRVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEIVGYGCSTCVGNTAP-LSEAVLNAVKQGDLVTCGVLSGNKNFEGRLCDCVRANYLASPPLVVAYAIAGTVNIDFRTEPLGTDP-TGKNIYLHDIWPSREEVHQIEEEHVVLSMFKALKEKIEMGNKRWNSLEAPDSV-LFPWDLKSTYIRCPSFFDKLTKEPVALQPIENAHVLLYLGDSVTTDHISPAGSIARSSAAAKYLTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIPLIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADSLGLSGRETFSLTFPEELSPGVTLNIKTSTG-KIFSVIASFENDVEIILYKHGGLLNFVARK 962          
BLAST of EMLSAG00000007801 vs. SwissProt
Match: gi|82082649|sp|Q5ZLQ4.1|IREB2_CHICK (RecName: Full=Iron-responsive element-binding protein 2; Short=IRE-BP 2)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 427/940 (45.43%), Postives = 605/940 (64.36%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERI-----LRRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDP------------SP------KTPVLGDD---------------------------ICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSD-ENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWK---NMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVI 899
            ++Y+V+++ G  Y+ LPYS+RVL E ++R       K ++    + WK     +       RV+LQDFTG+PA++D AA+RE+V  +GG P  V+  CP DL VDH +Q+D++  K  + + P+P            SP      K P  G                             +CPFH +     + +  NQ  EF RN+ER  F KW +  FKN ++IPP TG+ HQVNLEYL+RVV      L+PDSVVGTD+HTTM+NGLG+LGWGVG ++ +AVM G PVTL+ P VVG  + G  S  +TS D+VL ITK LRQA V G FVEFFG  + +LSVADR TI+NMCPEYGA++ FFP+D +T+++L  +G D++ +E +E Y+K VK+FR+ +  +    ++ +++I LS IIP VSGPKR++D+V++N + +DF++ L+ K G KG+ ++  + +    V  +G  + + HG V++AA+ SCTN  NPSVML AGLLAKKAVE GL V   ++TSL+PGSG+VT YL  SGV+PYL  LGFE+VGYGCSTC  N+ P LP++I  AIKQG+++ CG+LSG +NFEGRL   +RANYLASP +V+AYAIAG + I+ + EPLG     G +I+L++IWP+R+E+  +E + VI  +++++  K+  GNK W+SL  P S   FPW   STYI+CP +  ++     + +   N   LL LGD++T+DHISPAGSI RSS AA+YL++ GL PRE+NSYGARRGN  VM RGTF+N++L N  + K  P T+H PS  T  +FEA+E Y+ +G+ +  + GK +G G+SRDWA +GPFLLGV+A+LA S++  ++S L+  GI PLQ     + +   L G E  SI     ++PK  +D+      + F      +ND E  ++  GG +
Sbjct:   24 RFYNVSKLGGTKYDVLPYSIRVLFESSIRNCDGFLVKETDAMNILDWKTKQNDVEVPFCPARVVLQDFTGIPAMVDFAAMREAVRNAGGDPVKVNPACPTDLTVDHSLQIDFS--KCAIQNAPNPGGGEAQKPTAKLSPLKGQPRKLPCRGQSSCKGPCSAGELSRASGQFSAQIENTPILCPFHLQPVPEPETVLKNQEMEFGRNRERLQFFKWSSKVFKNTSIIPPETGMAHQVNLEYLSRVVFDVEDFLYPDSVVGTDSHTTMVNGLGILGWGVGGIETEAVMLGMPVTLTLPEVVGCELTGTASPLATSIDIVLGITKHLRQAEVAGKFVEFFGSGVSQLSVADRTTIANMCPEYGAILSFFPVDNVTLKHLRHTGFDEAKLEVMEAYLKAVKLFRNGESSSREPEYSQVVQISLSSIIPHVSGPKRSQDRVAVNNMKSDFQTCLNEKAGVKGFQIAAEKQNDVVPVQYEGNQYELSHGCVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLEVKPYIRTSLSPGSGMVTHYLSSSGVLPYLSKLGFEVVGYGCSTCVGNTAP-LPEAIRNAIKQGDIIACGVLSGTKNFEGRLCDCVRANYLASPPLVVAYAIAGTVRIDFETEPLG-TGFNGRSIYLRDIWPTRKELHTVEEECVISSMFKELKEKMEKGNKRWNSLEAPES-PLFPWDLKSTYIRCPSFFDKLAKEPVSLQPIENAHVLLYLGDSVTTDHISPAGSIARSSAAAKYLTNKGLTPREFNSYGARRGNDAVMTRGTFANIKLLNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIPVIILAGKKYGLGSSRDWAAKGPFLLGVKAVLAESYEKVHKSQLIGIGIAPLQFLPGENPNTLGLTGREQFSILFPPELSPKMTLDIKTSTG-KVFSVFALFENDVEITLYKNGGSL 957          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: XP_392993.2 (PREDICTED: cytoplasmic aconitate hydratase-like [Apis mellifera])

HSP 1 Score: 899.812 bits (2324), Expect = 0.000e+0
Identity = 462/917 (50.38%), Postives = 629/917 (68.59%), Query Frame = 0
Query:   15 LLKDFQVGERSYKYYDVTQI-QGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQ-ITSISYES--LKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            L+K  ++G + YKY+D+T   + Y+ LPYS+RVLLE AVR     Q  V K   +R+L                   RV+LQDFTGVPA++D AA+R++V + G  PD ++ +CP+DLV+DH +QVD+ + K                               DA + N+  EFERNKERF+FLKW   AF+N+ ++PPG+G++HQVNLEYLARVV    G+L+PDSVVGTD+HTTMINGLGV+GWGVG ++A+AVM G  +++  P+VVG +++G +S Y+TSTDLVL ITK LRQ GV G FVEFFGP + +LS+ADRATISNMCPEYGA VGFFPID+ ++ YL Q+GR + HI  +EKY+  V M R+  DEN+N  F+ ++ +DL  ++  VSGPKR  D+VS+ ++  DFK+ L  K G KG+GLS  +         +G+ + + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL V   +KTSL+PGSGVVT YL+ESGV+PYL  LGF++VGYGC TC  NSGP LPD IV+ I++  LVCCG+LSGNRNFEGR+ P+ RANYLASPL+VIAYAIAG +DI+  +EPLG +   G  +FL++IWP+R EI+ +E+K VIP ++++VY K+  G+ +W +L  P+    +PW S STYIK P Y   I       K++   R LL LGD++T+DHISPAGSI R+SPAA YL++ GL P+E+NSYGARRGN  VM RGTF+N+RL N  + K GP T+++P++    +F+A+E Y  D   L  + GK +G G+SRDWA +GP+LLG+RA++A S++  +RSNLV  GI+PL+ +   + ES  L G E   I I +N  P   I V     +R F+ ++R D + +   F  GG++  ++ +
Sbjct:    9 LMKSIKIGLKEYKYFDITNFGKKYDRLPYSIRVLLESAVRNCDNFQ--VKKSDVDRLLNWEHNQTLEAGIEVAFKPARVILQDFTGVPAVVDFAAMRDAVKRLGADPDKINPICPSDLVIDHSIQVDFFRTK-------------------------------DAFKKNEEMEFERNKERFMFLKWGTKAFQNMLIVPPGSGIIHQVNLEYLARVVFDTNGILYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQAISMLLPKVVGYKLEGTLSQYATSTDLVLTITKNLRQIGVVGKFVEFFGPGVSQLSIADRATISNMCPEYGATVGFFPIDQQSLVYLRQTGRSEEHINKIEKYLTAVHMLRNYDDENQNPNFSEVVTLDLGTVVSSVSGPKRPHDRVSVVDMKIDFKNCLTNKVGFKGFGLSPEKVDTVGLFEYEGKDYKLRHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLYVHPYIKTSLSPGSGVVTYYLEESGVIPYLSKLGFDVVGYGCMTCIGNSGP-LPDIIVETIEKNGLVCCGVLSGNRNFEGRIHPNTRANYLASPLLVIAYAIAGTVDIDFQKEPLG-HRMDGTPVFLQDIWPTRAEIRVVEQKYVIPAMFKEVYDKIEKGSSNWANLVAPDG-KLYPWDSSSTYIKHPPYFDNIQKELPEIKSITKARVLLNLGDSVTTDHISPAGSIARNSPAARYLANRGLTPKEFNSYGARRGNDDVMARGTFANIRLMNKFIGKAGPRTIYIPTKEEMDVFDAAELYIKDQTPLIILVGKEYGSGSSRDWAAKGPYLLGIRAVIAESYERIHRSNLVGMGIIPLEYLPGQNAESLGLTGYEVYDISISENCQPGQKITVSTDNGKR-FEVILRFDTEVDLTYFKHGGILNYMIRQ 888          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: EFX65502.1 (putative aconitate hydratase 1 [Daphnia pulex])

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 461/932 (49.46%), Postives = 640/932 (68.67%), Query Frame = 0
Query:   10 MEDEDLLKDFQ-------VGERSYKYYDVTQI--QGYEELPYSLRVLLECAVRKRSETQG-QVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQA-GVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNA---RNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            ME+ D+   +        V +++Y Y+++  +  + Y++LP+S+R+LLE  VR      G  + K+  E+I                    RV+LQDFTGVPAL+D AA+R++V++ GG P  ++ +CPADLV+DH VQVD+                               S  +DAL  NQ  EFERNKERF FLKW   +FKN+ V+PPG+G++HQVNLEYLARVV  Q G+L+PDSVVGTD+HTTMINGLGV+GWGVG ++A+AVM G  +++  P+V+G RI G +S  +TSTD+VL +TK LRQ  GV G FVEFFGP + ELS+ADRATISNMCPEYGA VG+FP+DE TI YL Q+ R    +  VE YMK   MFR  ++  ++  F  I E+DLS ++P +SGPKR +D+++ ++   DF   L  K G KG+G+++ + + + S   +G  +T+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL V   +KTSL+PGSGVVT YL+ESGV+P L +LGF IVGYGC TC  NSGP LP+S+V+AI++ +LVCCG+LSGNRNFEGR+ P+ RANYLASPL+V+AYAIAG +DI+ + +PLG+ S   + +FL++I+P+R+EIQ +E++ VIP +++QVYS+++ G+  W+ L  P   D +PW+  STYIK P +  ++  +    ++ K    LL LGD++T+DHISPAGSI R+SPAA YL++ GL+PRE+NSYGARRGN  +M RGTF+N+RL N+L++K GP T+H+PS     IF+A+ERY+ D  +L  + GK +G G+SRDWA +GP+ LG+ A++A SF+  +RSNLV  GILPLQ           L G E  +I+I  +I P  L++V VG++  SF+  +R+D + E   F   G++  +V K
Sbjct:    1 MENRDMANPYNTVKCTLSVHDKAYSYFNLRSVDPEKYDKLPFSIRILLESGVRN---CDGFHITKEDVEKIYNWELHQKSEETIEVSFKPSRVILQDFTGVPALVDFAAMRDAVNQFGGNPLTINPICPADLVIDHSVQVDF-------------------------------SRRSDALEKNQDLEFERNKERFAFLKWGAQSFKNMIVVPPGSGIVHQVNLEYLARVVFDQDGLLYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQAISMVLPQVIGYRITGHLSQLATSTDVVLTVTKHLRQVVGVVGKFVEFFGPGVNELSIADRATISNMCPEYGATVGYFPVDEKTIAYLRQTNRSAEQVAYVESYMKAASMFRDFNNSAQDPVFTQIYELDLSTVVPSLSGPKRPQDRIAQSDFKLDFSQCLSSKVGFKGFGIAEEKLNASASFEYEGSTYTLRHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLEVAPYIKTSLSPGSGVVTYYLKESGVIPALEILGFNIVGYGCMTCIGNSGP-LPESVVEAIEKNDLVCCGILSGNRNFEGRIHPNTRANYLASPLLVVAYAIAGTVDIDFEIQPLGY-SPDNKPVFLRDIYPTRKEIQAVEQQFVIPAMFQQVYSRITKGSDSWNKLEAPQ-CDLYPWNESSTYIKKPPFFDDMTKDIPSIQSIKEAHALLFLGDSVTTDHISPAGSIARNSPAARYLAARGLSPREFNSYGARRGNDEIMARGTFANIRLINNLVSKPGPRTIHIPSGEEMDIFDAAERYRKDKCNLIVLAGKEYGTGSSRDWAAKGPWKLGITAVIAESFERIHRSNLVGMGILPLQFLEGQQAKSLGLTGREKFTINIHADIKPGQLVEVQVGESG-SFQTQLRIDTEVELAYFINRGILNYMVRK 894          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: EEB16996.1 (aconitase, putative [Pediculus humanus corporis])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 458/923 (49.62%), Postives = 628/923 (68.04%), Query Frame = 0
Query:   13 EDLLKDFQVGERSYKYYDVTQI-QGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMING-LGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGS---NARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQ-ITSISYESLK--GTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKD 908
            ++    F +    YKY+D+      Y+ LPYS+RVLLE AVR     Q  V ++  + IL+                  RV+LQDFTGVPA++D AA+R++V   GG PD ++ +CP+DLV+DH VQVD+ +                                +DAL+ N+  EFERNKERF FLKW   AF+N+ ++PPG+G++HQVNLE+LAR+V     +L+PDSVVGTD+HTTMING LGV+GWGVG ++A+AVM G  +++  P VVG +I G +  Y TSTDLVL ITK LRQ GV G FVEFFGP +  LS+ADRATISNMCPEYGA VGFFP+D+ ++ YL ++ R  S I+ +E Y+KT KM R  +D  ++  ++ +IE+DL  ++  VSGPKR  D+VS++E+  DF + L  K G KG+GL+  Q     S N +G+ + + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+    +KTSL+PGSGVVT YL+ESGV+PYL  LGF +VGYGC TC  NSGP LP S+V+AI++ +LVCCG+LSGNRNFEGR+ P+ RANYLASPL+VIAY IAGR+DI+ + EPLG  +  G+ I+L++IWP+R EIQE+E+K VIP ++ +VY K+  G+  W S+  P S   +PW+  STYIK P +   +       ++ KN R LL LGD++T+DHISPAGSI R+SPAA +L+S GL PR++NSYG+RRGN  VM RGTF+N+RL N  +N+ GP T+H+P+     +F+A+ERYK +   L  + GK++G G+SRDWA +GP+LLG++A++A +++  +RSNLV  GI+PLQ +     E LK  G E  +IDI D++ P   I V +    RSF   +R+D + E   +  GG++  ++ K  D
Sbjct:    8 KNYFNSFLLDGIEYKYFDLCAFGDAYQRLPYSIRVLLESAVRNCDNFQ--VTENDVKNILQWETNQKVPGGVEVAFKPARVILQDFTGVPAVVDFAAMRDAVKLLGGDPDKINPICPSDLVIDHSVQVDFVKT-------------------------------SDALQKNEDLEFERNKERFTFLKWGAKAFRNMLIVPPGSGIVHQVNLEHLARLVFNVDNLLYPDSVVGTDSHTTMINGRLGVVGWGVGGIEAEAVMLGQSISMLLPEVVGYKITGTLGPYVTSTDLVLTITKHLRQLGVVGKFVEFFGPGVSALSIADRATISNMCPEYGATVGFFPVDQESLDYLKKTNRPVSKIKVMEHYLKTTKMLRDYADSTQDPVYSQVIELDLGTVVSSVSGPKRPHDRVSVSEMKTDFLNCLTNKVGFKGFGLNAEQTKAMCSFNYEGKDYILKHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVQAGLTTLPYIKTSLSPGSGVVTYYLKESGVVPYLEQLGFSVVGYGCMTCIGNSGP-LPPSVVEAIEKADLVCCGVLSGNRNFEGRIHPNTRANYLASPLLVIAYTIAGRVDIDFETEPLGM-TPDGKEIYLRDIWPTRAEIQEVEKKHVIPVMFEEVYGKIQNGSLSWQSIQAPPS-KLYPWNETSTYIKKPPFFDGMTRALPGVKSVKNARVLLNLGDSVTTDHISPAGSIARNSPAARFLASKGLMPRDFNSYGSRRGNDAVMARGTFANIRLVNKFMNQPGPKTIHIPTGEEMDVFDAAERYKMENTPLIILAGKDYGSGSSRDWAAKGPYLLGIKAVIAETYERIHRSNLVGMGIIPLQYLEGQDAEKLKLTGKETYTIDIPDDVKPLQKITVNLNDG-RSFDTRLRLDTEVELTYYKNGGILNYMIRKMLD 893          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: EAA04062.5 (AGAP007258-PA [Anopheles gambiae str. PEST])

HSP 1 Score: 857.44 bits (2214), Expect = 0.000e+0
Identity = 454/931 (48.76%), Postives = 615/931 (66.06%), Query Frame = 0
Query:   13 EDLLKDFQVGERSYKYYDVTQIQGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR---------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGG------VLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVN-IDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNAR---NWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQ-ITSISYES--LKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKD 908
            + LLK+  V   ++ Y+D+     Y ELPYS+RVLLE AVR     Q  + KDV   ILR                     RV+LQDFTGVPA++D AA+R++V K GG PD ++ +CP+DLV+DH VQVD+ + +                               DAL  NQ  EFERNKERF FLKW   AF N+ +IPPG+G++HQVNLEYLARVV           +L+PDSVVGTD+HTTMINGLGV+GWGVG ++A+AVM G  +++  P V+G ++ G ++   TSTDLVL ITK LRQ GV G FVEFFGP + ELS+ADRATISNMCPEYGA VG+FP+D+  + YL Q+ R +  +  +E Y+K     R   +  ++  F  I+E+DL+ ++  VSGPKR  D+V+++E+  DF+  L  K G KG+ + + +     S +  DG+ + + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL V   +KTSL+PGSGVVT YL+ESGV+P L  LGF +VGYGC TC  NSGP L D++   I++ NLVCCG+LSGNRNFEGR+ P+ RANYLASPL+VIAYA+AG +DI+ +++PLG     G A+FL++IWP+R EIQ +E+K VIP ++R VY KV +G+  W  L+ P     +PW + STYIK P +   +  +     N  N R LL LGD++T+DHISPAGSI R+SPAA +LS  GL PR++NSYG+RRGN  +M RGTF+N+RL N L+ + GP TLH+PS     +F+ ++RY  +G  L A+ GK++G G+SRDWA +GP+LLG++A++A S++  +RSNLV  GI+PLQ +   + ES  L G E  SI I ++  P   I V      + F+ +VR D + + + F  GG++  ++ K  D
Sbjct:    8 QSLLKEINVNGETFHYFDIASFPEYRELPYSVRVLLESAVRNCDNFQ-VLEKDV-RGILRWKQLKGTPTSDDELEIPFKPARVILQDFTGVPAVVDFAAMRDAVLKLGGDPDRINPICPSDLVIDHSVQVDFARSE-------------------------------DALAKNQDLEFERNKERFTFLKWGAKAFNNMLIIPPGSGIVHQVNLEYLARVVFQDAAKDGAARMLYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQAISMLLPEVIGYKLVGKLNPLVTSTDLVLTITKHLRQIGVVGKFVEFFGPGVSELSIADRATISNMCPEYGATVGYFPVDKNALDYLRQTNRAEEKVRVIEAYLKATDQLRDFGNAEQDPVFTQIVELDLASVVTSVSGPKRPHDRVAVSEMQQDFRQCLVSKVGFKGFAVPEAEMSAEGSFSWTDGKTYALRHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLKVAPYIKTSLSPGSGVVTYYLKESGVIPALEELGFNVVGYGCMTCIGNSGP-LDDNVANTIEKNNLVCCGVLSGNRNFEGRIHPNTRANYLASPLLVIAYALAGTVDIDFEKQPLG-TRPDGSAVFLRDIWPTRAEIQTVEQKHVIPAMFRDVYEKVELGSDSWQGLNAPTG-KLYPWDTQSTYIKRPPFFDGMTRDLPKIGNIVNARALLNLGDSVTTDHISPAGSIARNSPAARFLSDRGLTPRDFNSYGSRRGNDDIMARGTFANIRLVNKLVPRPGPRTLHIPSGEEMDVFDCAQRYAGEGTPLIALVGKDYGSGSSRDWAAKGPYLLGIKAVIAESYERIHRSNLVGMGIVPLQYLAGQNAESLGLTGQELFSIAIPESCKPHERIPVST-DCGKQFEVIVRFDTEVDLEYFRNGGILNYMIRKMID 901          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: AAF54529.1 (iron regulatory protein 1B [Drosophila melanogaster])

HSP 1 Score: 857.44 bits (2214), Expect = 0.000e+0
Identity = 457/924 (49.46%), Postives = 633/924 (68.51%), Query Frame = 0
Query:   17 KDFQVGERSYKYYDVTQIQG-YEELPYSLRVLLECAVRKRSETQGQVWKDVYERIL-------------------RRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVV-----TCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS-QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSN---ARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDN-ITPKCLIDVVVGKAERS-FKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K F     +YKY+D+  I   Y++LPYS+RVLLE AVR   +    + KDV + IL                    RV+LQDFTGVPA++D AA+R++V   GG P+ ++ +CPADLV+DH VQVD+               + P                 DAL  NQ+ EFERNKERF FLKW   AF N+ ++PPG+G++HQVNLEYLARVV     T    +L+PDSVVGTD+HTTMINGLGVLGWGVG ++A+AVM G  +++  P V+G +++G +S   TSTDLVL ITK LRQ GV G FVEF+GP + ELS+ADRATISNMCPEYGA VG+FPIDE T+ Y+ Q+ R +  I+ + +Y+K  +  R+ +D  ++ +F   I +DLS ++  VSGPKR  D+VS++++  DFKS L    G KG+ ++ + Q         DG+ + + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GLS+   +KTSL+PGSGVVT YL+ESGV+PYL  LGF+IVGYGC TC  NSGP L +++V  I++  LVC G+LSGNRNFEGR+ P+ RANYLASPL+VIAYAIAGR+DI+ ++EPLG +++ G+ +FL++IWP+R EIQE+E K VIP ++++VYSK+ +G++ W +L V      F WS+DSTYIK P + + +  +    ++ +  RCLL LGD++T+DHISPAGSI R+SPAA +LS   + PR++NSYG+RRGN  +M RGTF+N+RL N L+ K GP T+H+PS+    IF+A+ERY+ +G  L  + GK++G G+SRDWA +GPFLLGV+A++A S++  +RSNLV  GI+PLQ     S    +L G E  +I + ++ + P   I V   +A+ + F+ ++R D + +   +  GG++  ++ K
Sbjct:   12 KTFSQAGTTYKYFDLASIDSKYDQLPYSIRVLLESAVRN-CDNFHILEKDV-QSILGWSPALKQGSNDVEVSFKPARVILQDFTGVPAVVDFAAMRDAVLDLGGDPEKINPICPADLVIDHSVQVDF--------------ARAP-----------------DALAKNQSLEFERNKERFTFLKWGAKAFNNMLIVPPGSGIVHQVNLEYLARVVFENDATDGSKILYPDSVVGTDSHTTMINGLGVLGWGVGGIEAEAVMLGQSISMLLPEVIGYKLEGKLSPLVTSTDLVLTITKHLRQLGVVGKFVEFYGPGVAELSIADRATISNMCPEYGATVGYFPIDENTLGYMKQTNRSEKKIDIIRQYLKATQQLRNYADAAQDPKFTQSITLDLSTVVTSVSGPKRPHDRVSVSDMPEDFKSCLSSPVGFKGFAIAPEAQSAFGEFQWDDGKTYKLHHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEKGLSILPYIKTSLSPGSGVVTYYLKESGVIPYLEKLGFDIVGYGCMTCIGNSGP-LEENVVNTIEKNGLVCAGVLSGNRNFEGRIHPNTRANYLASPLLVIAYAIAGRVDIDFEKEPLGVDAN-GKNVFLQDIWPTRSEIQEVENKHVIPAMFQEVYSKIELGSQDWQTLQVSEG-KLFSWSADSTYIKRPPFFEGMTRDLPKLQSIQKARCLLFLGDSVTTDHISPAGSIARTSPAARFLSERNITPRDFNSYGSRRGNDAIMSRGTFANIRLVNKLVEKTGPRTVHIPSQEELDIFDAAERYREEGTPLVLVVGKDYGSGSSRDWAAKGPFLLGVKAVIAESYERIHRSNLVGMGIIPLQFLPGQSAETLNLTGREVYNIALPESGLKPGQKIQV---EADGTVFETILRFDTEVDITYYKNGGILNYMIRK 896          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: AAF56051.1 (iron regulatory protein 1A [Drosophila melanogaster])

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 457/921 (49.62%), Postives = 620/921 (67.32%), Query Frame = 0
Query:   26 YKYYDVTQIQG-YEELPYSLRVLLECAVRKRSETQGQVWKDVYERIL-------------------RRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVV-----TCQGG-VLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLS----QGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRD-NITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKD 908
            YKY+D+  I   YE LP+S+RVLLE AVR   +    + KDV + IL                    RV+LQDFTGVPA++D AA+R++V + GG P+ ++ +CPADLV+DH VQVD+ +                                +DAL  N++ EF+RNKERF FLKW   AF N+ ++PPG+G++HQVNLEYLARVV     +  G  +L+PDSVVGTD+HTTMINGLGVLGWGVG ++A+AVM G  +++  P V+G R++G +   +TSTDLVL ITK LRQ GV G FVEF+GP + ELS+ADRATISNMCPEYGA VG+FPIDE T+ Y+ Q+ R +  I+ + KY+K  +  R  S  +++ ++   + +DLS ++  VSGPKR  D+VS++ +  DFKS L    G KG+ +        G   +    DG+ + +GHG+V++AAI+SCTNTSNPSVMLGAGLLAK AV+ GLS+   +KTSL+PGSGVVT YL+ESGV+PYL  LGF+IVGYGC TC  NSGP L +++V  I++  LVCCG+LSGNRNFEGR+ P+ RANYLASPL+VIAYAIAGR+DI+ + EPLG +S+ G+ +FL++IWP+R EIQE+E K VIP ++++VYSK+ +G++ W +L V +S   +PWS  STYIK P + + +       K +   RCLL LGD++T+DHISPAGSI R SPAA YLS  GL PR++NSYG+RRGN  VM RGTF+N+RL N L +K GP TLH+PS     IF+A+ERY ++G  L  + GK++G G+SRDWA +GPFLLG++A++A S++  +RSNLV  GI+PLQ     S     L G E  +I + +  + P   I   V      F+  +R D + +   +  GG++  ++ K  D
Sbjct:   23 YKYFDLPSIDSKYESLPFSIRVLLESAVRN-CDNFHVLEKDV-QSILGWTPSLKQETSDVEVSFKPARVILQDFTGVPAVVDFAAMRDAVRELGGNPEKINPICPADLVIDHSVQVDFVR-------------------------------SSDALTKNESLEFQRNKERFTFLKWGARAFDNMLIVPPGSGIVHQVNLEYLARVVFESDSSADGSKILYPDSVVGTDSHTTMINGLGVLGWGVGGIEAEAVMLGQSISMLLPEVIGYRLEGKLGPLATSTDLVLTITKHLRQLGVVGKFVEFYGPGVAELSIADRATISNMCPEYGATVGYFPIDENTLSYMRQTNRSEKKIDIIRKYLKATRQLRDYSLVDQDPQYTESVTLDLSTVVTSVSGPKRPHDRVSVSSMCEDFKSCLISPVGFKGFAIPPSALAASGEFQWD---DGKSYKIGHGSVVIAAITSCTNTSNPSVMLGAGLLAKNAVQKGLSILPYIKTSLSPGSGVVTYYLRESGVIPYLEQLGFDIVGYGCMTCIGNSGP-LDENVVNTIEKNGLVCCGVLSGNRNFEGRIHPNTRANYLASPLLVIAYAIAGRVDIDFEIEPLGVDSN-GKEVFLRDIWPTRSEIQEVEHKHVIPAMFQEVYSKIQLGSRDWQTLEVSDS-KLYPWSEISTYIKLPPFFEGMTRALPKLKGIEKARCLLLLGDSVTTDHISPAGSIARKSPAARYLSERGLTPRDFNSYGSRRGNDAVMARGTFANIRLVNKLASKTGPSTLHVPSGEEMDIFDAAERYASEGTPLVLVVGKDYGSGSSRDWAAKGPFLLGIKAVIAESYERIHRSNLVGMGIIPLQFLPGQSADTLKLSGREVYNIVLPEGELKPGQRIQ--VDADGNVFETTLRFDTEVDITYYKNGGILNYMIRKMLD 902          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: gb|EFA02996.1| (Cytoplasmic aconitate hydratase-like Protein [Tribolium castaneum])

HSP 1 Score: 844.343 bits (2180), Expect = 0.000e+0
Identity = 445/922 (48.26%), Postives = 612/922 (66.38%), Query Frame = 0
Query:   13 EDLLKDFQVGERSYKYYDVTQIQG-YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTC--QGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFR--SSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSN---ARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            +  LK   V  + YKYYD++ +   Y+ LPYS+RVLLE AVR     Q  V ++  + IL                   RV+LQDFTGVPA++D AA+R++V   GG P+ ++  CPADLV+DH VQVD+ +           SP                     AL+ N+  EFERN+ERF FLKW   AF N+ ++PPG+G++HQVNLEYLARVV       +L+PD+VVGTD+HTTMINGLGVLGWGVG ++A+AVM G  +++  P+VVG R+ G +  Y TSTDLVL ITK LRQ GV G FVEF+GP +  LS+ADRATI+NMCPEYGA VG+FP+DE ++ YL Q+ R    I+ +E Y+K  K  R  +++ NE I F+  + +DLS ++  VSGPKR  D+VS++++  DF+  L  K G KG+G+ + + +       +G  +T+ HG+V++AAI+SCTNTSNPSVMLGAGLLAK AV  GL+V   +KTSL+PGSGVVT YLQES V+  L  LGF+IVGYGC TC  NSG  + ++IV AI+Q +LVCCG+LSGNRNFEGR+ P+ RANYLASPL+VIAYAIAG +DI+ ++EPLG     G  +FL+ IWP+R+EI  +E++ VIP +++QVYS++ +G+  W SL+ P+ +  +PWS  STYIK P +   +       +     R LL LGD++T+DHISPAGSI R+SPAA YL+  GL PRE+NSYG+RRGN  +M RGTF+N+RL N  ++  GP T++LP+     +F+ +ERYK+    L  + GK++G G+SRDWA +GP+LLGVRA++A SF+  +RSNLV  GI+PLQ     +     L G E  +I+I  ++ P   I +      ++F  V+R D + +   +  GG++  ++ K
Sbjct:    7 DKYLKTLTVESKEYKYYDLSALGAQYDRLPYSIRVLLESAVRNCDNFQ--VKENDVQNILNWEQNQSVEGGIEIPFKPARVILQDFTGVPAVVDFAAMRDAVKGLGGNPEKINPSCPADLVIDHSVQVDFAR-----------SPS--------------------ALKKNEDLEFERNQERFTFLKWGAKAFNNMLIVPPGSGIVHQVNLEYLARVVFTGKDKPILYPDTVVGTDSHTTMINGLGVLGWGVGGIEAEAVMLGQSISMLLPKVVGYRLHGTLGQYVTSTDLVLTITKNLRQLGVVGKFVEFYGPGVAALSIADRATIANMCPEYGATVGYFPVDEHSLTYLRQTSRPDEQIKLIEAYLKATKQLRNYANEMNEPI-FSQSVSLDLSTVVSSVSGPKRPNDRVSVSDMKNDFRLCLSNKIGFKGFGIPEAKLNTEAKFMYNGSQYTIRHGSVIIAAITSCTNTSNPSVMLGAGLLAKNAVAAGLTVAPYIKTSLSPGSGVVTYYLQESKVIDALTQLGFDIVGYGCMTCIGNSG-GIDENIVNAIEQNDLVCCGVLSGNRNFEGRIHPNTRANYLASPLLVIAYAIAGTVDIDFEKEPLG-KRPDGSPVFLREIWPTRKEIHAVEQQYVIPAMFQQVYSRIQLGSSSWQSLNAPSGI-LYPWSDSSTYIKKPPFFDGMTKQLPPMQPISGARVLLYLGDSVTTDHISPAGSIGRNSPAARYLAQNGLTPREFNSYGSRRGNDAIMARGTFANIRLVNKFMSNAGPKTVYLPTNEEMDVFDCAERYKSAKTPLIILAGKDYGSGSSRDWAAKGPYLLGVRAVIAESFERIHRSNLVGMGIIPLQFLPNETAETLGLTGKEIYNIEIPADLKPGQNIKIST-DTSKTFNVVLRFDTEVDLLFYKHGGILNYMIRK 890          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: gb|KFM82338.1| (hypothetical protein X975_14216, partial [Stegodyphus mimosarum])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 421/789 (53.36%), Postives = 571/789 (72.37%), Query Frame = 0
Query:  125 QIKQQLSSP-PDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIG---SNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQ-ITSISYES--LKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
             I ++L +P   P P  P L    CP H+  S  +DAL  N   EFERNKERF FLKW + AFKN+T++PPG+G+ HQVNLEYLARVV    G+L+PDS+VG D+HTTMINGLG++GWGVG ++A+AVM G  +++  P+VVG ++ G ++   TSTD+VL ITK LRQ GV G FVEFFGP + ELS+ADRATISNMCPEYGA VGFFP+D+ ++ YL Q+GR++ H++ V+ Y++ V M+R  ++ +++  F+ ++E+DL+ ++  VSGPKR  D+V + E+  DF+S L  K G KG+GL   +      +  + + + + HG+V++AAI+SCTNTSNPSVMLGAG+LAKKAVE GLSV   +KTS++PGSGVVT YLQESGV+ YL  LGF IVGYGC TC  NSGP LP+S+VQAI  G LV CG+LSGNRNFEGR+ P  RANYLASPL+V+AYA+AGR+DI+ + EP+G     G+ ++L++IWPSR EIQE+E K V+P ++++VYSK+  GNK W+SL VP + + +PW   STYIK P + K++       R+ KN R LL LGD++T+DHISPAGSI+R+SPAA YL+S GL PRE+NSYGARRGN  VM RGTF+N+RL+N  L+K  P T+H+ S+    +F+A+E+Y N+G  L  + GK++G G+SRDWA +GP+LLGVRA++A SF+  +RSNLV  G++PLQ +   + ES  L G E  +I I D I P     V V    R+F+ ++R D + E   F  GG++  +V +
Sbjct:  222 HIIKELPNPIVSPHPNFP-LQYGTCPMHKARSIGSDALEKNLDLEFERNKERFAFLKWGSKAFKNMTIVPPGSGICHQVNLEYLARVVFNNNGLLYPDSLVGADSHTTMINGLGIVGWGVGGIEAEAVMLGQAISMVLPQVVGYKLVGKVNPMVTSTDVVLTITKHLRQVGVVGKFVEFFGPGVAELSIADRATISNMCPEYGATVGFFPVDDKSLLYLKQTGREEKHLKYVKSYLEAVHMYRDYNNPDQDPVFSEVVELDLASVVSSVSGPKRPHDRVPVQEMKKDFQSCLVNKVGFKGFGLDPEKLSTTVPLIYNEKEYLLRHGSVVIAAITSCTNTSNPSVMLGAGILAKKAVEKGLSVLPYIKTSMSPGSGVVTYYLQESGVIKYLEKLGFLIVGYGCMTCIGNSGP-LPESVVQAIDMGELVACGVLSGNRNFEGRIHPHTRANYLASPLLVVAYALAGRVDIDFENEPIG-KGQDGQDVYLRDIWPSRDEIQEVEAKHVLPAMFKEVYSKIEHGNKRWNSLHVPET-NIYPWDQKSTYIKPPPFFKDMTLELPQIRSIKNARVLLYLGDSVTTDHISPAGSISRNSPAARYLASHGLTPREFNSYGARRGNDEVMARGTFANIRLRNKFLDKAAPKTIHIGSKTEMDVFDAAEKYHNEGRQLIILAGKDYGCGSSRDWAAKGPYLLGVRAVIAESFERIHRSNLVGMGLIPLQYLPGQNAESLGLTGYEQYTISIPDTIMPGQKTTVQVDDG-RAFEVIIRFDTEVELTYFRHGGILQYMVRQ 1005          

HSP 2 Score: 100.138 bits (248), Expect = 1.540e-20
Identity = 59/140 (42.14%), Postives = 85/140 (60.71%), Query Frame = 0
Query:   15 LLKDFQVGERSYKYYDVTQIQG--YEELPYSLRVLLECAVR-----KRSETQ-GQV--WKDVYERI--------LRRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDP 136
            LLK  ++   SYKYYD+  +    Y++LP+S+RVLLE +VR     +  ET  G +  W++   +           RV+LQDFTG+P + D AA+R+ V K GG PD V+ LCPA+LV+DH VQVD+++    L   P+P
Sbjct:   11 LLKTIEIDGASYKYYDLIGLNDPRYDKLPFSIRVLLEASVRCCDNFQVKETDIGNILDWENFQNKEGGIEVAFNPARVILQDFTGIPCVADFAAMRDVVQKLGGDPDKVNPLCPANLVIDHSVQVDFSE--STLRDSPNP 148          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: gb|EEC16473.1| (RNA-binding translational regulator IRP, putative, partial [Ixodes scapularis])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 430/917 (46.89%), Postives = 573/917 (62.49%), Query Frame = 0
Query:   14 DLLKDFQVGERSYKYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERIL----------------RRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASI-IEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNAR---NWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            D L+   V     +Y+ + ++    Y  LP+S+RVLLE AVR     Q +  KDV ER+L                 RVLLQDFT    +I  A I ++V + GG P  ++ LCP+DLVVDH VQVD+++                                ADAL  NQ  EFERN+ERF FLKW + A  N+ ++PPG+G++HQVNLE+L +VV C+ G+L+PDS+VG D+HTTMINGLGVLGWGVG ++A+AVM G   ++  P VVG R+ G +   +TSTDLVL ITK LRQ GV G FVEF GP + +LS+ADRAT+SNMCPEYGA VGFFP+D  T++Y+ Q+G     ++     +    +         + F++  +  D+++   C    +R       N +  +   ALH  +   G  +S    HV              HG V      +C        + GAGLLAKKAVE GLSV   +KTSL+PGSGVVT YL+E+GV+PYL  LGF IVGYGC TC  NSGP LP+ + +AI++G+LV  G+LSGNRNFEGR+ P  RANYLASPL+V+AYAIAG +DI+L  +PLG +S  G A+FL++IWPSR+EIQE+E K V+P ++R+VYSKV  G+K+W SLS P S+  +PW S STYIKCP + + +    R   + K  R LL LGD++T+DHISPAGSI R+SPAA YL++  L PRE+NSYGARRGN  VM RGTF+N+RL N  L+K GP TLHLPS     IF+A+ERY+ +GV L  + GK +G G+SRDWA +GPFLLGVR +LA S++  +RSNLV  GI+PLQ     S     L G E  S+ +  ++ P   + V +    RSF+A++R D   E   F  GG++  ++ +
Sbjct:   11 DKLRTLVVDGEECRYFSLPELGDPRYGRLPFSIRVLLESAVRNCDGFQVE-QKDV-ERLLDWQQQQREGVEVAFKPARVLLQDFTQQMRIIFDACIEDAVHRLGGDPRKINPLCPSDLVVDHSVQVDFSRT-------------------------------ADALERNQDLEFERNRERFQFLKWGSQALHNMRIVPPGSGIVHQVNLEFLGQVVFCRDGLLYPDSLVGADSHTTMINGLGVLGWGVGGIEAEAVMLGQATSMLLPEVVGYRLSGTLPPMATSTDLVLTITKHLRQVGVVGKFVEFLGPGVAQLSIADRATVSNMCPEYGATVGFFPVDAKTLEYMRQTGGWSCPLDWCNTGLHRHLL-------HPLSFSTTPLHSDVTNFFFCF---RR-------NALRIEMYYALHQHD--IGRRMSSVNSHVRC------------HGHVAQRTSVTC--------VAGAGLLAKKAVERGLSVAPHIKTSLSPGSGVVTYYLREAGVVPYLEQLGFHIVGYGCMTCIGNSGP-LPEPVAEAIEKGDLVAVGVLSGNRNFEGRVHPHTRANYLASPLLVVAYAIAGTVDIDLHSQPLGQDSQ-GNAVFLRDIWPSREEIQEVEGKHVLPSMFREVYSKVEHGSKNWQSLSAPESL-LYPWDSSSTYIKCPPFFETMEREPRPPEDIKGARVLLLLGDSVTTDHISPAGSIARNSPAARYLAARWLTPREFNSYGARRGNDDVMSRGTFANIRLVNKFLDKPGPRTLHLPSGEEMDIFDAAERYRQEGVPLVILAGKEYGSGSSRDWAAKGPFLLGVRVVLAESYERIHRSNLVGMGIVPLQYLPGQSAHSLGLTGRETFSVAVGGHLEPGQTVPVQLDDG-RSFQALLRFDTAVELAYFRHGGILPYVLRQ 851          
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Match: gb|EEC02132.1| (aconitase/homoaconitase, putative, partial [Ixodes scapularis])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 314/718 (43.73%), Postives = 439/718 (61.14%), Query Frame = 0
Query:  159 DALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKV-GPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSISYE---SLKGTECLS-IDIRDNITP----KCLI 867
            D+   N   E +RN ER+ FLKW   AF N  V+PPGTG+ HQVNLEYLA+VV  + G+ +PDS+VGTD+HTTM+NGL VLGWGVG ++A+A M G P+T+  P V+G+++ G +   +T+TDLVL +T+ LR+  V G FVEFFG  LK L++ADRATISNM PEYGA  GFFPID+ TI+YL  +GR+K+ I+ VEKY     ++   D      +  ++E+DLS +   ++GPKR +D+V++N++A +                               + + +G+G V++AAI+SCTNTSNPSVM+GA LLAKKA+E GL V   VKTSLAPGS VVT YL   G+  YL  LGF +VGYGC+TC  NSGP  P+ I + I +  LV   +LSGNRNFEGR++P  +A+YL SP++V+AYA++G ++I+L   P+      GE I+LK+IWPS++EI E+    +   ++ + YS +  G K W  L V  S + + W  +                  N K+ + L   GD+IT+DHISPAGSI                            N+ VM+RGTF+N+R++N +   V G +T++  S    TI++A+  YK   V +    GK +G G+SRDWA +GP LLGV+A++A SF+  +RSNLV  GILPL  T  +      L G+E +  I + +NI P    KC+I
Sbjct:    3 DSFDKNVQMEMKRNIERYAFLKWGQQAFNNFKVVPPGTGICHQVNLEYLAKVVWHKDGLAYPDSLVGTDSHTTMVNGLSVLGWGVGGIEAEAAMLGQPLTMILPEVIGVKLTGKLIGIATATDLVLTVTEMLRKKRVVGKFVEFFGEGLKNLTIADRATISNMSPEYGATCGFFPIDQETIKYLELTGREKTQIKLVEKYATEQNLWY--DFEHEAEYTEVLELDLSTVHSSLAGPKRPQDRVNLNDVATN-------------------------------QNYEIGNGDVVIAAITSCTNTSNPSVMIGAALLAKKALEYGLKVKPWVKTSLAPGSKVVTEYLNLRGLDKYLDELGFNLVGYGCTTCIGNSGPLNPE-IEETINKNGLVVASVLSGNRNFEGRINPLTKASYLGSPILVVAYALSGTLNIDLTNMPI------GENIYLKDIWPSKEEIDEVIANSINSSMFIEKYSDIFSGTKEWKDLQVTTSSN-YNWDKN------------------NIKSAKILAIFGDSITTDHISPAGSIR---------------------------NHKVMMRGTFANIRIKNEMCKGVEGGFTINQLSGTQQTIYDAAMDYKAHDVPVVIFAGKEYGSGSSRDWAAKGPGLLGVKAVIAESFERIHRSNLVGMGILPLTFTGNNTRLDLKLDGSETIDIIGLSENIRPYNPVKCVI 634          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|758375086|gb|AJO69942.1| (IRP1B [Lepeophtheirus salmonis])

HSP 1 Score: 1593.94 bits (4126), Expect = 0.000e+0
Identity = 776/785 (98.85%), Postives = 778/785 (99.11%), Query Frame = 0
Query:  131 SSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDKTTCETA 915
            S PP  +P  P+  DDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDKTTCETA
Sbjct:  221 SVPPMDNPGLPI-QDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDKTTCETA 1004          

HSP 2 Score: 289.656 bits (740), Expect = 6.312e-80
Identity = 144/169 (85.21%), Postives = 145/169 (85.80%), Query Frame = 0
Query:    1 MKEGPSSGTMEDEDLLKDFQVGERSYKYYDVTQIQGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR--------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICP 149
            MKEGPSSGTMEDEDLLKDFQVGERSYKYYDVTQIQGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERIL                     RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLG  + P
Sbjct:    1 MKEGPSSGTMEDEDLLKDFQVGERSYKYYDVTQIQGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILSVLSGCEEDSEEDDDILFHPGRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGGSMQP 169          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|817083481|ref|XP_012264349.1| (PREDICTED: cytoplasmic aconitate hydratase-like [Athalia rosae])

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 467/917 (50.93%), Postives = 634/917 (69.14%), Query Frame = 0
Query:   13 EDLLKDFQVGERSYKYYDVTQI-QGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSN---ARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQ-ITSISYES--LKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIV 903
            ++LLK  ++GE   +YYDVT     Y++LP+S+RVLLE AVR   E Q  V K   E+IL                   RV+LQDFTGVPA++D AA+R++V K GG PD ++ +CP+DLV+DH VQVD+ +                  GD+             AL+ N+  EFERNKERF+FLKW   AFKN+ ++PPG+G++HQVNLEYLARVV    G+L+PDSVVGTD+HTTMINGLGVLGWG G ++A+AVM G  +++  P VVG +++GV++ Y TSTDLVL ITK LRQ GV G FVEFFGP + ELS+ADRATISNMCPEYGA VGFF +DE ++ YL Q+ R   H++ +E+Y++TVKM R+ +D +++  F+ ++ +DLS ++  VSGPKR  D+VS++E+  DF S L  K G KG+GL   +  V  +   +G+ + + HG V++AAI+SCTNTSNPSVMLGAGLLA+KAV+ GL+V   +KTSL+PGSGVVT YL+ESGV+P L  LGF++VGYGC TC  NSGP LPDS++ AI++ +LVCCG+LSGNRNFEGR+ P+ RANYLASPL+VIAYAIAG + I+ + EPLG+ +  G+AI+L+++WP+R EIQ +E+K VIP ++++VYSK+  G+  W SL  P     +PW  +STYIK P Y   +             R LL LGD++T+DHISPAGSI R+SPAA YL+  GL P+E+NSYG+RRGN  VM RGTF+N+RL N  + K GP T+++P+     IF+A+E+Y  D V L A+ GK +G G+SRDWA +GPFL G++A++A S++  +RSNLV  GI+PLQ +   S ES  L G E  +I I D+  P   I+V     ++ F  +VR D + +   F  GG++  ++
Sbjct:    8 KNLLKTIKIGETDCQYYDVTNFGDKYDKLPFSIRVLLESAVRNCDEFQ--VKKSDVEKILEWETNQKIPEGVEVAFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPDKINPICPSDLVIDHSVQVDFTR------------------GDN-------------ALKKNEDLEFERNKERFMFLKWGAKAFKNMLIVPPGSGIVHQVNLEYLARVVFDANGLLYPDSVVGTDSHTTMINGLGVLGWGCGGIEAEAVMLGQAISMLLPNVVGYKLEGVLNQYVTSTDLVLTITKNLRQLGVVGKFVEFFGPGVAELSIADRATISNMCPEYGATVGFFAVDEQSLAYLRQTSRSDKHVKYIEEYLRTVKMLRNYNDSSQDPVFSEVVTLDLSTVVSSVSGPKRPHDRVSVSEMKKDFTSCLSAKIGFKGFGLKPEKLKVEATFQFEGKDYKLNHGAVVIAAITSCTNTSNPSVMLGAGLLAQKAVKAGLTVAPYIKTSLSPGSGVVTYYLKESGVIPSLTQLGFDVVGYGCMTCIGNSGP-LPDSMIDAIEKNDLVCCGVLSGNRNFEGRIHPNTRANYLASPLLVIAYAIAGTVLIDFEAEPLGYRAD-GKAIYLRDVWPTRAEIQAVEQKHVIPAMFKEVYSKIESGSGSWSSLQAPGG-QLYPWDDESTYIKHPPYFDGLTKTIPPTNPIVKARVLLNLGDSVTTDHISPAGSIARNSPAARYLAKRGLKPKEFNSYGSRRGNDAVMARGTFANIRLVNKFIGKAGPRTIYIPTNEEMDIFDAAEKYAEDNVPLIALVGKEYGSGSSRDWAAKGPFLQGIKAVIAESYERIHRSNLVGMGIIPLQYLPGESAESLGLTGLELYNISIPDDYRPGQTIEVTTDDGKK-FNVLVRFDTEVDLTYFRHGGILNYMI 887          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|852779352|ref|XP_012882096.1| (PREDICTED: cytoplasmic aconitate hydratase [Dipodomys ordii])

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 454/916 (49.56%), Postives = 634/916 (69.21%), Query Frame = 0
Query:   15 LLKDFQVGERSYKYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            L++     +   K++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                 D+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRD++ ++ ++KY++ V MFR   D +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ +S    H   +   +   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG + I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W+SL  P+    F W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL+  GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I D++ P+  + V +    ++F+ ++R D D E   FH GG++  ++ K
Sbjct:    8 LVESLDPAQPEKKFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDVENILNWNVMQHKNIEVPFNPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNR-------------------------------RTDSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLAGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDENKVKYIKKYLQAVGMFRDFCDSSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVSPEHHHAQQTFVYNNSEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVDAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNTK-GQQVFLKDIWPTRDEIQAVERQFVIPGMFKEVYQKIETVNESWNSLEAPSEKLYF-WNPKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTKRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGETLDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIPDSLKPRMRVQVKLDTG-KTFQVIMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|395855812|ref|XP_003800343.1| (PREDICTED: cytoplasmic aconitate hydratase [Otolemur garnettii] >gi|831243475|ref|XP_012667143.1| PREDICTED: cytoplasmic aconitate hydratase [Otolemur garnettii])

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 453/902 (50.22%), Postives = 641/902 (71.06%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   YE LP+S+RVLLE AVR       K+++ +  + W  +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  + G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+VVG ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRD+  ++ ++KY++TV MFR  +D +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   +   F + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWPSR EIQ +ER+ VIPG++++VY K+   N+ W++L+VP+    F W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +MVRGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++AILA S++  +RSNLV  G++PL+     +     L G E  ++ I +N+TP+  + V +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLKKLEDSRYERLPFSIRVLLEAAVRNCDEFLVKKTDVENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDRDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVVGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIRYLEQTGRDEKTVKHIKKYLQTVGMFRDFNDPSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYNKSEFILTHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPSRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALAVPSDKLYF-WNPKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMVRGTFANIRLLNKFLNKQAPQTIHLPSGEVLDVFDAAERYQEAGLPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAILAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTVIIPENLTPRMKVQVKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|335296435|ref|XP_003357777.1| (PREDICTED: cytoplasmic aconitate hydratase [Sus scrofa])

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 451/904 (49.89%), Postives = 635/904 (70.24%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R     Q  V KD  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF+N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRD+  ++ ++KY++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   D   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+++V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L  P+    + W+  STYIK P + +++  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PR++NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I + + P+  + V +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCD--QFLVKKDDVENILNWNVLQHENIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFRNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGRDEDKVKHIKKYLQAVGMFRDFSDSSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQIAPDHHNDHKTFIYDNSEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEAVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGMNAK-GQQVFLKDIWPTRDEIQAVERQFVIPGMFKEVYQKIETVNESWNALEAPSDT-LYSWNPKSTYIKSPPFFEDLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPRDFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGEVLDVFDAAERYQQAGLPLIILAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIPETLKPQMKVQVKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|585642402|ref|XP_006881316.1| (PREDICTED: cytoplasmic aconitate hydratase [Elephantulus edwardii])

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 454/905 (50.17%), Postives = 635/905 (70.17%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE AVR   E    V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                 D+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARV   Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G ++ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRD++ I+ ++KY++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ +     +       +   F + HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAVE GL+V   VKTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+++V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +E++ VIPG++++VY K+   N+ W++L+ P+  DK + W+  STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +M RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     + S   L G E  ++ I +N+ P+  +DV +    R+F+A++R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAVRNCDEFL--VKKNDVENILNWNVTQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPICPADLVIDHSIQVDFNR-------------------------------RVDSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVAFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVSQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLTQTGRDETKIKLIKKYLQAVGMFRDFSDTSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQIPPDHHNDQKKFMYNNSEFILAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVEAGLNVKPYVKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEAVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQEVFLKDIWPTRDEIQAVEQQYVIPGMFKEVYQKIETVNESWNALAAPS--DKLYSWNPKSTYIKSPPFFENLTLDLQPPKSIIDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNKFLNKQAPQTIHLPSGEVLDVFDAAERYQQAGLPLIILAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENASTLGLTGHERYTVIIPENLKPRMKVDVKLDTG-RTFQAIMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|820997834|ref|XP_012364575.1| (PREDICTED: cytoplasmic aconitate hydratase isoform X1 [Nomascus leucogenys])

HSP 1 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 457/905 (50.50%), Postives = 634/905 (70.06%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   Y  LP+S+RVLLE A+R   E    V K   E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA  GFFP+DE++I YLAQ+GRD+  ++ ++KY++ V MFR  +D +++  F  ++E+DL  ++PC SGPKR +DKV+++ +  DF+S L  K+G KG+ ++    +   +   D   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YLQESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P+  DK F W+S STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  VM RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I +N+ P+  + + +    ++F+AV+R D D E   F  GG++  ++ K
Sbjct:   20 KFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFL--VKKQDIENILHWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAGFFPVDEVSIMYLAQTGRDEEKLKYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSNMKKDFESCLGAKQGFKGFQVAPEHHNDCKTFIYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS--DKLFFWNSKSTYIKSPPFFENLTLDLQLPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFLNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|1012010101|ref|XP_015993994.1| (PREDICTED: cytoplasmic aconitate hydratase [Rousettus aegyptiacus])

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 449/901 (49.83%), Postives = 639/901 (70.92%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVR-------KRSETQGQV-WKDVYERILR------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIV 903
            K++++ ++    Y  LP+S+RVLLE A+R       K+S+ +  + W  +  + +       RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF+N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GRD+  +  +++Y++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   +   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R+EIQ +ER+ VIPG++++VY K+   NK W++L VP+  DK + W+  STYIK P + + +  + +  +++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +MVRGTF+N+RL N  LNK  P T+HLPS  T  +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  ++ I +N+ P+  + + +    ++F+AV+R D D E   FH  G++  ++
Sbjct:   20 KFFNLNKLDDSRYGRLPFSIRVLLEAAIRNCDQFLVKKSDIENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPICPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFRNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGSPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVTQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLIQTGRDEEKVNHIKRYLQAVGMFRDFSDSSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDCKTFIYNNNEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLTVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAIIQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIKIDFEKEPLGVNAK-GQQVFLKDIWPTREEIQAVERQYVIPGMFKEVYQKIETVNKSWNALVVPS--DKLYYWNPKSTYIKSPPFFENLTLDLQPPESIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMVRGTFANIRLLNKFLNKQAPQTIHLPSGETLDVFDAAERYQQAGLPLIILAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGETADTLGLTGRERYTVIIPENVKPRMKVQIKLDTG-KTFQAVMRFDTDVELTYFHNKGILNYMI 884          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|795201739|ref|XP_011804047.1| (PREDICTED: cytoplasmic aconitate hydratase isoform X2 [Colobus angolensis palliatus] >gi|795201746|ref|XP_011804048.1| PREDICTED: cytoplasmic aconitate hydratase isoform X2 [Colobus angolensis palliatus])

HSP 1 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 454/905 (50.17%), Postives = 631/905 (69.72%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSKT 906
            K++++ +++   Y  LP+S+RVLLE A+R   E    V K   E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+N+                                AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I YL Q+GRD+  ++ ++KY++ V MFR  +D +++  F  ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   D   FT+ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GL+V   +KTSL+PGSGVVT YLQESGVMPYL  LGF++VGYGC TC  NSGP LP+ +V+AI QG+L+  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P S   F W+S STYIK P + + +  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  VM RGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I +N+ P+  + V +    ++F+ V+R D D E   F  GG++  ++ KT
Sbjct:   20 KFFNLNKLEDPRYGRLPFSIRVLLEAAIRNCDEFL--VKKHDIENILHWNVMQHENIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNR-------------------------------RADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGRFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKVQYIKKYLQAVGMFRDFNDPSQDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFTYDNTEFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEPVVEAITQGDLIAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATP-SDKMFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGRERYTIIIPENLKPRMKVQVKLDTG-KTFQVVMRFDTDVELTYFLNGGILNYMIRKT 887          
BLAST of EMLSAG00000007801 vs. nr
Match: gi|743742248|ref|XP_010965658.1| (PREDICTED: cytoplasmic aconitate hydratase isoform X1 [Camelus bactrianus])

HSP 1 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 454/905 (50.17%), Postives = 638/905 (70.50%), Query Frame = 0
Query:   27 KYYDVTQIQG--YEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR----------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDK-FPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI---TSISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            K++++ +++   YE LP+S+RVLLE A+R     Q  V K+  E IL                 RV+LQDFTGVPA++D AA+R++V K GG P+ ++ +CPADLV+DH +QVD+                               S  AD+L+ NQ  EFERN+ERF FLKW + AF N+ +IPPG+G++HQVNLEYLARVV  Q G  +PDS+VGTD+HTTMI+GLG+LGWGVG ++A+AVM G P+++  P+V+G R+ G      TSTD+VL ITK LRQ GV G FVEFFGP + +LS+ADRATI+NMCPEYGA   FFP+DE++I+YL Q+GR++  ++ ++KY++ V MFR  SD +++  FA ++E+DL  ++PC SGPKR +DKV+++++  DF+S L  K+G KG+ ++    +   +   +   F++ HG+V++AAI+SCTNTSNPSVMLGAGLLAKKAV+ GLSV   +KTSL+PGSGVVT YL+ESGVMPYL  LGF++VGYGC TC  NSGP LP+++V+AI QG+LV  G+LSGNRNFEGR+ P+ RANYLASP +VIAYAIAG I I+ ++EPLG N+  G+ +FLK+IWP+R EIQ +ER+ VIPG++++VY K+   N+ W++L+ P+  DK + W+  STYIK P + +++  + +  K++     LL LGD++T+DHISPAG+I R+SPAA YL++ GL PRE+NSYG+RRGN  +MVRGTF+N+RL N  LNK  P T+HLPS     +F+A+ERY+  G+ L  + GK +G G+SRDWA +GPFLLG++A+LA S++  +RSNLV  G++PL+     +     L G E  +I I + + P+  + V +    ++F+AV+R D D E   FH GG++  ++ K
Sbjct:   20 KFFNLNKLKDPRYERLPFSIRVLLEAAIRNCD--QFLVKKNDVENILNWNVLQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPICPADLVIDHSIQVDF-------------------------------SRRADSLQKNQDLEFERNRERFEFLKWGSQAFCNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLVGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSIKYLVQTGREEEKVKHIKKYLQAVGMFRDFSDPSQDPDFAQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLRAKQGFKGFQVAPDHHNDHKTFIYNNSEFSLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLSVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGP-LPEAVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAK-GQQVFLKDIWPTRDEIQVVERQYVIPGMFKEVYQKIETVNESWNALAAPS--DKLYCWNPKSTYIKSPPFFEDLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMVRGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIILAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGRERYTISIPETLKPRMKVQVKLDTG-KTFQAVMRFDTDVELTYFHNGGILNYMIRK 886          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold481_size160081-processed-gene-0.6 (protein:Tk12153 transcript:snap_masked-scaffold481_size160081-processed-gene-0.6-mRNA-1 annotation:"aconitase ")

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 452/919 (49.18%), Postives = 623/919 (67.79%), Query Frame = 0
Query:   15 LLKDFQV-GERSYKYYDVTQI-QGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYI----KEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITS---ISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            LL+D +V G  + K++D+  +   Y +LP+S+RVLLE AVR     Q  V +    +IL+                  RV+LQDFTGVPA++D AA+R++V + GG P++++  CP+DLV+DH VQVD+               +TP                 DAL  N+  EFERNKERF FLKW   AFKN+ ++PPG+G++HQVNLEYLARV      +++PDSVVGTD+HTTMINGLGV+GWGVG ++A+AVM G P+++  P+V+G +I G +    TSTD+VL ITK LRQ GV G FVEF+GP +  LS+ADRATI+NMCPEYGA VG+FP+D  +I YL Q+ RD + I+ +E Y+  V M R+ SD +++  F+ ++E+DL+ ++P +SGPKR  D+VS++++  DF + L    G KGYGL + +        ++G+   + HG VL+AAI+SCTNTSNPSVMLGAGL+AKKAVE GLSV   +KTSL+PGSGVVT YL+ESGV+PYL  LGF IVGYGC TC  NSGP L + + +AIK+G+LVCCG+LSGNRNFEGR+  D RANYLASP +VIAYAIAGR+DI+ + E LG ++  G+ +FL++IWPSR+EIQ +E+K VIP ++ +VYSK++ GN  W+ L  P     +PW  +STYIK P +     KE+ +  R  +N   LL L D++T+DHISPAGSI R+SPAA +L S G+ PRE+NSYG+RRGN  VM RGTF+N+RL N  + + GP TLH+PS     +F+A+E YK +   L  + G+++G G+SRDWA +GPFL GVRA++A S++  +RSNLV  GI+PLQ  S        L   E  ++ I  ++ P+  ++V V   ++SFK + R D + E   +  GG++  ++ K
Sbjct:   63 LLRDLKVEGHGNLKFFDLASLGPEYGQLPFSIRVLLESAVRNCDNFQ--VLETDVIKILKWAQNQSVPSGVEVPFRPARVILQDFTGVPAVVDFAAMRDAVQRLGGDPEMINPQCPSDLVIDHSVQVDFV--------------RTP-----------------DALSKNEELEFERNKERFTFLKWGAKAFKNMLIVPPGSGIVHQVNLEYLARVCFTDSDIVYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQPISMVLPKVLGYKISGKMHSLVTSTDVVLTITKHLRQIGVVGKFVEFYGPGVASLSIADRATIANMCPEYGATVGYFPVDSQSIDYLKQTNRDATKIKAIEAYLNAVGMMRNYSDASQDPTFSEVVELDLASVVPSLSGPKRPHDRVSVSDMKTDFLNCLSANIGFKGYGLPKDKLTTTVPFVLNGKEHVISHGAVLIAAITSCTNTSNPSVMLGAGLMAKKAVEKGLSVAPYIKTSLSPGSGVVTYYLKESGVIPYLDALGFSIVGYGCMTCIGNSGP-LEEPVSEAIKKGDLVCCGVLSGNRNFEGRIHADTRANYLASPPLVIAYAIAGRVDIDFETEALGQDAD-GKPVFLRDIWPSREEIQAVEKKYVIPTMFEEVYSKITTGNDRWNKLEAPEG-KLYPWDQNSTYIKSPPFFDGMTKELPA-PRKVENALPLLNLADSVTTDHISPAGSIARNSPAARFLGSKGITPREFNSYGSRRGNDAVMARGTFANIRLVNKFIGQAGPKTLHIPSNEVMDVFDAAEEYKKENRHLVILAGQDYGCGSSRDWAAKGPFLQGVRAVMAESYERIHRSNLVGMGIVPLQYMSGENADSLGLTAKEEFTVHIPADLKPQQTLEVQV-SGKKSFKVLARFDTELELTYYRHGGILNYMIRK 943          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold1622_size33238-snap-gene-0.11 (protein:Tk00863 transcript:maker-scaffold1622_size33238-snap-gene-0.11-mRNA-1 annotation:"aconitase ")

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 452/919 (49.18%), Postives = 623/919 (67.79%), Query Frame = 0
Query:   15 LLKDFQV-GERSYKYYDVTQI-QGYEELPYSLRVLLECAVRKRSETQGQVWKDVYERILR------------------RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRS-SDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYI----KEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITS---ISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            LL+D +V G  + K++D+  +   Y +LP+S+RVLLE AVR     Q  V +    +IL+                  RV+LQDFTGVPA++D AA+R++V + GG P++++  CP+DLV+DH VQVD+               +TP                 DAL  N+  EFERNKERF FLKW   AFKN+ ++PPG+G++HQVNLEYLARV      +++PDSVVGTD+HTTMINGLGV+GWGVG ++A+AVM G P+++  P+V+G +I G +    TSTD+VL ITK LRQ GV G FVEF+GP +  LS+ADRATI+NMCPEYGA VG+FP+D  +I YL Q+ RD + I+ +E Y+  V M R+ SD +++  F+ ++E+DL+ ++P +SGPKR  D+VS++++  DF + L    G KGYGL + +        ++G+   + HG VL+AAI+SCTNTSNPSVMLGAGL+AKKAVE GLSV   +KTSL+PGSGVVT YL+ESGV+PYL  LGF IVGYGC TC  NSGP L + + +AIK+G+LVCCG+LSGNRNFEGR+  D RANYLASP +VIAYAIAGR+DI+ + E LG ++  G+ +FL++IWPSR+EIQ +E+K VIP ++ +VYSK++ GN  W+ L  P     +PW  +STYIK P +     KE+ +  R  +N   LL L D++T+DHISPAGSI R+SPAA +L S G+ PRE+NSYG+RRGN  VM RGTF+N+RL N  + + GP TLH+PS     +F+A+E YK +   L  + G+++G G+SRDWA +GPFL GVRA++A S++  +RSNLV  GI+PLQ  S        L   E  ++ I  ++ P+  ++V V   ++SFK + R D + E   +  GG++  ++ K
Sbjct:   29 LLRDLKVEGHGNLKFFDLASLGPEYGQLPFSIRVLLESAVRNCDNFQ--VLETDVIKILKWAQNQSVPSGVEVPFRPARVILQDFTGVPAVVDFAAMRDAVQRLGGDPEMINPQCPSDLVIDHSVQVDFV--------------RTP-----------------DALSKNEELEFERNKERFTFLKWGAKAFKNMLIVPPGSGIVHQVNLEYLARVCFTDSDIVYPDSVVGTDSHTTMINGLGVVGWGVGGIEAEAVMLGQPISMVLPKVLGYKISGKMHSLVTSTDVVLTITKHLRQIGVVGKFVEFYGPGVASLSIADRATIANMCPEYGATVGYFPVDSQSIDYLKQTNRDATKIKAIEAYLNAVGMMRNYSDASQDPTFSEVVELDLASVVPSLSGPKRPHDRVSVSDMKTDFLNCLSANIGFKGYGLPKDKLTTTVPFVLNGKEHVISHGAVLIAAITSCTNTSNPSVMLGAGLMAKKAVEKGLSVAPYIKTSLSPGSGVVTYYLKESGVIPYLDALGFSIVGYGCMTCIGNSGP-LEEPVSEAIKKGDLVCCGVLSGNRNFEGRIHADTRANYLASPPLVIAYAIAGRVDIDFETEALGQDAD-GKPVFLRDIWPSREEIQAVEKKYVIPTMFEEVYSKITTGNDRWNKLEAPEG-KLYPWDQNSTYIKSPPFFDGMTKELPA-PRKVENALPLLNLADSVTTDHISPAGSIARNSPAARFLGSKGITPREFNSYGSRRGNDAVMARGTFANIRLVNKFIGQAGPKTLHIPSNEVMDVFDAAEEYKKENRHLVILAGQDYGCGSSRDWAAKGPFLQGVRAVMAESYERIHRSNLVGMGIVPLQYMSGENADSLGLTAKEEFTVHIPADLKPQQTLEVQV-SGKKSFKVLARFDTELELTYYRHGGILNYMIRK 909          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold463_size163741-snap-gene-0.3 (protein:Tk05403 transcript:maker-scaffold463_size163741-snap-gene-0.3-mRNA-1 annotation:"aconitate hydratase")

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 392/898 (43.65%), Postives = 575/898 (64.03%), Query Frame = 0
Query:   40 LPYSLRVLLECAVR-------KRSETQGQV-W------KDVYERILRRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQ---GGVL-FPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQ--GHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEY---IKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLL-NKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQI----TSISYESLKGTECLSIDIRDNITPKCLIDVVV----GKAERSFKAVVRVDNDYETDVFHAGGVIAQIVSK 905
            LP+SL++LLE  +R        +++ Q  + W       D       RV++QDFTGVPA++DLAA+R++V K GG    ++ L PA+LV+DH V VDY    Q                               AL  N   EFERN ER+ FL+W  SAF N  V+PP TG++HQVN+EYLAR V  +   G V  +PD++VGTD+HTTM+NGLGVLGWGVG ++A+A M G  +T+  P+VVG ++KG + + +T+TDLVL +T+ LR  GV G FVEF+G  L  L +ADRATI+NM PEYGA  G FPIDE T+ YL  +GR+   IE V++Y     MFR+ D+ E  R+ + +E+D+  ++P ++GPKR +D++++ +++   K+A +++   K      G      A  +  DG  FT+  G V +AAI+SCTNTSNP V++ +GLLA+ AV  GL+V   VKTSLAPGS VVT YL+++ +M  L  LGF++VGYGC+TC  NSGP LP++I  A++ G+L    +LSGNRNFEGR+  DI+ N+LASP +V+AYA+AG I +++ ++PLG     G  +FLK+IWPS++EIQE+    +   ++++ YS V  G++ W ++ +  S D++ W+SDSTYI+ P Y   + +  S+ +  KN R L  LGD+IT+DHISPAGS    SPA +YL+  G+A +++NSYG+RRGN+ VM+RGTF+N+RL+N L     G +T + P +   +I++AS +Y+ +GV L  I GK +G G+SRDWA +G  LLGV+A++  S++  +RSNLV  G+LPLQ     + +S+  L G E  SI+  +N +    +D+VV    GK  +  + +VR+D   E D +  GG++  ++ +
Sbjct:  112 LPFSLKILLENLLRTENGVDVSKADIQAIINWDAKATPNDEIAFTPARVVMQDFTGVPAIVDLAAMRDAVVKLGGDVQKINPLAPAELVIDHSVMVDYFGTPQ-------------------------------ALEKNAELEFERNAERYEFLRWGQSAFDNFKVVPPRTGIVHQVNIEYLARTVFTKEENGEVTAYPDTLVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQAITMLVPQVVGFKLKGKMPEGATATDLVLTVTQMLRNLGVVGKFVEFYGEGLAHLPLADRATIANMAPEYGATCGIFPIDEETLTYLRLTGREDDQIELVKEYAMAQGMFRTEDQPE-ARYTATLELDMGTVVPSLAGPKRPQDRIALTDMSE--KTAEYVRAYAKDRDAKAGDVLTKSAIEITQDGNTFTLEDGAVTIAAITSCTNTSNPYVVVASGLLARNAVAKGLTVKPWVKTSLAPGSKVVTDYLEKANLMGDLDKLGFDVVGYGCTTCIGNSGP-LPEAIGNAVRNGDLTVSSVLSGNRNFEGRIHADIKMNFLASPPLVVAYALAGNIQVDMHKDPLG-QDQQGNDVFLKDIWPSQKEIQEVVTANINQAMFKKSYSNVFKGDERWAAIPITES-DRYNWNSDSTYIQNPPYFVGMSKDPSDIKPIKNARVLAFLGDSITTDHISPAGSFNADSPAGKYLTEQGVARKDFNSYGSRRGNHQVMMRGTFANVRLRNELAPGTEGGWTRYQPEDSEMSIYDASMKYQENGVPLIVIAGKEYGTGSSRDWAAKGTLLLGVKAVVTESYERIHRSNLVGMGVLPLQFKEGESKVSH-GLTGKEIYSIEGLENGSRH--VDLVVNDESGKEIKRIELLVRIDTPREWDYYQHGGILHYVLRR 969          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold2708_size13032-processed-gene-0.3 (protein:Tk01688 transcript:snap_masked-scaffold2708_size13032-processed-gene-0.3-mRNA-1 annotation:"aconitate hydratase 1")

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 375/898 (41.76%), Postives = 535/898 (59.58%), Query Frame = 0
Query:   37 YEELPYSLRVLLECAVRKR--------------SETQGQVWKDVYERILR--RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVV---TCQGGV--LFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNARNWKNM---RCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKV-GPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQIT---SISYESLKGTECLSIDIRDNITPKCLIDVVVGKAERSFKAVV---RVDNDYETDVFHAGGVIAQIV 903
            + +LP +L+V+LE  +R                SE   +  K+  E   R  RVL+QDFTGVPA++DLAA+R+ +   GG    ++ L P DLV+DH V +D      +  +P                          A + N   E+ERN ER+ FLKW   AF N  V+PPGTG+ HQVNLEYL++ V   T Q GV   +PD++VGTD+HTTM+NGL VLGWGVG ++A+A M G PV++  P VVG  + G + + +T TDLVL + + LR  GV G FVEF+G  L  L +ADRATI+NM PEYGA  GFFPID  T++YL  +GRD+  I  VE Y K    +R +D      + + + +D+  I+P +SGPKR +D V++      F      +E  + +    G+      V + GE +T+  G V++A+I+SCTNTSNP VM+GAGL+A+KA   GL+    VKTSLAPGS VV+ YL+ +G+   L  +GF +VGYGC+TC  NSGP +   +  AI QG+LV   +LSGNRNFEGR+ PD+RANYLASP +V+AYA+AG +DI+L  E LG     G  +FLK+IWP+  EI  +  K V    + + Y+ V  G++ W ++  P+S + + W + STYI+ P Y + +  +     N+   + L  LGD +T+DHISPAGS   S+PA +YL    +  RE+NSYG+RRGN+ VM+RGTF+N+R++N +L+ V G YT   P      IF+A+  ++ +G  L    G+ +G G+SRDWA +G  LLGV+A++A +F+  +RSNLV  G++P + T   S     L G E ++I   D I P   +   +  A+ S K +    R+D   E +    GGV+  ++
Sbjct:   22 FSKLPAALKVVLENMLRFEDGGFSVSVDDIKAFSEWADKGGKNPREIAYRPARVLMQDFTGVPAVVDLAAMRDGIVALGGDAQQINPLNPVDLVIDHSVMID------EFGNP-------------------------RAFQMNVDREYERNLERYTFLKWGQKAFNNFRVVPPGTGICHQVNLEYLSQTVWTDTDQNGVEIAYPDTLVGTDSHTTMVNGLAVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFELTGQMMEGTTGTDLVLKVVEMLRAHGVVGKFVEFYGAGLDVLPLADRATIANMAPEYGATCGFFPIDGETLRYLRNTGRDEDRIALVEAYAKENGFWRDADYAP--IYTATLSLDMGTIVPAISGPKRPQDYVALTNAKTAFT-----REMAETFRRPMGK-----EVTVVGEDYTMESGKVVIASITSCTNTSNPYVMIGAGLVARKAAALGLNRKPWVKTSLAPGSQVVSEYLEAAGLQEDLDKIGFNLVGYGCTTCIGNSGP-IQKELSDAIAQGDLVATSVLSGNRNFEGRISPDVRANYLASPPLVVAYALAGTMDIDLATEALG-QDQNGNDVFLKDIWPTSAEINALVEKTVTREAFIKKYADVFKGDEKWQAVQTPDS-ETYDWPAASTYIQNPPYFQGMSKDPGKISNLSGAKVLAVLGDMVTTDHISPAGSFKDSTPAGQYLIERQVPVREFNSYGSRRGNHEVMMRGTFANIRIKNEMLDGVEGGYT-KGPDGAQAAIFDAAMAHQAEGTPLVIFAGEQYGAGSSRDWAAKGTALLGVKAVIAENFERIHRSNLVGMGVIPFEFTGGDSRKSLGLTGDETVAIAGLDTIEPLQNVTATITMADGSNKEITVKCRIDTAVEIEYIENGGVLHYVL 872          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold5331_size4740-processed-gene-0.2 (protein:Tk02592 transcript:snap_masked-scaffold5331_size4740-processed-gene-0.2-mRNA-1 annotation:"aconitate hydratase")

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 383/962 (39.81%), Postives = 551/962 (57.28%), Query Frame = 0
Query:   14 DLLKDFQVGE-RSYKYYDVTQIQGYEELPYSLRVLLECAVRK---RSETQGQV-----WKDV----YER--ILRRVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYG-------------LSQGQGHV---AFSVNID------------GEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEI----GSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKV-GPYT-----LHLPS----------EVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQITS-ISYESLKGTECLSIDIRD-NITPKCLIDVVVGKA-ERSFKAVVRVDNDYETDVFHAGGVIAQIVSKTKDK 909
            D L+ F+ G   S        I     LP S+R+++E  +R    R  T+  V     W       YE    + RV+LQDFTGVP ++DLAA+R++ + +G  P +V+ L P DLVVDH VQVD+   +                                AL  N + EF RN+ER+ FLKW   AF+   V+PPG G++HQVNLE+LA  V  +  V +PD++VGTD+HTTMINGLGV+GWGVG ++A+A M G PVT   P VVG+ + G +++  T+TDL L IT+ LR  GV G FVEF+GP  + LS+ DRATI+NM PEYGA +GFFP+D  TI YL  +GR +    TVE Y +  +M+   ++ E I +   +E+DL+ ++P VSGPKR +D++ + ++ A F           GYG             LS   G     A  +N D            G    + HG+VL+AAI+SCTNTSNPSVML AGL+AKKA   GL+V   VKTSL PGS VVT YL  + +   L  LGFE VGYGC+TC  NSGP  P+ I  A+   +LVC  +LSGNRNFE R+   IRAN+L SP +V+AYA+AGRIDI+L  +PLG     G  I+LK++WPS  E+QE+    + P +++++YS +   ++ W  +        + W+ DSTYI+ P +         +  ++  + R L   GD++T+DHISPAG+IT +SPA +YL   G+   ++NS+G+RRGN  +M RGTF N+R++N +   + G YT      H+P+             T I++A+  Y+  G  L  I G+++G G+SRDWA +G  LLGV+A++  SF+  +RSNL+  G+LPL       Y+ +K     +  I   +   K + +V +  +   S   + R+D   E D + +GG++  ++++  D+
Sbjct:    2 DTLRTFENGSFHSLPALKSLGIADVSRLPISIRIVIESLLRNLDGRKVTESDVKNLANWNAKSPGDYEVPFTVARVVLQDFTGVPLVVDLAAMRDAAANAGADPAIVEPLVPVDLVVDHSVQVDFAGSQS-------------------------------ALDRNLSIEFIRNQERYEFLKWGQQAFETFGVVPPGIGIVHQVNLEHLATGVLSKDEVFYPDTLVGTDSHTTMINGLGVVGWGVGGIEAEAGMLGQPVTFLVPEVVGVYLHGKLAEGVTATDLTLRITEILRAHGVVGKFVEFYGPGAEALSLPDRATIANMAPEYGATMGFFPLDSETINYLRGTGRSEELCATVENYFRAQEMWGIPEKGE-IDYTDDLELDLASVVPAVSGPKRPQDRIDVPDLGAKFNDLFTASVDEGGYGREASTRNDVAELDLSTPAGFSPEGALLLNSDDDPSNDVAIETQGSKIALQHGSVLIAAITSCTNTSNPSVMLAAGLVAKKANALGLTVAPFVKTSLGPGSRVVTDYLNATHLQKELDQLGFETVGYGCTTCIGNSGPLNPE-IEAALTSKDLVCASVLSGNRNFEARIHGSIRANFLMSPPLVVAYALAGRIDIDLTNDPLG-QDQNGNDIYLKDLWPSPAELQEVIGSALKPEVFQKLYSNLDTASEKWVGIESATGA-TYDWNGDSTYIQLPPFFDNFSRTPATEGQDLIDTRPLGVFGDSVTTDHISPAGAITATSPAGKYLLEHGVEKAKFNSFGSRRGNDRIMTRGTFGNVRIKNLMTPGIEGGYTQYFGDAHVPAPDQDIPSAENAKATFIYDAAVAYQQSGRKLIIIAGEDYGMGSSRDWAAKGTALLGVKAVITKSFERIHRSNLIGMGVLPLTFKDKADYDKIKDMHSCTFSITGLSGELKTMQEVTLTTSCGLSLPLIARLDTPAEIDYYLSGGILPYVLNQILDQ 928          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold9883_size2308-processed-gene-0.0 (protein:Tk01508 transcript:snap_masked-scaffold9883_size2308-processed-gene-0.0-mRNA-1 annotation:"aconitate hydratase")

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 305/766 (39.82%), Postives = 441/766 (57.57%), Query Frame = 0
Query:   17 KDFQVGERSYKYYDVTQIQG-----YEELPYSLRVLLECAVRKR-------------SETQGQVWKDVYERILR--RVLLQDFTGVPALIDLAAIRESVSKSGGCPDVVDSLCPADLVVDHCVQVDYNQIKQQLSSPPDPSPKTPVLGDDICPFHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTC---QGG--VLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADF---------------KSALHLK-EG----PKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTCSYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNSVDKFPWSSDSTYIKCPEYIKEIGSNA---RNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARR 734
            K    G++S  YY +   Q      +  LP +L+V+LE  +R               +E   Q  K+  E   R  RVL+QDFTGVPA++DLAA+R+ +   GG  + ++ L P DLV+DH V +D      +  +P                          A + N   E+ERN ER+ FLKW   AF N  V+PPGTG+ HQVNLEYLA+ V     Q G  V +PD++VGTD+HTTM+NG+ VLGWGVG ++A+A M G P+++  P V+G  + G + + +T TDLVL + + LR  GV G FVEF+G  L  L +ADRATI+NM PEYGA  GFFPID  T++Y+  +GRD+  I  VE Y K   M+R +D +    +   + +D+  I+P +SGPKR +D +++      F               KS +  + EG    P+      G     +    DG Y  +  G++++A+I+SCTNTSNP VM+GAGL+A+KA   GL+    VKTSLAPGS VV++YL+ + +   L  +GF +VGYGC+TC  NSGP  P +I +AI   +L+   +LSGNRNFEGR+ PD+RANYLASP +V+AYA+ G ++ +L   PLG     G  ++L++IWP+ +E+ E+  + V    ++  Y+ V  G++ W  ++  ++   + W   STY++ P Y + +        N +  + L  LGD IT+DHISPAGS    +PA +YL    +  RE+NSYG+RR
Sbjct:   14 KTLTAGDQSIAYYSIPAAQAAGLGDFSNLPAALKVVLENMLRFEDGKTVTVDDIKAFAEWGAQGGKNPREIAYRPARVLMQDFTGVPAVVDLAAMRDGIVALGGDAEQINPLNPVDLVIDHSVMID------EFGNP-------------------------RAFQMNVDREYERNMERYTFLKWGQKAFNNFRVVPPGTGICHQVNLEYLAQTVWTDKDQHGTEVAYPDTLVGTDSHTTMVNGMAVLGWGVGGIEAEAAMLGQPISMLIPEVIGFELTGAMMEGTTGTDLVLKVVEMLRAKGVVGKFVEFYGAGLDTLPLADRATIANMAPEYGATCGFFPIDGETLRYMRTTGRDEDRIALVEAYAKENGMWRGADYSP--VYTDTLTLDMGTIVPAISGPKRPQDYIALTSAHTAFADYVKGVRDGKDPSEKSEVRWEGEGGQPEPRDIPGDTGSHKRGYVQTEDGNY-QLHDGSIVIASITSCTNTSNPYVMIGAGLVARKARALGLTRKPWVKTSLAPGSQVVSAYLEAANLQEDLDAIGFNLVGYGCTTCIGNSGPLEP-AISKAINDYDLIGTSILSGNRNFEGRISPDVRANYLASPPLVVAYALVGDMNHDLANSPLG-QDKDGNDVYLRDIWPTSKEVAELVEQTVTREAFQTKYADVFKGDEKWQDVATTDA-KTYDWPPASTYVQNPPYFQGMSKEPGVITNIEGAKVLAVLGDMITTDHISPAGSFKEGTPAGQYLIEHQVPVREFNSYGSRR 742          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold615_size123629-snap-gene-0.2 (protein:Tk01943 transcript:maker-scaffold615_size123629-snap-gene-0.2-mRNA-1 annotation:"aconitate hydratase")

HSP 1 Score: 177.563 bits (449), Expect = 9.182e-46
Identity = 189/705 (26.81%), Postives = 303/705 (42.98%), Query Frame = 0
Query:  174 ERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSD----ENENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTC-----SYNSGPNLP-DSIVQAIKQGNLVCCGLLSGNRNFEGRLD--PDIRANYLASPLMVIAYAIAGRIDINLDREPLGFNSHTGEAIFLKNIWPSRQEIQEIERKLVIPGIYRQVYSKVSVGNKHWDSLSVPNS--VDKFPWSSDSTYIKCPEYIKEIGSNARNWKNMRCLLKLGDNITSDHISPAGSITRSSPAAEYLSSLGLAPREYNSYGARRGNYHVMVRGTFSNMRLQNHLLNKVGPYTLHLPSEVTTTIFEASERYKNDGVSLFAIGGKNFGRGTSRDWATRGPFLLGVRAILAVSFDPTYRSNLVKTGILPLQ-ITSISYESLKGTECLSIDIRDNITP 863
            E F FL+ V+  +  I    PG G++HQV LE  A      GG++     +GTD+HT    GLG++  GVG  DA  VM G P  L  P+++G+++ G +S +S+  D++L +   L   G  GA VE+FG     LS   + TI NM  E GA    F  D+   +YL  + R       +      VK   ++D     N    F  +IEI+L+++ P ++GP       S+ +   D       K    G+ L             D E+  +G          SCTN+S   +   A  +AK+A++ GL+     +  + PGS  V       G++     +   I    C  C      Y+   N P +SI+ +              NRNF  R D  P+  A ++ASP MV A AIAGR+D N   + L   +  GE +                 KL  P  Y    +  +V ++ +++ +   S    K   +SD   +  P ++  +    ++  +MR L+K+    T+DHIS AG   +     E +S+                N +      F++    N +LN +    + +P        +++  Y+  G+     G +N G G+SR+ A   P  LGV A++  SF   + +NL K G+L L  I    Y+ ++  + +SI   D + P
Sbjct:  117 EVFNFLESVSDKY-GIGFWKPGAGIIHQVVLENYA----FPGGMM-----IGTDSHTVNAGGLGMVAIGVGGADAVDVMAGMPWELKNPKLIGVKLTGKLSGWSSPKDVILKVADILTVKGGTGAIVEYFGDGALNLSCTGKGTICNMGAEIGATTSTFGYDDSMDRYLRATDR-----ADIADAANEVKEHLTADAECYANPEQYFDQVIEINLTELKPLINGPFTPDLSTSVGKEMTD-------KATKNGWPL-------------DVEWGLIG----------SCTNSSYEDLSRAAS-IAKQAIDKGLTTK--AEFGINPGSEQVRYTTDRDGILKIFEDVNATIFTNACGPCIGQWARYSDPMNAPKNSIIHSF-------------NRNFSKRADGNPNTHA-FVASPEMVAAIAIAGRLDFNPMTDTL--TNDKGEQV-----------------KLEEPTGYELPPNGFAVEDRGFNAPAADGSGITVKVDPTSDRLQLLTP-FVPIL---QKDVTDMRILIKVKGKCTTDHISMAGPWLKYRGHLENISN----------------NCYTGAINYFNDK--PNKVLNYLNNDYIAVP--------DSARAYQAAGIGTVVFGEENLGEGSSREHAAMEPRFLGVHAVIVKSFARIHETNLKKQGMLALTFIDKADYDKVRQDDVVSIVDFDQMAP 710          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: snap_masked-scaffold8621_size2665-processed-gene-0.0 (protein:Tk07776 transcript:snap_masked-scaffold8621_size2665-processed-gene-0.0-mRNA-1 annotation:"hypothetical protein")

HSP 1 Score: 156.762 bits (395), Expect = 2.541e-40
Identity = 128/455 (28.13%), Postives = 206/455 (45.27%), Query Frame = 0
Query:  150 FHQKMSYWADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDE---NENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSL--APGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTC------SYNSGPNLPDSIVQAIKQGNLVCCGLLSGNRNFEGRLDPDIRA-NYLASPLMVIAYAIAGRIDINL 592
               K+    D LR+  T     N+E + FL+ +++ +       PG+G++HQV LE  A      GG++     +GTD+HT    GLG++  GVG  DA  VM G+P  + FP+++G+ + G +S ++   D++L + + L   G  GA VE+ GP  + +S   +ATI NM  E GA    F  DE   +YL  +GR+ +     +         R  DE   +    +  +IEIDLS + P ++GP        + ++ A+ ++        +G+ L                        +  A I SCTN+S   +   A + A++A   GL++    KT L   PGS  V + ++  G++     LG  ++   C  C      S    P +P+ IV              S NRNF  R D D     ++ SP  V+A A+AG +D + 
Sbjct:  100 IQAKVEAKQDLLRAIDT-----NEEVYHFLESISAKYGG-GFWKPGSGIIHQVVLENYA----FPGGMM-----IGTDSHTPNAGGLGMIAIGVGGADAVDVMTGNPWNVRFPKMIGVHLTGELSGWAAPKDVILKVAEILTVKGGTGAIVEYIGPGAQAISATGKATICNMGAEIGATTSLFAYDEAIARYLKSTGREAT----ADAANAVAHHLRPDDEVLADPASYYDQVIEIDLSALTPHINGPHTPDLAREVKDLGAEARA--------EGWPLE-----------------------ISAALIGSCTNSSYEDITRAASI-AREAKAKGLTL----KTELLITPGSEQVRATIERDGLLADFEALGATVLANACGPCIGQWDRSDEREPGIPNVIVT-------------SYNRNFPKRNDGDAATLAFVTSPETVMALALAGNVDFDF 486          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold6_size1037037-snap-gene-7.0 (protein:Tk01301 transcript:maker-scaffold6_size1037037-snap-gene-7.0-mRNA-1 annotation:"aconitate hydratase")

HSP 1 Score: 147.517 bits (371), Expect = 1.899e-36
Identity = 134/446 (30.04%), Postives = 199/446 (44.62%), Query Frame = 0
Query:  158 ADALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDE----NENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTC-----SYNSGPNLP-DSIVQAIKQGNLVCCGLLSGNRNFEGRLD--PDIRANYLASPLMVIAYAIAGRIDIN 591
            AD   +N TS      E F FL+ V++ +  I    PG G++HQV LE  A      GG++     +GTD+HT    GLG++  GVG  DA  VM G    L FP+++G+R+ G IS ++   D++L + + L   G  GA VE+FGP    LS   + TI NM  E GA    F  D    +YL  + R       V      VK   ++D     N    F  +I+IDLS + P ++GP              D  +A+       G  ++       + + ++               I SCTN+S   +   A  +A++A++ GL +    +  + PGS  V    +  G++     LG +I    C  C      Y+   N P +SIV +              NRNF  R D  P+  A ++ASP +  A AIAGR+D N
Sbjct:   92 ADLKFANSTS-----AEVFDFLESVSNKY-GIGFWKPGAGIIHQVVLENYA----FPGGMM-----IGTDSHTVNAGGLGMVAIGVGGADAVDVMAGMAWELKFPKLIGVRLTGTISGWTAPKDVILKVAEILTVKGGTGAIVEYFGPGAIALSCTGKGTICNMGAEIGATTSTFGYDASMERYLRATDR-----ADVADAANEVKEHLTADADVYANPENYFDQVIDIDLSKLGPLLNGP-----------FTPDLSTAV-------GTDMNVKATENEWPIQVE------------WGLIGSCTNSSYEDLSR-ASSIAQQALDKGLKMK--AELGINPGSEQVRFTAERDGILSVFEKLGSKIFTNACGPCIGQWARYSDPKNAPKNSIVHSF-------------NRNFAKRADGNPNTHA-FVASPEITAAIAIAGRLDFN 470          
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold8901_size2576-snap-gene-0.0 (protein:Tk10445 transcript:maker-scaffold8901_size2576-snap-gene-0.0-mRNA-1 annotation:"aconitate hydratase")

HSP 1 Score: 139.813 bits (351), Expect = 2.196e-34
Identity = 127/445 (28.54%), Postives = 195/445 (43.82%), Query Frame = 0
Query:  159 DALRSNQTSEFERNKERFIFLKWVNSAFKNITVIPPGTGVMHQVNLEYLARVVTCQGGVLFPDSVVGTDTHTTMINGLGVLGWGVGTLDAQAVMFGHPVTLSFPRVVGIRIKGVISDYSTSTDLVLMITKKLRQAGVQGAFVEFFGPSLKELSVADRATISNMCPEYGALVGFFPIDEITIQYLAQSGRDKSHIETVEKYMKTVKMFRSSDE----NENIRFASIIEIDLSDIIPCVSGPKRTKDKVSINEIAADFKSALHLKEGPKGYGLSQGQGHVAFSVNIDGEYFTVGHGTVLLAAISSCTNTSNPSVMLGAGLLAKKAVECGLSVPKVVKTSLAPGSGVVTSYLQESGVMPYLYMLGFEIVGYGCSTC-----SYNSGPNLP-DSIVQAIKQGNLVCCGLLSGNRNFEGRLD--PDIRANYLASPLMVIAYAIAGRIDIN 591
            D  R+N+ S      E F FL  V++ +  I    PG G++HQV LE  A      GG++     +GTD+HT    GLG++  GVG  DA  VM G    L FP+++G+R+ G +S ++   D++L + + L   G  GA VE+FGP    +S   + TI NM  E GA    F  DE   +YL  + R     E V      VK   ++D     N    F  +I+I+LS++ P ++GP          +++ +  + +  K     + +                        V  + I SCTN+S   +   A  +A+   + GL +       + PGS ++    +  G++     LG  I    C  C      Y+   N P +SIV +              NRNF  R D  P+  A ++ASP +    A AGR+D N
Sbjct:  107 DLKRANEVS-----NEVFDFLGSVSNKY-GIGFWAPGAGIIHQVVLENYA----FPGGMM-----IGTDSHTVNAGGLGMVAIGVGGADAVDVMAGMAWELKFPKLIGVRLTGKLSGWTAPKDVILKVAEILTAKGGTGAIVEYFGPGAIAMSCTGKGTICNMGAEIGATTSTFGYDESMERYLRATDR-----EAVADAANKVKEHLTADAEVYANPEQYFDQVIDINLSELGPLLNGPFTP-------DLSTNVGTEMTEKATKNDWPMK-----------------------VEWSLIGSCTNSSYEDLSR-ASSIAEFGQKNGLKLKS--NLGINPGSELIRFTTERDGILAPFENLGATIFTNACGPCIGQWARYDDPKNAPKNSIVHSF-------------NRNFAKRADGNPNTHA-FVASPELTAVIAFAGRLDFN 484          
The following BLAST results are available for this feature:
BLAST of EMLSAG00000007801 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO)
Total hits: 25
Match NameE-valueIdentityDescription
-0.000e+049.89symbol:ACO1 "Uncharacterized protein" species:9823... [more]
-0.000e+050.39symbol:ACO1 "Cytoplasmic aconitate hydratase" spec... [more]
-0.000e+050.39symbol:ACO1 "Cytoplasmic aconitate hydratase" spec... [more]
-0.000e+050.39symbol:ACO1 "Cytoplasmic aconitate hydratase" spec... [more]
-0.000e+050.55symbol:Aco1 "Cytoplasmic aconitate hydratase" spec... [more]
-0.000e+049.56symbol:Aco1 "aconitase 1" species:10090 "Mus muscu... [more]
-0.000e+050.55symbol:Aco1 "Cytoplasmic aconitate hydratase" spec... [more]
-0.000e+050.55symbol:Aco1 "aconitase 1, soluble" species:10116 "... [more]
-0.000e+050.06symbol:ACO1 "Cytoplasmic aconitate hydratase" spec... [more]
-0.000e+050.06symbol:ACO1 "Cytoplasmic aconitate hydratase" spec... [more]

Pages

back to top
BLAST of EMLSAG00000007801 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA)
Total hits: 8
Match NameE-valueIdentityDescription
gi|592766715|gb|GAXK01187853.1|0.000e+049.35TSA: Calanus finmarchicus comp11210_c2_seq1 transc... [more]
gi|592778709|gb|GAXK01175859.1|4.625e-4025.47TSA: Calanus finmarchicus comp2443_c8_seq1 transcr... [more]
gi|592778707|gb|GAXK01175861.1|8.758e-2627.59TSA: Calanus finmarchicus comp2443_c9_seq2 transcr... [more]
gi|592778708|gb|GAXK01175860.1|8.797e-2627.59TSA: Calanus finmarchicus comp2443_c9_seq1 transcr... [more]
gi|592778705|gb|GAXK01175863.1|5.197e-1326.17TSA: Calanus finmarchicus comp2443_c9_seq4 transcr... [more]
gi|592778706|gb|GAXK01175862.1|9.196e-1326.17TSA: Calanus finmarchicus comp2443_c9_seq3 transcr... [more]
gi|592778704|gb|GAXK01175864.1|3.312e-1028.36TSA: Calanus finmarchicus comp2443_c9_seq5 transcr... [more]
gi|592935787|gb|GAXK01022766.1|1.896e+041.18TSA: Calanus finmarchicus comp1075233_c0_seq1 tran... [more]
back to top
BLAST of EMLSAG00000007801 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self)
Total hits: 3
Match NameE-valueIdentityDescription
EMLSAP000000078010.000e+0100.00pep:novel supercontig:LSalAtl2s:LSalAtl2s457:64181... [more]
EMLSAP000000001180.000e+048.16pep:novel supercontig:LSalAtl2s:LSalAtl2s101:49679... [more]
EMLSAP000000080833.375e-2427.01pep:novel supercontig:LSalAtl2s:LSalAtl2s481:17158... [more]
back to top
BLAST of EMLSAG00000007801 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
gi|3123225|sp|P21399.3|ACOC_HUMAN0.000e+050.39RecName: Full=Cytoplasmic aconitate hydratase; Sho... [more]
gi|122145596|sp|Q0VCU1.1|ACOC_BOVIN0.000e+050.39RecName: Full=Cytoplasmic aconitate hydratase; Sho... [more]
gi|341940613|sp|P28271.3|ACOC_MOUSE0.000e+049.56RecName: Full=Cytoplasmic aconitate hydratase; Sho... [more]
gi|2492645|sp|Q63270.1|ACOC_RAT0.000e+050.55RecName: Full=Cytoplasmic aconitate hydratase; Sho... [more]
gi|2492644|sp|Q90875.1|ACOC_CHICK0.000e+050.06RecName: Full=Cytoplasmic aconitate hydratase; Sho... [more]
gi|266391|sp|Q01059.1|ACOC_RABIT0.000e+050.50RecName: Full=Cytoplasmic aconitate hydratase; Sho... [more]
gi|60392492|sp|Q62751.2|IREB2_RAT0.000e+045.63RecName: Full=Iron-responsive element-binding prot... [more]
gi|341940838|sp|Q811J3.2|IREB2_MOUSE0.000e+045.42RecName: Full=Iron-responsive element-binding prot... [more]
gi|254806047|sp|B3VKQ2.1|IREB2_PIG0.000e+045.40RecName: Full=Iron-responsive element-binding prot... [more]
gi|82082649|sp|Q5ZLQ4.1|IREB2_CHICK0.000e+045.43RecName: Full=Iron-responsive element-binding prot... [more]

Pages

back to top
BLAST of EMLSAG00000007801 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods)
Total hits: 25
Match NameE-valueIdentityDescription
XP_392993.20.000e+050.38PREDICTED: cytoplasmic aconitate hydratase-like [A... [more]
EFX65502.10.000e+049.46putative aconitate hydratase 1 [Daphnia pulex][more]
EEB16996.10.000e+049.62aconitase, putative [Pediculus humanus corporis][more]
EAA04062.50.000e+048.76AGAP007258-PA [Anopheles gambiae str. PEST][more]
AAF54529.10.000e+049.46iron regulatory protein 1B [Drosophila melanogaste... [more]
AAF56051.10.000e+049.62iron regulatory protein 1A [Drosophila melanogaste... [more]
gb|EFA02996.1|0.000e+048.26Cytoplasmic aconitate hydratase-like Protein [Trib... [more]
gb|KFM82338.1|1.540e-2053.36hypothetical protein X975_14216, partial [Stegodyp... [more]
gb|EEC16473.1|0.000e+046.89RNA-binding translational regulator IRP, putative,... [more]
gb|EEC02132.1|0.000e+043.73aconitase/homoaconitase, putative, partial [Ixodes... [more]

Pages

back to top
BLAST of EMLSAG00000007801 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017))
Total hits: 25
Match NameE-valueIdentityDescription
gi|758375086|gb|AJO69942.1|6.312e-8098.85IRP1B [Lepeophtheirus salmonis][more]
gi|817083481|ref|XP_012264349.1|0.000e+050.93PREDICTED: cytoplasmic aconitate hydratase-like [A... [more]
gi|852779352|ref|XP_012882096.1|0.000e+049.56PREDICTED: cytoplasmic aconitate hydratase [Dipodo... [more]
gi|395855812|ref|XP_003800343.1|0.000e+050.22PREDICTED: cytoplasmic aconitate hydratase [Otolem... [more]
gi|335296435|ref|XP_003357777.1|0.000e+049.89PREDICTED: cytoplasmic aconitate hydratase [Sus sc... [more]
gi|585642402|ref|XP_006881316.1|0.000e+050.17PREDICTED: cytoplasmic aconitate hydratase [Elepha... [more]
gi|820997834|ref|XP_012364575.1|0.000e+050.50PREDICTED: cytoplasmic aconitate hydratase isoform... [more]
gi|1012010101|ref|XP_015993994.1|0.000e+049.83PREDICTED: cytoplasmic aconitate hydratase [Rouset... [more]
gi|795201739|ref|XP_011804047.1|0.000e+050.17PREDICTED: cytoplasmic aconitate hydratase isoform... [more]
gi|743742248|ref|XP_010965658.1|0.000e+050.17PREDICTED: cytoplasmic aconitate hydratase isoform... [more]

Pages

back to top
BLAST of EMLSAG00000007801 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins)
Total hits: 10
Match NameE-valueIdentityDescription
snap_masked-scaffold481_size160081-processed-gene-0.60.000e+049.18protein:Tk12153 transcript:snap_masked-scaffold481... [more]
maker-scaffold1622_size33238-snap-gene-0.110.000e+049.18protein:Tk00863 transcript:maker-scaffold1622_size... [more]
maker-scaffold463_size163741-snap-gene-0.30.000e+043.65protein:Tk05403 transcript:maker-scaffold463_size1... [more]
snap_masked-scaffold2708_size13032-processed-gene-0.30.000e+041.76protein:Tk01688 transcript:snap_masked-scaffold270... [more]
snap_masked-scaffold5331_size4740-processed-gene-0.20.000e+039.81protein:Tk02592 transcript:snap_masked-scaffold533... [more]
snap_masked-scaffold9883_size2308-processed-gene-0.00.000e+039.82protein:Tk01508 transcript:snap_masked-scaffold988... [more]
maker-scaffold615_size123629-snap-gene-0.29.182e-4626.81protein:Tk01943 transcript:maker-scaffold615_size1... [more]
snap_masked-scaffold8621_size2665-processed-gene-0.02.541e-4028.13protein:Tk07776 transcript:snap_masked-scaffold862... [more]
maker-scaffold6_size1037037-snap-gene-7.01.899e-3630.04protein:Tk01301 transcript:maker-scaffold6_size103... [more]
maker-scaffold8901_size2576-snap-gene-0.02.196e-3428.54protein:Tk10445 transcript:maker-scaffold8901_size... [more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
LSalAtl2s457supercontigLSalAtl2s457:64181..67196 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
ensembl2013-09-26 .965016
Blast vs. GO2014-04-02
TblastN vs C. finmarchicus TSA2014-05-09
Blastp vs. self2014-05-10
Blastp vs. SwissProt2017-02-10
Blastp vs. Selected Arthropods2017-02-20
Blastp vs. NR (2/2017)2017-02-20
Blastp vs. Tigriopus kingsejongensis proteins2018-04-18
Properties
Property NameValue
NotePutative cytoplasmic aconitate hydratase, iron regulatory protein
Logic nameensemblgenomes
EvidenceManual
Descriptionmaker-LSalAtl2s457-snap-gene-0.30
Biotypeprotein_coding
Cross References
External references for this gene
DatabaseAccession
Ensembl Metazoa (gene)EMLSAG00000007801 (primary cross-reference)
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
EMLSAT00000007801EMLSAT00000007801-703648Lepeophtheirus salmonismRNA


Synonyms
The feature 'EMLSAG00000007801' has the following synonyms
Synonym
IRP1B
irp1b
Sequences
The following sequences are available for this feature:

gene from alignment at LSalAtl2s457:64181..67196+

Legend: mRNA
Hold the cursor over a type above to highlight its positions in the sequence below.
>EMLSAG00000007801-690567 ID=EMLSAG00000007801-690567|Name=EMLSAG00000007801|organism=Lepeophtheirus salmonis|type=gene|length=3016bp|location=Sequence derived from alignment at LSalAtl2s457:64181..67196+ (Lepeophtheirus salmonis)
ATGAAAGAAGGGCCCTCATCAGGGACTATGGAAGATGAAGACCTTCTCAA GGATTTCCAAGTTGGGGAAAGAAGCTACAAATATTACGACGTAACCCAAA TCCAGGGCTATGAGGAACTCCCTTACTCCTTGCGTGTTCTCCTGGAGTGT GCCGTTCGAAAGCGTTCGGAAACGCAAGGACAAGTCTGGAAGGATGTTTA TGAACGGATTTTGAGTGTGTTGAGCGGATGTGAAGAGGACTNCTGAGGAA GATGACGATATCCTATTTCATCCAGGGCGAGTTCTTCTTCAGGATTTCAC AGGAGTTCCAGCATTGATCGATTTAGCAGCGATCCGTGAATCTGTATCCA AGTCCGGTGGTTGTCCGGATGTGGTGGACAGTCTTTGTCCAGCAGATCTG GTTGTAGATCACTGTGTTCAAGTGGACTACAACCAAATCAAGCAGCAACT GTCAAGYCCGCCTGATCCTTCTCCCAAGACCCCGGTTCTCGGGGGTTCGA TGCAGCCTTGTCCCACCGTGATCGTTCACTCCACTTTCCCTCCCCCTTTC CTGGCCTATCCTCCACCTCCGCCCATTTATACGCTCCCTGCATTCTACCC CATTTCAAGCTATCAAYCCAAGGTAGTGGCCCCTTCYCCGGCATCCAATA CTTCAAATCGCTCTGTTCCTCCAATGGACAACCCTGGACTTCCAATTCAA GATGATATTTGCCCATTTCATCAAAAAATGTCTTATTGGGCCGATGCTCT GCGTTCAAATCAGACATCCGAATTTGAGCGCAATAAGGAACGTTTCATCT TTCTAAAATGGGTTAATTCTGCCTTCAAAAATATCACCGTGATTCCTCCT GGAACAGGAGTGATGCATCAAGTGAATTTAGAATATCTTGCCAGAGTGGT GACGTGTCAAGGAGGTGTTCTCTTTCCAGACTCTGTTGTGGGGACAGACA CTCATACTACAATGATTAATGGGCTAGGTGTACTTGGATGGGGTGTTGGG ACTCTTGATGCACAAGCTGTTATGTTTGGACATCCTGTTACTTTGAGTTT TCCTCGTGTAGTTGGTATCCGTATAAAAGGTGTTATATCTGACTACTCGA CATCCACTGACTTAGTGTTAATGATAACGAAGAAGCTACGTCAAGCAGGA GTACAAGGAGCGTTTGTTGAATTCTTTGGTCCCAGCCTGAAGGAATTGAG TGTTGCTGATCGAGCTACGATTTCTAATATGTGCCCTGAGTATGGAGCAT TGGTTGGCTTTTTTCCAATTGATGAAATTACAATTCAATATCTTGCACAA TCTGGGAGGGATAAATCTCATATAGAAACTGTGGAAAAGTACATGAAAAC TGTCAAAATGTTTCGCTCCTCGGATGAAAATGAAAACATCAGATTTGCTT CTATTATTGAAATTGATTTGTCTGATATTATTCCTTGTGTATCTGGTCCA AAAAGGACCAAAGACAAAGTATCAATCAATGAAATAGCAGCGGATTTTAA GTCTGCATTACACTTAAAAGAGGGACCTAAAGGATATGGGTTATCACAAG GACAAGGTCATGTTGCTTTTTCTGTGAACATTGATGGAGAATATTTCACA GTAGGCCATGGAACTGTTTTACTAGCAGCTATTTCATCATGTACAAATAC AAGCAATCCTTCTGTAATGCTTGGAGCCGGTCTTTTAGCTAAAAAGGCCG TAGAATGTGGTTTGAGCGTGCCAAAAGTAGTAAAGACAAGTTTAGCACCT GGAAGTGGGGTCGTAACGTCGTATTTACAAGAAAGTGGTGTAATGCCTTA TCTTTACATGTTGGGATTCGAAATCGTGGGCTATGGATGCTCTACATGTT CTTATAATAGTGGGCCAAATCTTCCTGATTCAATTGTTCAAGCTATCAAG CAAGGAAATTTGGTATGTTGTGGCCTCTTGTCAGGAAATAGAAATTTCGA AGGTCGATTAGATCCCGATATTAGAGCAAATTATTTGGCCTCTCCACTTA TGGTTATTGCTTATGCTATCGCCGGTCGTATCGATATAAATCTTGATAGA GAACCATTGGGTTTTAACTCTCACACAGGAGAAGCCATTTTCTTGAAGAA TATTTGGCCTTCTCGACAAGAAATTCAAGAGATAGAGAGAAAACTAGTTA TTCCTGGCATATATAGACAAGTTTATTCAAAAGTATCTGTTGGCAATAAA CACTGGGACTCTTTGTCTGTACCTAATTCTGTTGATAAGTTTCCTTGGTC AAGTGACTCAACTTACATAAAGTGTCCCGAATATATTAAGGAAATAGGTT CTAATGCACGTAATTGGAAAAATATGCGTTGTTTGTTAAAATTAGGAGAC AATATAACATCAGATCACATCAGCCCTGCTGGAAGTATTACTCGTAGTAG TCCTGCTGCAGAATATTTATCGTCTCTTGGACTTGCTCCGAGGGAATATA ATTCTTATGGTGCTCGAAGAGGTAATTACCATGTTATGGTTCGTGGAACA TTTTCTAATATGCGTCTACAGAATCATTTATTGAACAAAGTTGGACCTTA TACACTGCACTTGCCCTCTGAAGTAACAACCACCATTTTTGAGGCTTCAG AACGCTATAAAAACGATGGAGTGTCTCTATTTGCTATTGGTGGTAAGAAT TTTGGAAGAGGAACTTCGAGGGATTGGGCAACTAGAGGTCCATTTTTATT AGGAGTTCGTGCAATTTTAGCCGTCTCCTTTGATCCAACATATCGCTCGA ATCTCGTCAAAACTGGAATTCTTCCCCTGCAAATTACAAGTATATCATAT GAGTCTCTTAAAGGAACTGAATGCCTTAGCATTGATATAAGAGACAATAT TACACCTAAATGTCTCATCGATGTGGTTGTTGGAAAGGCAGAAAGATCCT TTAAAGCTGTTGTTCGAGTCGACAATGACTATGAAACAGATGTCTTTCAT GCAGGGGGTGTAATTGCACAAATTGTCAGCAAAACAAAGGACAAGACGAC ATGCGAGACAGCTTGA
back to top
Add to Basket