EMLSAG00000004823, EMLSAG00000004823-687589 (gene) Lepeophtheirus salmonis
Overview
Associated RNAi Experiments
Nothing found Homology
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592951992|gb|GAXK01006561.1| (TSA: Calanus finmarchicus comp68346_c0_seq1 transcribed RNA sequence) HSP 1 Score: 41.2022 bits (95), Expect = 7.397e-5 Identity = 22/77 (28.57%), Postives = 41/77 (53.25%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKF +G++F E ++G T + MDG +++K ++ +K + F + T + GV CTQ+++R Sbjct: 228 MELKFRLGEEFDEVATDGRKCRTTVTMDGNKLIVNQKAVR-SGEKDVMDVREFTEDGLTM--KWTAGGVTCTQLYKR 449
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592839066|gb|GAXK01118478.1| (TSA: Calanus finmarchicus comp124765_c0_seq1 transcribed RNA sequence) HSP 1 Score: 39.6614 bits (91), Expect = 2.021e-4 Identity = 24/77 (31.17%), Postives = 42/77 (54.55%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 ++LKF++G++F+E ++G T + M+G ++K LK +K + F D T ++ GV CTQV+ R Sbjct: 242 IELKFKLGEEFEEDTTDGRKCKTTVTMEGNKLITNQKALK-SGEKDVMVVRDFTDEGLTM--KMTTGGVTCTQVYAR 463
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592951991|gb|GAXK01006562.1| (TSA: Calanus finmarchicus comp68346_c0_seq2 transcribed RNA sequence) HSP 1 Score: 32.7278 bits (73), Expect = 5.521e-2 Identity = 13/40 (32.50%), Postives = 25/40 (62.50%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILK 40 M+LKF +G++F E ++G T + MDG +++K ++ Sbjct: 228 MELKFRLGEEFDEVATDGRKCRTTVTMDGNKLIVNQKAVR 347
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592781364|gb|GAXK01173204.1| (TSA: Calanus finmarchicus comp132107_c0_seq1 transcribed RNA sequence) HSP 1 Score: 31.5722 bits (70), Expect = 1.404e-1 Identity = 22/77 (28.57%), Postives = 37/77 (48.05%), Query Frame = 0 Query: 2 QLKFEVGKKFKETPSEGCTVDTLIA-MDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 ++KF +GK+F+E G V I M+G +S K K + +++ F D T V V+C ++F+R Sbjct: 96 EIKFIIGKEFEEKAPMGGKVQKAIGTMEGENLVVSSKTEKGEMRRT----FVFTDGGMTMNMHAVAQDVRCKRIFKR 314
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592866507|gb|GAXK01091055.1| (TSA: Calanus finmarchicus comp2038368_c0_seq1 transcribed RNA sequence) HSP 1 Score: 30.4166 bits (67), Expect = 5.690e-1 Identity = 19/46 (41.30%), Postives = 23/46 (50.00%), Query Frame = 0 Query: 9 KKFKETPSEGCTVDTLIAMDG-ATTFISEKILKLDSQKSTKTICHF 53 KKF SEGCT D ++ MD A EK L+S+ K HF Sbjct: 1187 KKFNLEYSEGCTADYVLVMDSDANQDDKEKTNGLESKHFEKICGHF 1324
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592871903|gb|GAXK01085659.1| (TSA: Calanus finmarchicus comp78465_c1_seq11 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.718e+0 Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = 0 Query: 15 PSEGCTVDTLI-AMDGATTFISEKILKLDSQKSTKTICHFKDPKC 58 PS C +D D A TFI IL L++Q + ++C P+C Sbjct: 394 PS*NCLLDIFY*NNDLALTFIDGNILFLNAQCAVLSLCKTTSPQC 528
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592871905|gb|GAXK01085657.1| (TSA: Calanus finmarchicus comp78465_c1_seq9 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.721e+0 Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = 0 Query: 15 PSEGCTVDTLI-AMDGATTFISEKILKLDSQKSTKTICHFKDPKC 58 PS C +D D A TFI IL L++Q + ++C P+C Sbjct: 394 PS*NCLLDIFY*NNDLALTFIDGNILFLNAQCAVLSLCKTTSPQC 528
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592871911|gb|GAXK01085651.1| (TSA: Calanus finmarchicus comp78465_c1_seq3 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.734e+0 Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = 0 Query: 15 PSEGCTVDTLI-AMDGATTFISEKILKLDSQKSTKTICHFKDPKC 58 PS C +D D A TFI IL L++Q + ++C P+C Sbjct: 394 PS*NCLLDIFY*NNDLALTFIDGNILFLNAQCAVLSLCKTTSPQC 528
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592871913|gb|GAXK01085649.1| (TSA: Calanus finmarchicus comp78465_c1_seq1 transcribed RNA sequence) HSP 1 Score: 28.8758 bits (63), Expect = 1.736e+0 Identity = 16/45 (35.56%), Postives = 23/45 (51.11%), Query Frame = 0 Query: 15 PSEGCTVDTLI-AMDGATTFISEKILKLDSQKSTKTICHFKDPKC 58 PS C +D D A TFI IL L++Q + ++C P+C Sbjct: 394 PS*NCLLDIFY*NNDLALTFIDGNILFLNAQCAVLSLCKTTSPQC 528
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Match: gi|592897683|gb|GAXK01060692.1| (TSA: Calanus finmarchicus comp3206703_c0_seq1 transcribed RNA sequence) HSP 1 Score: 27.7202 bits (60), Expect = 3.425e+0 Identity = 11/29 (37.93%), Postives = 19/29 (65.52%), Query Frame = 0 Query: 41 LDSQKSTKTICHFKDPKCTQVSEVVGSGV 69 LD+ KS+ TI F+D + ++ E G+G+ Sbjct: 284 LDTDKSSLTISDFRDERNLELEETFGNGL 370
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Match: EMLSAP00000004823 (pep:novel supercontig:LSalAtl2s:LSalAtl2s254:346296:346535:1 gene:EMLSAG00000004823 transcript:EMLSAT00000004823 description:"augustus_masked-LSalAtl2s254-processed-gene-3.2") HSP 1 Score: 159.458 bits (402), Expect = 4.088e-52 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFERYK 79 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFERYK Sbjct: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFERYK 79
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Match: EMLSAP00000004641 (pep:novel supercontig:LSalAtl2s:LSalAtl2s2426:5738:7142:1 gene:EMLSAG00000004641 transcript:EMLSAT00000004641 description:"maker-LSalAtl2s2426-augustus-gene-0.3") HSP 1 Score: 108.227 bits (269), Expect = 2.512e-31 Identity = 52/77 (67.53%), Postives = 65/77 (84.42%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKFE GKKF+ET S+G TVDTL+ +DG TTF+SE++ K D QKSTKT+ FK+ KCTQ++EVVGS VKCTQVFE+ Sbjct: 60 MELKFEXGKKFEETTSDGRTVDTLVTLDGPTTFVSEQMAKKDGQKSTKTVRDFKEGKCTQITEVVGSDVKCTQVFEK 136
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Match: EMLSAP00000004244 (pep:novel supercontig:LSalAtl2s:LSalAtl2s222:241073:242209:-1 gene:EMLSAG00000004244 transcript:EMLSAT00000004244 description:"snap_masked-LSalAtl2s222-processed-gene-2.5") HSP 1 Score: 87.8113 bits (216), Expect = 9.007e-24 Identity = 43/66 (65.15%), Postives = 53/66 (80.30%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVG 66 M+LKF+VGK+F+ET S+G TVDTL+ MDG TTF+ E+ K D QKSTKT+ KD KCTQV+EVVG Sbjct: 33 MELKFKVGKEFEETXSDGRTVDTLVTMDGPTTFVPEQTAKNDGQKSTKTVRDIKDGKCTQVTEVVG 98
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Match: EMLSAP00000004759 (pep:novel supercontig:LSalAtl2s:LSalAtl2s250:476390:476626:1 gene:EMLSAG00000004759 transcript:EMLSAT00000004759 description:"augustus_masked-LSalAtl2s250-processed-gene-4.0") HSP 1 Score: 80.8777 bits (198), Expect = 2.198e-21 Identity = 44/75 (58.67%), Postives = 54/75 (72.00%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVF 75 M+LKF+VGKKF+E S+G V+TL MDG TTF E+I K D QK+TKT FKD K Q+ +VVGS V+ TQVF Sbjct: 1 MELKFQVGKKFEEATSDGRPVNTLDTMDGPTTFDFEQITKKDGQKNTKTGRDFKDGKYIQIIKVVGSDVQYTQVF 75
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Match: EMLSAP00000008820 (pep:novel supercontig:LSalAtl2s:LSalAtl2s549:632112:633454:-1 gene:EMLSAG00000008820 transcript:EMLSAT00000008820 description:"maker-LSalAtl2s549-snap-gene-6.7") HSP 1 Score: 68.9366 bits (167), Expect = 1.401e-16 Identity = 36/57 (63.16%), Postives = 44/57 (77.19%), Query Frame = 0 Query: 20 TVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFE 76 TV+TL+ TTF+SE+I + D QKSTKT+ FKD KCTQ +EVVGS VKC+QVFE Sbjct: 43 TVNTLV-----TTFVSEQIAEKDGQKSTKTVRDFKDGKCTQATEVVGSDVKCSQVFE 94
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Match: EMLSAP00000013048 (pep:novel supercontig:LSalAtl2s:LSalAtl2s9:378121:380047:-1 gene:EMLSAG00000013048 transcript:EMLSAT00000013048 description:"snap_masked-LSalAtl2s9-processed-gene-3.0") HSP 1 Score: 50.0618 bits (118), Expect = 1.464e-9 Identity = 29/74 (39.19%), Postives = 43/74 (58.11%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLD-SQKSTKTICHFKDPKCTQVSEVVGSGVKCTQ 73 M+L F+ K+ +E + MD AT F++E+I K + K + +FKD KCT+V+EV+GS KCTQ Sbjct: 55 MELSFKSRKEVREKYLRRLYWGHSVTMDRATIFVTEQIAKESWTDKPIPFLTNFKDGKCTKVTEVIGSEFKCTQ 128
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Match: EMLSAP00000001274 (pep:novel supercontig:LSalAtl2s:LSalAtl2s120:334020:334389:1 gene:EMLSAG00000001274 transcript:EMLSAT00000001274 description:"maker-LSalAtl2s120-snap-gene-3.2") HSP 1 Score: 43.1282 bits (100), Expect = 3.871e-7 Identity = 22/38 (57.89%), Postives = 25/38 (65.79%), Query Frame = 0 Query: 40 KLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 K D QK+ KT+C FK KC V+ VVGS K TQVFE Sbjct: 52 KKDGQKTNKTVCDFKHGKCMLVTLVVGSKYKSTQVFEN 89
BLAST of EMLSAG00000004823 vs. nr
Match: gi|225712974|gb|ACO12333.1| (Cellular retinoic acid-binding protein 2 [Lepeophtheirus salmonis]) HSP 1 Score: 110.153 bits (274), Expect = 2.182e-29 Identity = 53/77 (68.83%), Postives = 66/77 (85.71%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKFEVGKKF+ET S+G TVDTL+ +DG TTF+SE++ K D QKSTKT+ FK+ KCTQ++EVVGS VKCTQVFE+ Sbjct: 56 MELKFEVGKKFEETTSDGRTVDTLVTLDGPTTFVSEQMAKKDGQKSTKTVRDFKEGKCTQITEVVGSDVKCTQVFEK 132
BLAST of EMLSAG00000004823 vs. nr
Match: gi|155966175|gb|ABU41042.1| (putative cellular retinoic acid/retinol binding protein [Lepeophtheirus salmonis] >gi|225713860|gb|ACO12776.1| Cellular retinoic acid-binding protein 2 [Lepeophtheirus salmonis] >gi|290463031|gb|ADD24563.1| Cellular retinoic acid-binding protein 2 [Lepeophtheirus salmonis] >gi|290561270|gb|ADD38037.1| Cellular retinoic acid-binding protein 2 [Lepeophtheirus salmonis]) HSP 1 Score: 110.153 bits (274), Expect = 2.217e-29 Identity = 53/77 (68.83%), Postives = 66/77 (85.71%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKFEVGKKF+ET S+G TVDTL+ +DG TTF+SE++ K D QKSTKT+ FK+ KCTQ++EVVGS VKCTQVFE+ Sbjct: 60 MELKFEVGKKFEETTSDGRTVDTLVTLDGPTTFVSEQMAKKDGQKSTKTVRDFKEGKCTQITEVVGSDVKCTQVFEK 136
BLAST of EMLSAG00000004823 vs. nr
Match: gi|225718480|gb|ACO15086.1| (Cellular retinoic acid-binding protein 2 [Caligus clemensi]) HSP 1 Score: 109.383 bits (272), Expect = 4.317e-29 Identity = 54/77 (70.13%), Postives = 64/77 (83.12%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKFEVGKKF+ET S+G VDTL+ +DG TTF+SE+I K D QKS KTI FKD KCTQ++EVVGS VKCTQVFE+ Sbjct: 60 MELKFEVGKKFEETTSDGRVVDTLVTLDGPTTFVSEQIAKKDGQKSAKTIRDFKDGKCTQMTEVVGSDVKCTQVFEK 136
BLAST of EMLSAG00000004823 vs. nr
Match: gi|225710890|gb|ACO11291.1| (Cellular retinoic acid-binding protein 2 [Caligus rogercresseyi]) HSP 1 Score: 102.449 bits (254), Expect = 2.887e-26 Identity = 50/77 (64.94%), Postives = 62/77 (80.52%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKFEVGKKF+ET S+G VDTL+ ++G T F+SE+ K D KSTKTI F+D KCTQ++EVVGS VKCTQVFE+ Sbjct: 60 MELKFEVGKKFEETTSDGRLVDTLVTLEGPTKFVSEQTAKKDGHKSTKTIRDFQDGKCTQITEVVGSDVKCTQVFEK 136
BLAST of EMLSAG00000004823 vs. nr
Match: gi|225710698|gb|ACO11195.1| (Cellular retinoic acid-binding protein 2 [Caligus rogercresseyi]) HSP 1 Score: 102.064 bits (253), Expect = 3.256e-26 Identity = 50/77 (64.94%), Postives = 62/77 (80.52%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKFEVGKKF+ET S+G VDTL+ ++G T F+SE+ K D KSTKTI F+D KCTQ++EVVGS VKCTQVFE+ Sbjct: 60 MELKFEVGKKFEETTSDGRLVDTLVTLEGPTKFVSEQTAKKDGHKSTKTIRDFQDGKCTQITEVVGSDVKCTQVFEK 136
BLAST of EMLSAG00000004823 vs. nr
Match: gi|225709644|gb|ACO10668.1| (Cellular retinoic acid-binding protein 2 [Caligus rogercresseyi]) HSP 1 Score: 102.064 bits (253), Expect = 4.185e-26 Identity = 50/77 (64.94%), Postives = 62/77 (80.52%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKFEVGKKF+ET S+G VDTL+ ++G T F+SE+ K D KSTKTI F+D KCTQ++EVVGS VKCTQVFE+ Sbjct: 60 MKLKFEVGKKFEETTSDGRLVDTLVTLEGPTKFVSEQTAKKDGHKSTKTIRDFQDGKCTQITEVVGSDVKCTQVFEK 136
BLAST of EMLSAG00000004823 vs. nr
Match: gi|961375140|gb|ALS04314.1| (cellular retinoic acid-binding protein 2 [Acartia pacifica]) HSP 1 Score: 52.7582 bits (125), Expect = 5.815e-7 Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKF+VG++F ET +G V ++ +DG F+ E+ K + QKSTK+I F +C + G + C Q F+R Sbjct: 60 MELKFKVGEEFDETTPDGREVKAIVTLDG-NKFVCEQKAKKEGQKSTKSIREFNGEECIYTMTIDGMDLVCVQKFKR 135
BLAST of EMLSAG00000004823 vs. nr
Match: gi|961375138|gb|ALS04313.1| (cellular retinoic acid-binding protein 2 [Acartia pacifica] >gi|961375142|gb|ALS04315.1| cellular retinoic acid-binding protein 2 [Acartia pacifica]) HSP 1 Score: 52.7582 bits (125), Expect = 6.134e-7 Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKF+VG++F ET +G V ++ +DG F+ E+ K + QKSTK+I F +C + G + C Q F+R Sbjct: 60 MELKFKVGEEFDETTPDGREVKAIVTLDG-NKFVCEQKAKKEGQKSTKSIREFNGDECIYTMTIDGMDLVCVQKFKR 135
BLAST of EMLSAG00000004823 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold747_size103044-snap-gene-0.14 (protein:Tk12097 transcript:maker-scaffold747_size103044-snap-gene-0.14-mRNA-1 annotation:"cellular retinoic acid-binding protein 2") HSP 1 Score: 62.3882 bits (150), Expect = 1.749e-14 Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKF++G++F ET +G V ++ +G +FIS + K D QKSTK++ FK + Q EV+G+ + CTQ F+R Sbjct: 59 MELKFKLGEEFDETTPDGREVKAVVVQEG-NSFISTQTAKKDGQKSTKSVREFKGDEVIQTMEVLGTDIVCTQTFKR 134
BLAST of EMLSAG00000004823 vs. Tigriopus kingsejongenis genes
Match: maker-scaffold25_size650667-snap-gene-0.20 (protein:Tk06682 transcript:maker-scaffold25_size650667-snap-gene-0.20-mRNA-1 annotation:"cellular retinoic acid-binding protein 2") HSP 1 Score: 62.3882 bits (150), Expect = 1.749e-14 Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = 0 Query: 1 MQLKFEVGKKFKETPSEGCTVDTLIAMDGATTFISEKILKLDSQKSTKTICHFKDPKCTQVSEVVGSGVKCTQVFER 77 M+LKF++G++F ET +G V ++ +G +FIS + K D QKSTK++ FK + Q EV+G+ + CTQ F+R Sbjct: 59 MELKFKLGEEFDETTPDGREVKAVVVQEG-NSFISTQTAKKDGQKSTKSVREFKGDEVIQTMEVLGTDIVCTQTFKR 134 The following BLAST results are available for this feature:
BLAST of EMLSAG00000004823 vs. GO
Analysis Date: 2014-04-02 (Blast vs. GO) Total hits: 0
BLAST of EMLSAG00000004823 vs. C. finmarchicus
Analysis Date: 2014-05-09 (TblastN vs C. finmarchicus TSA) Total hits: 11
Pagesback to top
BLAST of EMLSAG00000004823 vs. L. salmonis peptides
Analysis Date: 2014-05-10 (Blastp vs. self) Total hits: 7
BLAST of EMLSAG00000004823 vs. SwissProt
Analysis Date: 2017-02-10 (Blastp vs. SwissProt) Total hits: 0
BLAST of EMLSAG00000004823 vs. Select Arthropod Genomes
Analysis Date: 2017-02-20 (Blastp vs. Selected Arthropods) Total hits: 0
BLAST of EMLSAG00000004823 vs. nr
Analysis Date: 2017-02-20 (Blastp vs. NR (2/2017)) Total hits: 8
BLAST of EMLSAG00000004823 vs. Tigriopus kingsejongenis genes
Analysis Date: 2018-04-18 (Blastp vs. Tigriopus kingsejongensis proteins) Total hits: 2
Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Properties
Cross References
External references for this gene
Relationships
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene from alignment at LSalAtl2s254:346296..346535+ Legend: mRNA Hold the cursor over a type above to highlight its positions in the sequence below.>EMLSAG00000004823-687589 ID=EMLSAG00000004823-687589|Name=EMLSAG00000004823|organism=Lepeophtheirus salmonis|type=gene|length=240bp|location=Sequence derived from alignment at LSalAtl2s254:346296..346535+ (Lepeophtheirus salmonis)back to top Add to Basket
|